JFIF  x x C         C     "        } !1AQa "q2 #B R $3br %&'()*456789:CDEFGHIJSTUVWXYZcdefghijstuvwxyz        w !1AQ aq"2 B #3R br $4 % &'()*56789:CDEFGHIJSTUVWXYZcdefghijstuvwxyz   ?  N m? j EP ELF>Р@`2@8 @X?X?@@@55PPPP-P-P-S-S-S-888$$Ptd'''QtdRtdP-P-P-||GNU۝h)ЅSrwi$،Q MP@F`D%!" 1QHB@2H"SA Q!C*Q   x @!! 5BB@8XX CH0[ 2 "dB (@PBpC  @   PZP@h@,x *#jЂB pEMR 2 h$@0"B0  Ѐ @ D &xd2Df BXA31@@  QDP0͎BC# XRH4.@ #( @.2A@2R(BP@0H   LJQ PR  j"( B@ @H `"J@1 AA@Cx $H@B#pr ( $=02hJWB(H(0*MS"A $@ )AA!$JTq!=R@"%PHxB0P A0N " h0D)& )i01@@@  @!@ @B@2b bD D@@&PH0@b("@H @QH 2"`H  !* *HX  Ę@bPŊ@0)#H CCȄ idb8D@bC! @@F@@ L!2!$`"']H 0HF`&%@B$ 0  (TEE$r8U#XlP   F@0ZIgebaz 0&F"a/#$!φ$@$@@D  0 BHt %(H0)  CY8$K` 'BP !đ AJ,@!H SBAP   P@BaB R^@"@! 2"* %U BH!DR)*@C@R@D U "B cQh $ެ)*` (Hh(FX $4@*@P@ () ` h, P@F":@ @VB QHH  YB"B$@ B+ @ @@H@Cph $ pXB4$!P (0p +9h"*@ "PFB $( 2P %&" 3ÊЈ0BH"D"DID@,@"T @  @:Z@񢁄-8`@ @ (60 (B:DrĈ+@ #Ф@Jt Jp!@)8 &BDi@£Anijnrtvy{|    #$()+,/035789:>?@DFILOQSUVXZ^adgklntwy{}   !%()+,146:<>@EGJKNPRSUY[^bdfijmpqsuxz{|   #%&)*+,.03478<=@BDFGJMPQRUXZ\]^bceklmpquy{}  !#'(+,/2689;=?ABDFJMOPQSVXZ]bcgikqrsuz !"%')+,.01246:;<?BDGIMOQSUW[^_cefgjklnopruvy|~ !#%'),./0123589:<@BCEFKLMNOUX]^`chmopruwxz} "%'*+-/1234578<?@CDFHIMPQSTVXY\`cdfhikqrstuvwxz{}             # $ & + 1 4 6 : ; > ? A B C F 8(.$)}WI)FZguh #D[nP"ɛWPvyk; C.cPС t`8ms%8$rf=T?bD_j0c^=ם@#) ].VJxifSd}bm2b`5 ѕNBSc*eyo(8i?,BdhIdWkm{wWSG4D0g}5d;L'XEgV,w^Xӿ@rk21HoY=JGӁVxD)ھw}+ʒ5>oǠ#噓,U>wԡ$jXn -i( h`nIiK2OrF@R 06 ΛhsZ &zW?ΏDgǒЮPVIAI!m`,4 s%zH7#qBڌrBa ~*=)ݕh)`R`u1"&iy"ZPb~8vv.'V qȒh2/rIӦmڰ>`Nh6txB[LR^Vu 4H{͜P5bK!C9L8mFrao,SBƩ)gL!}02 x]ۼͱ;1ʵ*rR r^m<*p˔d꒑s/w<X%kТ(ģ@?R4өApZ-[C cW"гh}dtEr/y"#/8 ߤdG"Vτ9^a8~Z!|m97BCOpD@ GVQm`%ziߤQLcߺ ,zxԠieUpo,x(U _J5 Z}$䎣E4g}RG3TI,A}FErݲ׻eQ~S 3=kز~Eӧk m@rk|7:K4cg#޻dWqGuVœ2y4򎩴¾k֜sI7߷}ЌI攀+9]LǺ^.cD㤘7^Lf'#4?=ޗǢq1&h3pƒkq9^PpUȻ u,*h*mRXna΀* 8n]-n0-wme*Hu?l #b1 ImڨFaTqb$ aPcxS"FoƑ1R*TԈ+|FU,U2(qWX>({%ȓ,Tɋ*@1rꞋpF#b;:|  =,vE3!ݎ!ڟHnSouFI 8 eq2)'`H/t]6`UH TU2@2ԥ EWH”:oV]<˜Hrڬ`5ԟܚȁ<qrW ٍ^C=^i,B# d]쯺NΧW>Ⱥۗ//~o_6͏y#Ғ9 >7mZ$N)1(9)U82R( R[M:e$V,dZk5ky_:p}c`VNTGt2*βPi&!^dáZ\ЩFj'^}^`Jwg6'i7(} Gf#lX$V!fV;I ֌>`fhˑ ~' 1VTz(G}tNB|(v63oQJڵ>Ϝ}+i0h 3jz'U xP%%f\ XU6՞rNYU&e5I{|F}8䵼R RK$ <>Fā7j{]^ p?Y+}Ic6W8'"X~*/\aUFōy; <@cՍcuNua/o҃塓F]\axnEÉ̈0ϋWƨ۠ $fHd&Stȼ$e5[G#{د B_6i@SxzmW dzA1eIecy_3 I vr,oIaNg"cӪ=vsEa{tK6Gopղ.0t. jKusW(8fr:zjݜ 9mOЊaiͫɳ)M7='@GH')Gڅ=3" b?QP_{LWםҔFN'o/@MS sN%,B(3I7N~wHCEH@F-$D!@gh$]U=Dˬ9s9%2LRha\Fm 38WI)XB62XyOk%g;Іd[<R+l> 3M6Q:ILZLe7ڀY[z5"SQ1mmOpgСm]<'o- xR*u?"@y(-RW"kJYGcേ1ؑ,8~ZԸ}2!/.Eu6@UR1Z d$˾"9ƨK:dqw0ˎ TG<4\P{Q;;.w[_ҮnӀdȄ2(4j^\e496ڰь%223Baѳ 'Bp' Vm {LCij݁Q*g v$'9}ҢKj]b{RNȒCIu(NA͉U].HYWwmܮ|;2VJ9 8f)Q2mT4svnr 'ny`W_b|O] NڔF UI$llH@[Z z!j՘*Fy5=\4U ,Q `p>`-Giwݳ]5E[oPI !\2 f,ˋא[(̨u8 StG;bSYWVEU>@& 'bmMDog 6!XM݋:S|poG$K5x>n}&#%ĥnڛ~=hyW^C#>9TsPV2H򢱏(aJ0/bn  7ڋPU*9agN"fBr+x8 dCVtyFT̛;/XbJ$炌!<׋O>kTc?炌~(-z I` a?ZdIoֲ$kCX%}fWvGޘ$mW\ؖ`]f wW~Ha՟u*ǥAZ܍aWJvEO1^#n$pzꯌ, z)V]~ܪT8V{c`gaۘ d&+pj$(ttwgIq&h0T>d] ]I~<#FXG楖jbǢ]7YȊ$Kz%h0fȍI)O@$9pNq)UՋb?)ěuY?䏺&e 0n5"*tM+_%Ka\ ,Zeذa-4pPːИL3Bm`Ns3&GD[OoEC*3Z$`d]bd!Q݆(LI\h Y.ԭImX{)-nj"KBm|4l74[f+>"`+w #=1#g8nu"?ܺY^1^v;@p[Vl 8[Bշa 'hzxbb鹻 t&ق9/ֳ=6ou410!zràbveiKvK ^D^8t+hsZ`vB`1TlIu®!Աz)XO Ky\4Dr }_oUG/ר DW-1)+|l*y0Cʏ'.E3,qS>6׸x%clX5X5=F1y9 4\GCkhYVflX&2஌k+y{-&@?^V:|k)kyAC^\f}WUĚB5MF dt63`n*c<QAC[owFU[9B]̒,Z[( #JL6NV*RrI~Lβc2QS~sʨ+ᰀ([H(r@ȂBźZwy8P#CٍQui2z37yU?r@Ftnt#,?좦 H$hrPZm }ۮ3H6i D{ zV[=tV ]PvԬ뱢 ;JuMnMshSk 6O H'ץ/KԔ =aUt^`s1շWXDZB\=pqIs AI,K 3oQ0_zQ"2pEr5:t S|&&T҉VPHQV ))`d]d?WB8 +zA;3Į#sYf"Ԙ5J:FV&<ĺQXcf_DE#)_:ݪanař-[gfLIF֍&m3GS\p"Ot\:|yL 󐼏H ̠ak]y}\ȬÕ߸:cs2 p#-W+O8#zv YPu2)N c_SY4AWگZ[0 d,^mWud.z=7W>PTZ:;Nf1nkXDYpvWA_Ӎn@];NaE֋'Es&ʆ*ked&Ȭ%d#'L7Wg*~T"@fɵ M sv2zN'RV~|Y<])>u)ذj׍缥4VJm8kH4|nXqj(n͒cge"^΅{rBEc,nEd7A'ԂY"cIQZE$6ZF^XUǧ罏 vjGFrPlwH#%%lX$SYSl+-g/oP- E+CXdWAZt:/Se΍ESjO.\ul#3sΗ X.Ylĺ d?+d0rZsarxG+`Qݴz0w*#f}TQS5_a/d0wN>G1~fE&]>!xqF1.}9;UA" Kfwu&xD'`{o!5>ukaJsk.WIàϙKfE(N*BwKfA0!W=?|Hfk +Z_"%QCyޢ" d|NMaGr FL QGM ۰eduLI[I^;65Yl&1.j mN{x _tg=NMX3К']uI>ҔIEv<.V ~vgk;.NVO2P,̖ܗgqgoillSBgc= :s usCuD\tE `jSs× ژ Ty = ?KJo$ yG__7Wp9]_u= y~dd(Ü5tiv; bI >X=N|ŖIy&D eAgbe@v{ iז֢afʗXjWsWg9W ?$ lS[pfb0rX7wgԙx}y_v*Ov{, vW@Bi,Dҗ)ęyGrhF"Xhu̖bvU 6C r{NMs|c>` Grl{SiԗpB V^A!`B i77\,yN٘Q 9 Μg,>it yekug6[a|h#e 4Dty -nޙM_h  D?ޜT%sno <|J^ 5dMJb'7|:sB֜ #gtS{BB xGw;QOTCHCy%oixk |zgb/@\EMtbD0:`D֡(f/o]hRACe >\OkXg!85ʣO~>|Qnՙs O@}<&4 4"xW DioW@X *DtXT =  O/| 1`1p }5 H ^+ ML `; Ȧ  2 '' iC @4 5 %pR0&0>A 0VN e` @{@ R } ?+ T. y 7; 6 <  'J} ] 5m P#P| & D  Z !Ja p  m+ P@C 5Z'l )ԣ _~ OL p"g v&4C  t h PK"{! p@[ | {  q Q 'C/ T2 2 K ɻ =+b $c  ` I yD)  1, |* A/_/ 5|( T Ah VB  ,`] P]A ZD U @'.z 6   m y2/ +n2 u6 `L0. 3 ?X 0* X\ >xn0N i  T , 1.$ o! }JJN <:f `i;g vS p  68 Q$ > "[ @ZIF pM 4-y =` S_o h. W} G y'  pe g#S Pd݉ ? < ? Z " f) p  16  !] YG ܒ Ja |K4 !$  `ZK X0:# h?5 2MX i/ L } `_!m  0e ss K 0 y& 3  wQ3 4o :>1֤ ԛ P"a0P/Y O3/" b\  K e~ 9 @3D]! `  S P ? L <=1D '  n~  V *r l @  :\`014   W ;@ QT( Ij ЉO rl}n X @g ( 0 ^ 0)&0J 04 X* T0y &9 T0 YL  V} = >`s/.f @Qр p d`f P@RP , 6BhU1 p* @HC e ȓ c J F0՝ R04;}0 )9-@ 10* | 1t F >x<-h # /I Pmi i.p [K b  ^ .X j I @y *  Q* %  1@0$  /Y 7 J y ! {r0uf 7 !0b NS7 ?3!2 ? @aL 5K1jZ ` </C  Fk (k dE ' ;9! sHK eŚ  D   o O P&`" pN( $Rm _| !)z d0A `[08 nSm E1[ P'K %YsH ^|  go>1n pRS Ez  `` R * bx 1: Q@Z. x @-R 7  tt ^= ; 0x63 ~X/h1x K: s p8  1 " ( PgN  07 1P P)H/ ,b / /1 V px | P nT7 '; N$ I BƉ >   }  D PA ? #, 6B еHc z* ge9 p'q &  sz ۦ /~ I "k &E XlL 8_ Rv     / I V8G 0+B@0 ) M8Y @Z '{k  %  r _ ` m. @ +e p"K7 N0k u _c -&=(1ѥ 0{ .J QX&`_0z kw pK 1xKE Kn P~r Л 5 pc- >Y % eH  =n u ~o plb\ /, ? .R _^7  \w G Y M 1 ^8_ S}1  j 6Ȥ o j6n5 Zm F FOh [@f0* 5.? D [ P& 5 ^Z  C _h JjH0f, p|4 5 @3,8 -_ aBqu 01 ?dA U0/] \O# pK  PdE `  O0c ;  '#y <4 9 jC] a pi. * #Z * @F @|?60G ap =J n& `KKbG `[<`0  15 pZl/ x `" 7 B h pK  } 0 v)!  ıX~ { Z@ J    |Q 0I^ E X{  !,) >5 Pwx`[ [ I YE  5, @&`/ 0e4: p ^z Φ  |/  u c  З?Zn KKh/Y \J Pz 7 &K ki} 1 D   PXQ/[ n l EcXc К { 1 0{g 't`/' e # h46j }QQ ; [s E y p3P-Y @Nk /  P;/ X. {fe *  1J e= Q %_ /`0#t P@B:l Y x0) P\wl pi u2E 0B- W| Sz  O\ t 0J{U * ~e=/B  0 Kp uX5v ?( *XSP @  Xc (a  "  o q ( M I ٬J^ 9_\ - #  V M0- @_R M _L  kp>1] m X oY 1 !5 'o r 2 p&q   + ;   M&]0 `  zy: Yj ( @$  /8 ^ !/ P:0u  jO p"(]/>@ m Rv  k 0-" Pb!s ~   0 ɥ o  6'|7 0 K nk (s 2  7 D%@1 " / }ۑ c? Pi j' (z ? K> _  nwW "LK EPoo 9E 0F PfnZ  o& 0v ` @ *N@/ p ,`// p `  Br  GA}  4I `O< 'a P 'Wq/J B4 ݌ @ PVW ,4  +L p+W@1- ,3G *t P0Hu $  /4 K  z  @E 0I g   : O< ! , pT+] _q PuJ ۦ O8 p /3J F\        0uPD ) N. P*  -  p k X `C/&7 ֐ V  /cJ `y@ 1E % %% @$+ |CF T { b no/4h H 4"U  1Z !R  + ] 0'8 (?Y  ] #Q J( ? 5Y=1 < Q `\ FL   ([  ( 0 D & 0he ]/  I P (5n +FE Н!e* 0>~ 92 P' ޑ`g C bEoC c U?$P P7U U>1 `03S<0Y  n D  # K:`0; n?` = ] / ? !  ϛ #M (_+ 3CW , |F wLb- c_ L( 1ؕ y =| I +" dSa: QC =`׍ 7 6*~ ݥ r. BDܐ-3  </0 O a [ 5 v 8d   P;- P\R 0HA f% 0a $Q0P `v-u  Q  { 3</}% b  5L 0O ;`O &2= 50 ދ S`0mQ DBc @w g3u @Z$` 6i;bh H^ qUdy 2 !@ x' {w !3 `r l y &9 Pe# l.( #w " .5  f 8!b H6< O  # id 8P AaQ2 bD ']q 01 [)i `j#Q s Vʞ 4C5%`1 :Z   K 5 `a"] [u  i ] y W/ ; L 6 "$G q   )" л_`0A 0[H z  3B ^I>1 /% EO CE<0 0Bj@ )E @! @!N } s 7  =$!p 1=7 f v #U tI !:j Y] "h DI  0"'y =1*  K0y# g6`-qp @~b =: VJL @u0 *A 90 j DJMk Y pAb<-K 0 - A ` 'f 6~6i t.  1 Fi v& 1I F >  ?T p( 5 PX IM 0Y& 07W '0 U PCK wܗ [@j ) `gOo \f p7Cr  s6u `6# v&@ |C Y05 i `P PM, e|^3 0U$ 0 a IC `j0 @0%    `K " 0Sm p2Q(  m  + 4 %O ( oۋ i ('   H pF bJ>2 '@0> 0+NB @b{ O 0t>p1 PL P7= 1# `U pn=1H QQK @bV  {'b)  { =, @ R  q'XY 0=1<   j / 0>~ U pF>d .-Z & Lg ( 0} , 7/Ŕ L 5X  ; @ t3>D 460d @  !+m ;@ 0R 0N `r7( D 2K 0Pl @  n/\% p^s ok &| : E ۱#y p5+ PC C0ZX } @0Tt Cj `E |  0w pe #Uj Je  0 O e>4 &i l\@ ) gDY I z cp 5   1K[ ,St J@ P`L_ UZL\ ` b  7wC W  `|'~t   H=1 4) @ T  # 3; @'; 0C; 0Yq [ \ ] Ec }'-  @a `65&* ` 2H_k (  1܁  {6 /dK r'  '|҃ @ ] H`0`   Ю 0&; q7 ) @-  u 5X/ Pl / @ MW*\ @|=1m] <0? >K FB \] X $S' ? J "> É /0 * 3;Q F C U P@dS  0<F 2 /n 1* PO* 34 5%0C| )u`/A LT) > 6PW  + e f (AV kօ ! 0t P#i~; 7n c* >" ?˄  ? m0@/*1 o z=1f ;.0  P$$ pwC `dP C2+ `C9 L. 'J? @@ } : pF[  z @ g0G bv @ ~ F00 0</;X { v XO / g \ m$ / @u4 . _? sN ' BD3 &   &p ~V| ײ = .Jf p/0 )\o J0S j urN 0Kb !_ P&g  d0G ,@ T|^ p34Q Er p 0Y `R0Cc ,r `t P}*/M @od +; J rG ]`J PP @&bN @L t0E @{ , pIn Dr 1 J P81Kl [9 S9]  M03 i: : ܃ /, `}h J>X5 &L ?&a0q P=  F0Hg C Њ7 0o ns0= YDS+ q `j j (>x1a  6--  C "=1Ĩ |', (VH 3 $g (^ > T !l1 b6F 6h 5v ?x &N ? ɏ ͜ Xd .5 N P!3 y pM Q ~' \0} c %Ah PJME] \`*/_ 2 /K/z : W P 9O  ( 8 awA gXU `$n.A  =fIz J 58 P j tAZ "-c&{0Z !8 =/#O p:0o 3I )  \. Ǽ)% S y# `m* g` p4 0:! ˱ w |   CTI `*+gW Q `g 4%.a  : z  5= @f h( O] 8B  i (P , D# `x Z} @ ,@W  @/)N pq?jd  '  1  Sa r z`/z A 'z   'B( V [ | + 2 #[ p7'YC pj)9 `T6 `ET <0d\ p 0O + * X "n 0;* skj  B0`1^D @ KcI Pf 'r K  bv    , Qu Їf`0) `[ fq p9 `_m8  j z0 :O >  ( 0 k e `.?e C@]^ `h}. |_ J X0o@/ 08L 3%p1 pVR_ | gwP ) 6> #6b X 5 kF + tC6o R- ^Q J0X s > 0s{ б 24 .d 9Jv 0ITj @}|t :*ΧK0* H/ )km   0n  V0 lV pK\ 019* [7?- %; ` H Wm@->m Oe pB Pc2Wr :/v pKa0 F ] `|O tA  n m 0u ]2 H;-h s2S$ b =d p1 +R0Ø ]@! Dr 0w_ P/1  1` m"# <P P'D 05B{  / ЯW AW 2 tg dU _ ! $ Hv DL@G ?RU m p R  D0 D `hr0Z0u  [  ? (:e  ?S &@J p@3 $Q + p!0 ڔ ' e 5VN 5S    +w Q wZ p s ,2 pn ^ B18 J pEz q !kj ? t }| \ & O Ah !g.Ɉ 2 $ PN!$ 0~1| t :;s U3 /0% ' l 0%n Sp }ajP.   _'!/n `4;v X/6 @mQ  1`p0lm `LS `;O0 l/ P"D < & J _ )'/P v 7 0 dI02 p&!7 0  V Pa Z8 PFZ #E n{[ )T / XW PThA g$ C` RJ P Y p~a ˎ m2 =ϊ -B s1 p  "( sa P !(&Q p?5 .8Eh H F aZ 9 M7m/ pU 0. , 9Q9 0  <) Kf( }d %Pv w  1 JTS   B 0`k@/ < 0 K08 # J` K  d% < & .M 1". @2D   k (f v  " `/`z/7 ) CN A=01  Yr- B<0$ REa 3!g.yF p6 b# D$8 +8 @W0#{ Ԭ -)J Fo @j-`0i 2 m_u  Zt &26 `   $) Km @U Enjb p* 1d 1=y @>Fo+ RkQ N6q p vr `1  KH! vyfr 3؟ ?x -(x P& ~>1 6  0FR 8gJ x/ A ; D   ) M) do {H J  5i /X- `:}   al@/h| & h u< 0e p l ] P\A(k o mC '`T P 7 ! R& @.c 3< `' ']9 2RH $zo i,^ P"# {|  }Dj pl/t_ _5v0-v/n '4 0w  Br *) T i j> 1@b ) @ TT@0{  , PA& u/ M+) c aG  hZ f 1G @TD z0`k  0F~ = h4 `<ۈ 5 z QQZ ] sQh `\W; Z/1 pOE z Sy k :WO- /7$ PIx |(l >$' `/y = .6 ` *8 .|K YG ,h; Z%SM 1, 5 c bW *U  9/ 0*0d пo^  : 0> ( c 09 1w:   2[L y ' @/[F Fk  z'sk `A  1l !^C ,, !e 2L  _ XM @B7N qt F<@/ P| % pKw C a' @>1 {D t ^ ?RG -^ >A P? P*` # pH,^ $G:U DZ @! b  [DS6 @ 08J ?9/O `)  x3 & =b `S /VG pLP1`0n4 H}C PDđ 1ц \ mn l"F "H p!Z yX r V 2 DZ  2 Ա}w OS ?Y OQ-  q:   [  "o__gmon_start___ITM_deregisterTMCloneTable_ITM_registerTMCloneTable__cxa_finalizePy_BytesMainPy_ExitStatusException_PyRuntime_InitializePyPreConfig_InitPythonConfig_Py_PreInitializeFromPyArgvPyConfig_InitPythonConfigPyConfig_SetBytesArgvPy_InitializeFromConfigPyConfig_ClearPyConfig_SetArgv_PyRuntime_PyRuntimeState_Init_PyMem_SetDefaultAllocator_PyGC_Initialize_PyEval_InitializePyThread_allocate_lockPyThread_get_thread_identPyMem_SetAllocatorPyMem_GetAllocator_Py_CheckRecursionLimit_PyPreConfig_InitCompatConfigPyMem_RawMallocsem_initperrorPyMem_RawFreePyThread_init_threadpthread_condattr_initpthread_condattr_setclockpthread_self_PyPreConfig_InitFromPreConfig_PyPreConfig_Read_PyPreConfig_Writesetlocale_PyMem_RawStrdup_Py_SetLocaleFromEnvPy_UTF8Mode_Py_LegacyLocaleDetected_PyWideStringList_Clear_Py_CoerceLegacyLocalewcschrwcscmpPy_IsolatedFlagPy_IgnoreEnvironmentFlag_PyMem_GetAllocatorName_Py_ResetForceASCII_PyArgv_AsWstrListPy_DecodeLocale_PyWideStringList_Copy_Py_DecodeLocaleExnl_langinfo_Py_normalize_encoding_Py_DecodeUTF8Ex_Py_ctype_table_Py_ctype_tolowermbrtowcmbstowcs_PyPreCmdline_Read_PyOS_ResetGetOpt_PyOS_opterr_PyOS_GetOpt_PyOS_optargPyWideStringList_Append_PyOS_optindstderrfprintffwrite_Py_get_xoptionwcslenwcsncmpPyWideStringList_Insert_PyMem_RawWcsdupPyMem_RawReallocmemmove_Py_GetEnvgetenv_PyMem_SetupAllocators_PyConfig_InitCompatConfig_PyConfig_SetPyArgv_Py_PreInitializeFromConfig_PyPreConfig_InitFromConfig_PyConfig_CopyPyConfig_Read_PyConfig_Write_Py_HashRandomization_Init_PyInterpreterState_EnablePyInterpreterState_NewPyThreadState_New_PyEval_FiniThreads_PyGILState_InitPyEval_InitThreads_PyTypes_Init_PyUnicode_Init_PyStructSequence_Init_PyLong_Init_PyExc_Init_PyFloat_Init_PyContext_Init_PyErr_Init_PySys_Create_PyBuiltin_Init_PyImport_FixupBuiltinPyModule_GetDict_PyBuiltins_AddExceptions_PyImport_Init_PyImportHooks_Init_PyWarnings_Init_PyConfig_WritePathConfigPy_FatalErrorPyConfig_SetString_PyPreConfig_GetConfig_PyPreCmdline_SetConfig_Py_path_config_PySys_ReadPreinitWarnOptions_PySys_ReadPreinitXOptions_Py_global_config_int_max_str_digits_PyConfig_InitPathConfig_Py_GetForceASCII_Py_IsLocaleCoercionTarget_PyPreCmdline_Clear_Py_get_env_flagstdout_Py_str_to_intPy_GetVersionPy_NoUserSiteDirectoryPy_BytesWarningFlagPy_InspectFlagPy_InteractiveFlagPy_OptimizeFlagPy_DebugFlagPy_VerboseFlagPy_QuietFlagPy_FrozenFlagPy_UnbufferedStdioFlagPy_NoSiteFlagPy_DontWriteBytecodeFlag__errno_locationwcstok_PyWideStringList_Extend_PyPathConfig_Calculatememset_Py_wreadlink_Py_wfopenfreadfclose_Py_DecodeUTF8_surrogateescapewcscatwcscpywcsncpywcsncat_Py_FindEnvConfigValuewcstombsPyMem_MallocPyMem_Free_Py_EncodeUTF8Ex_Py_wgetcwdPySys_Auditfopen64_Py_VaBuildValue_SizeTPyTuple_PackPyUnicode_FromStringPyObject_GetIterPyIter_Next_PyObject_LookupAttrIdPyObject_CallFunctionObjArgsPyErr_Occurred_Py_DeallocPyTuple_NewPyObject_IsTruePyMem_Realloc_Py_EncodeLocaleRawfcntl64PyExc_OSErrorPyErr_SetFromErrnoioctlPy_HashRandomizationFlagstdinsetvbuf_Py_HashSecretgetrandomPyEval_SaveThreadPyEval_RestoreThread_Py_open_Py_readPyExc_ValueError_Py_open_noraise_Py_fstat_noraisePyExc_NotImplementedError_Py_fstatPyExc_RuntimeError_PyEval_EvalFrameDefaultPyThread_acquire_lockPyThread_release_lockPyThread_acquire_lock_timedsem_trywaitsem_waitgettimeofdaysem_timedwait_PyTime_GetMonotonicClock_PyTime_GetSystemClock_PyTime_AsTimespec_PyTime_FromNanosecondssem_postPyThread_tss_getPyThread_tss_set_PyThreadState_Swappthread_cond_destroypthread_mutex_destroyPyThread_free_lockPyThread_tss_createpthread_key_createpthread_getspecificpthread_setspecificpthread_mutex_init_PyThread_cond_initpthread_cond_initAnnotateRWLockCreatepthread_mutex_lockpthread_cond_signalpthread_mutex_unlock_PyThread_cond_afterpthread_cond_timedwaitAnnotateRWLockAcquiredPyBaseObject_TypePyType_ReadyPyType_Type_PyWeakref_RefType_PyWeakref_CallableProxyType_PyWeakref_ProxyTypePyLong_TypePyBool_TypePyByteArray_TypePyBytes_TypePyList_Type_PyNone_Type_PyNotImplemented_TypePyTraceBack_TypePySuper_TypePyRange_TypePyDict_TypePyDictKeys_TypePyDictValues_TypePyDictItems_TypePyDictRevIterKey_TypePyDictRevIterValue_TypePyDictRevIterItem_TypePyODict_TypePyODictKeys_TypePyODictItems_TypePyODictValues_TypePyODictIter_TypePySet_TypePyUnicode_TypePySlice_TypePyStaticMethod_TypePyComplex_TypePyFloat_TypePyFrozenSet_TypePyProperty_Type_PyManagedBuffer_TypePyMemoryView_TypePyTuple_TypePyEnum_TypePyReversed_TypePyStdPrinter_TypePyCode_TypePyFrame_TypePyCFunction_TypePyMethod_TypePyFunction_TypePyDictProxy_TypePyGen_TypePyGetSetDescr_TypePyWrapperDescr_Type_PyMethodWrapper_TypePyEllipsis_TypePyMemberDescr_Type_PyNamespace_TypePyCapsule_TypePyLongRangeIter_TypePyCell_TypePyInstanceMethod_TypePyClassMethodDescr_TypePyMethodDescr_TypePyCallIter_TypePySeqIter_TypePyPickleBuffer_TypePyCoro_Type_PyCoroWrapper_Type_PyInterpreterID_TypePyDict_GetItemWithErrorPyObject_HashNotImplementedPyDescr_NewWrapperPyDict_SetItemPyExc_BaseException_PyDict_GetItemIdPyObject_Free_PyDict_GetItemIdWithError_Py_NoneStruct_PyDict_SetItemIdPyObject_GC_DelPyDescr_NewMemberPyDescr_NewGetSetPyDict_NewPyCFunction_NewExPyDescr_NewMethodPyDescr_NewClassMethodPyStaticMethod_NewPyExc_SystemErrorPyExc_TypeError_Py_tracemalloc_config_PyObject_GC_NewVarPyErr_NoMemory_PyErr_BadInternalCall_PyTraceMalloc_NewReferencePyType_GetFlagsPyObject_MallocPyObject_Callocmmap64_PyObject_GC_NewPyUnicode_InternFromString_PyUnicodeWriter_PrepareInternalPyUnicode_New_PyUnicodeWriter_FinishPyUnicode_InternInPlacePyDict_SetDefaultPyObject_Hash_Py_HashBytes_PyUnicode_ReadyPyDict_DelItemPyType_GenericAlloc_PyObject_GC_Malloc_PyUnicode_FromIdPySequence_TuplePyList_NewPyList_AppendPyMem_CallocPyList_AsTuple_PyTuple_ResizePyExc_StopIteration_PyTuple_FromArrayPyObject_GC_UnTrack_PyTrash_thread_deposit_object_PyTrash_thread_destroy_chainPyType_IsSubtypePyType_ModifiedPyDict_GetItem_PyErr_RestorePyLong_FromVoidPtrPyWeakref_NewRefPyLong_FromUnsignedLong_PyLong_NewPyExc_OverflowErrorPyObject_GC_Track_PyObject_AssertFailedPyObject_RichCompareBoolPy_BuildValuePyObject_CallFunctionPyErr_WriteUnraisable_PyTuple_MaybeUntrack_PyWeakref_ClearRefPyMethod_ClearFreeListPyFrame_ClearFreeListPyCFunction_ClearFreeListPyTuple_ClearFreeListPyFloat_ClearFreeListPyList_ClearFreeListPyDict_ClearFreeListPyAsyncGen_ClearFreeListsPyContext_ClearFreeList_PyDict_MaybeUntrackPySys_FormatStderrPySys_WriteStderr_PyErr_WriteUnraisableMsg_PyTime_AsSecondsDoublePyOS_snprintf_PyLong_Zero_PyLong_OnePyStructSequence_InitType2_PyInterpreterState_GetPyStructSequence_UnnamedFieldPyLong_FromSsize_tPyDict_SetItemStringPyExc_ExceptionPyExc_StopAsyncIterationPyExc_GeneratorExitPyExc_SystemExitPyExc_KeyboardInterruptPyExc_ImportErrorPyExc_ModuleNotFoundErrorPyExc_EOFErrorPyExc_RecursionErrorPyExc_NameErrorPyExc_UnboundLocalErrorPyExc_AttributeErrorPyExc_SyntaxErrorPyExc_IndentationErrorPyExc_TabErrorPyExc_LookupErrorPyExc_IndexErrorPyExc_KeyErrorPyExc_UnicodeErrorPyExc_UnicodeEncodeErrorPyExc_UnicodeDecodeErrorPyExc_UnicodeTranslateErrorPyExc_AssertionErrorPyExc_ArithmeticErrorPyExc_FloatingPointErrorPyExc_ZeroDivisionErrorPyExc_ReferenceErrorPyExc_MemoryErrorPyExc_BufferErrorPyExc_WarningPyExc_UserWarningPyExc_DeprecationWarningPyExc_PendingDeprecationWarningPyExc_SyntaxWarningPyExc_RuntimeWarningPyExc_FutureWarningPyExc_ImportWarningPyExc_UnicodeWarningPyExc_BytesWarningPyExc_ResourceWarningPyExc_ConnectionErrorPyExc_BlockingIOErrorPyExc_BrokenPipeErrorPyExc_ChildProcessErrorPyExc_ConnectionAbortedErrorPyExc_ConnectionRefusedErrorPyExc_ConnectionResetErrorPyExc_FileExistsErrorPyExc_FileNotFoundErrorPyExc_IsADirectoryErrorPyExc_NotADirectoryErrorPyExc_InterruptedErrorPyExc_PermissionErrorPyExc_ProcessLookupErrorPyExc_TimeoutErrorPyLong_FromLong_PyHamt_InitPyContext_TypePyContextVar_TypePyContextToken_TypePyContextTokenMissing_Type_PyHamt_Type_PyHamt_ArrayNode_Type_PyHamt_BitmapNode_Type_PyHamt_CollisionNode_Type_PyHamtKeys_Type_PyHamtValues_Type_PyHamtItems_Type_PyObject_New_PyModule_CreateInitializedPyDict_GetItemString_Py_gitversion_Py_gitidentifierPy_GetCopyrightPy_GetPlatformPyFloat_GetInfoPyLong_GetInfoPyStructSequence_NewPyHash_GetFuncDefPyList_SortPyDict_DelItemString_PySys_ImplName_PySys_ImplCacheTag_PyNamespace_NewPyThread_GetInfo_Py_PackageContextPyModuleDef_InitPyModuleDef_TypePyErr_WarnFormatPyModule_NewPyModule_NewObjectPyModule_TypePyModule_AddFunctionsPyModule_GetNameObjectPyErr_BadArgumentPyObject_SetAttrStringPyObject_SetAttrPyUnicode_AsUTF8PyObject_GenericSetAttr_PyObject_GenericSetAttrWithDict_PyType_Lookup_PyObjectDict_SetItem_PyDict_GetItem_KnownHash_PyObject_GetDictPtrPyModule_SetDocString_PyObject_SetAttrId_PySys_SetPreliminaryStderrPyFile_NewStdPrinterPy_GetCompilerPy_GetBuildInfoPyOS_vsnprintfPyFloat_FromDoublePyUnicode_FromStringAndSizePyBytes_FromStringAndSizePyUnicode_FromOrdinalPyLong_FromUnsignedLongLongPyLong_FromLongLongPyComplex_FromCComplexPyUnicode_FromWideCharPyErr_WarnExPyLong_AsSsize_t_PyDict_DelItem_KnownHash_PyErr_SetKeyErrorPyObject_ClearWeakRefsPyDict_UpdatePyMapping_KeysPyObject_GetItemPyBool_FromLong_Py_TrueStruct_Py_FalseStructconfstrPyUnicode_DecodeFSDefaultAndSize_PyObject_CallFunction_SizeTPyCodec_StrictErrors_PyImport_FixupExtensionObjectPyModule_GetDefPyObject_SetItem_PyState_AddModulePyDict_CopyPyObject_DelItemPyList_SetItem_PyDict_KeysSizePyFilter_TypePyMap_TypePyZip_Type_Py_EllipsisObject_Py_NotImplementedStructPyClassMethod_TypePyExc_EnvironmentErrorPyExc_IOErrorPySys_SetObjectPyModule_Create2PyModule_AddObject_PyImport_IsInitializedPyModule_GetNamePyImport_ImportFrozenModulePyImport_AddModulePyInit__imp_PyImport_SetModuleStringPyObject_CallMethodPyImport_ImportFrozenModuleObjectPyMarshal_ReadObjectFromStringPyImport_FrozenModules_PyUnicode_EqualToASCIIStringPyFrozenSet_NewPySet_AddPyCode_NewWithPosOnlyArgsPyUnicode_FromKindAndDataPyUnicode_DecodeUTF8PySet_New_PyLong_FromByteArrayPyBuffer_FillInfoPyMemoryView_FromBuffer_PyObject_CallMethodId_SizeTPyNumber_AsSsize_tPyObject_InitPyUnicode_ComparePyEval_GetBuiltinsPyImport_GetModuleDict_PyImport_AddModuleObjectPyEval_EvalCodePyEval_EvalCodeEx_PyEval_EvalCodeWithName_PyFrame_New_NoTrackPyCell_NewPyGen_NewWithQualNamePyUnicode_FromFormat_PyErr_FormatPyAsyncGen_NewPyCoro_New_PyErr_SetStringPyUnicode_Join_PyObject_GC_ResizePyEval_EvalFrameEx_Py_CheckFunctionResultPySequence_ContainsPyErr_GivenExceptionMatches_PyObject_GetMethodPyObject_GetAttrPyNumber_AddPyNumber_SubtractPyNumber_MultiplyPyNumber_InPlaceAddPyFrame_BlockSetupPyNumber_PowerPyFrame_BlockPopPyNumber_TrueDividePyNumber_And_PyDict_NewPresizedPySlice_NewPyNumber_RshiftPyFunction_NewWithQualNamePyNumber_RemainderPyNumber_InPlaceLshiftPyNumber_FloorDividePyObject_CallPyNumber_OrPyNumber_LshiftPyNumber_Negative_PyObject_LookupSpecialPyNumber_InPlaceXorPyNumber_InPlaceFloorDividePyNumber_InPlaceSubtractPyNumber_InPlaceMultiplyPyNumber_Xor_PyErr_SetObjectPyTraceBack_Here_PyErr_Fetch_PyErr_NormalizeExceptionPyException_SetTracebackPyNumber_InPlacePowerPyNumber_InPlaceRshift_PyUnicode_JoinArray_PyList_Extend_PyCoro_GetAwaitableIter_PyGen_yf_PyDict_MergeExPyNumber_Invert_PyObject_LookupAttrPyFrame_FastToLocalsWithErrorPySequence_GetItem_PyErr_ExceptionMatches_PyErr_ClearPyFrame_LocalsToFast_PySet_UpdatePyNumber_Positive_PyLong_AsIntPyImport_ImportModuleLevelObjectPyNumber_MatrixMultiplyPyNumber_InPlaceRemainder_PySys_GetObjectIdPyNumber_InPlaceAndPyNumber_InPlaceOrPyNumber_InPlaceTrueDividePyObject_RichCompare_PyObject_MakeTpCall_PyDict_LoadGlobal_PyGen_SendPyUnicode_FormatPyCFunction_CallPyTuple_SizePyObject_FormatPyObject_Str_PyGen_FetchStopIterationValue_PyCode_InitOpcachePyObject_ReprPyObject_ASCII_PyErr_GetTopmostExceptionPyException_SetCause_PyObject_GetAttrIdPyImport_GetModulePyModule_GetFilenameObjectPyErr_SetImportError_PyModuleSpec_IsInitializingPyNumber_InPlaceMatrixMultiplyPyFrame_GetLineNumber_PyCode_CheckLineNumber_PyObject_CallMethodIdObjArgsPyCode_Addr2Line_PyObject_FastCallDict_PyErr_SetNonePyAsyncGen_Type_PyErr_FormatFromCause_PyAsyncGenValueWrapperNewPyTuple_GetItem_PyFunction_Vectorcall_Py_CheckRecursiveCall_PyType_CalculateMetaclassPyMapping_Check_PyStack_AsDict_PyDict_DelItemIdPyMapping_SetItemStringPyList_SetSlicePyObject_GenericGetAttrPyArg_ParseTuplePyUnicode_AsUTF8AndSize_PyDict_NewKeysForClassPyEval_GetGlobalsPyCell_SetPyUnicode_IsIdentifier_PyUnicode_EqualToASCIIId_Py_ManglePyClassMethod_NewPyLong_AsLongPyUnicode_AsUnicodeAndSizePyFloat_AsDoublePyNumber_IndexPyLong_AsLongLongPyObject_GetBufferPyBuffer_IsContiguousPyLong_AsUnsignedLongLongMaskPyLong_AsUnsignedLongMaskPyUnicode_GetDefaultEncodingPyUnicode_AsEncodedStringPyBuffer_ReleasePyByteArray_SizePyBytes_Size_PyByteArray_empty_stringPyComplex_AsCComplexmemcpy_PyObject_NextNotImplemented_PyDict_NextPyMethod_New_PyType_LookupIdPyType_GenericNew_PyArg_NoKeywordsPyTuple_GetSlice_PyArg_UnpackKeywords_PyObject_GenericGetAttrWithDictPyMember_GetOnePyObject_TypePyArg_UnpackTuple_PyArg_CheckPositionalPySeqIter_NewPyTupleIter_TypePyMember_SetOnePyLong_AsUnsignedLongLongPyLong_AsUnsignedLongPyObject_GenericGetDict_PyObject_RealIsSubclassPyArg_ValidateKeywordArgumentsPyUnicode_AppendPySequence_ListPyObject_GetAttrStringPyCallable_Check_Py_VaBuildStack_Py_VaBuildStack_SizeT_PyDictView_NewPyDictIterItem_TypePyObject_IsInstance_Py_SwappedOpPyUnicode_RichComparePyUnicode_FromFormatVsprintf_PyUnicodeWriter_WriteASCIIString_PyUnicodeWriter_WriteStrPyObject_ReallocPyException_GetTracebackPyException_GetContextPyException_SetContext_PyErr_ChainExceptions_PyTraceBack_FromFramePyBytes_AsStringPyObject_IsSubclass_PyObject_Call_Prepend_PyStack_UnpackDictPyUnicode_RPartitionmemchrmemrchrPySlice_UnpackPySlice_AdjustIndices_PyLong_Sign_PyArg_BadArgumentPyVectorcall_CallPyModule_FromDefAndSpec2_PyImport_FindExtensionObject_PyImport_FindExtensionObjectExPyInit__threadfloorPyModule_GetStatePyModule_ExecDef_PyDict_Pop_PyDict_Pop_KnownHashPyInit__weakref_PyTime_Init_PySys_InitMain_PyFaulthandler_Init_PyUnicode_InitEncodings_PySignal_Init_PyTraceMalloc_InitPySys_GetObjectPyList_SizePyImport_ImportModule_PyWideStringList_AsListclock_gettimeclock_getres_PyImportZip_InitPyLong_AsLongAndOverflowPyUnicode_FindCharPyUnicode_Substring_PyTime_GetPerfCounter_PyTime_AsMicroseconds_PyImport_AcquireLock_PyImport_ReleaseLock_PyTime_FromSecondsPyArg_ParseTupleAndKeywords_PyTime_FromSecondsObject_PyDict_GetItemStringWithErrorPy_MakePendingCallsPyListIter_TypePyObject_CallFinalizerFromDealloc_PyUnicode_EQPySetIter_TypePyObject_LengthHint_PyObject_HasLenPyObject_Sizewmemcmp_Py_SourceAsStringPyEval_MergeCompilerFlagsPyRun_StringFlagsPyEval_GetLocalsPyInit__io_PyIO_ModulePyModule_AddIntConstantPyIOBase_TypePyRawIOBase_TypePyBufferedIOBase_TypePyTextIOBase_TypePyFileIO_TypePyBytesIO_Type_PyBytesIOBuffer_TypePyStringIO_TypePyBufferedReader_TypePyBufferedWriter_TypePyBufferedRWPair_TypePyBufferedRandom_TypePyTextIOWrapper_TypePyIncrementalNewlineDecoder_Type_PyIO_str_close_PyIO_str_closed_PyIO_str_decode_PyIO_str_encode_PyIO_str_fileno_PyIO_str_flush_PyIO_str_getstate_PyIO_str_isatty_PyIO_str_newlines_PyIO_str_peek_PyIO_str_read_PyIO_str_read1_PyIO_str_readable_PyIO_str_readall_PyIO_str_readinto_PyIO_str_readline_PyIO_str_reset_PyIO_str_seek_PyIO_str_seekable_PyIO_str_setstate_PyIO_str_tell_PyIO_str_truncate_PyIO_str_write_PyIO_str_writable_PyIO_str_nl_PyIO_empty_str_PyIO_empty_bytessem_destroyPyMarshal_InitPyInit_posix__environPyStructSequence_NewTypePyUnicode_DecodeASCIIqsortPyType_FromSpecWithBasesPyObject_SelfIterPyObject_CallFinalizer_PyGen_Finalize_PyErr_WarnUnawaitedCoroutinePySequence_FastPyUnicodeIter_Type_PyLong_AsByteArrayPyObject_BytesPyBytes_FromObjectPyBytes_FromString_PyArg_ParseTuple_SizeT_PyEval_SliceIndex_PyImport_DynLoadFiletabPySequence_CheckPyList_InsertPyImport_ImportPyImport_ImportModuleLevelPyInit_time_PyTime_localtimelocaltime_rsigaltstack_PyObject_CallMethodId_Py_SetFileSystemEncoding_Py_DumpPathConfig_PyCodec_LookupPyInit_faulthandlersigemptysetsigactionPyList_GetItemPyEval_CallObjectWithKeywordsPyImport_ImportModuleNoBlockPyCodec_RegisterError_PyThreadState_UncheckedGetPyUnicode_FSConverterPyOS_FSPathPyUnicode_EncodeFSDefault_Py_EncodeLocaleExPyUnicode_AsWideCharStringPyErr_SetFromErrnoWithFilenameObjectlstat64fstatat64fstat64pthread_cond_waitAnnotateRWLockReleasedPyThread_exit_threadPyErr_SetFromErrnoWithFilenameObjectsstrerrorPyUnicode_DecodeLocale_Py_GetErrorHandlerPyNumber_Check_PyUnicode_FromASCII_PyLong_FromUid_PyLong_FromGid_PyLong_FromTime_t_PyErr_CheckSignalsPyEval_GetFrame_PyArg_ParseTupleAndKeywords_SizeT_PyLong_NumBitsPyLong_AsDoublefrexpmodfPyLong_FromDouble_PyLong_Lshiftreaddir64closedir_Py_dupfdopendirrewinddir_PyUnicode_XStripPyNumber_Long_PyLong_FromNbIntPyLong_FromUnicodeObject_PyLong_FromBytes_PyLong_FromNbIndexOrNbInt_PyLong_CopyPyFile_OpenCodeObject_Py_open_cloexec_works_Py_set_inheritable_PyIOBase_finalizePyObject_CallMethodObjArgs_PyIOBase_check_readablePyNumber_AsOff_tlseek64_Py_convert_optional_to_ssize_t_PyFileIO_closed_PyBytes_ResizePyBytes_Concat_PyBytes_JoinPyUnicode_FSDecoderPyAST_CheckPy_CompileStringObjectPyArena_NewPyAST_obj2modPyAST_ValidatePyAST_CompileObjectPyArena_FreePyMemoryView_FromObject_PyUnicode_CopyPyAST_mod2objPyParser_ASTFromStringObject_PyParser_GrammarPyParser_ParseStringObjectPyAST_FromNodeObjectPyNode_FreePyTokenizer_FromStringPyTokenizer_FromUTF8__ctype_tolower_locPyInit__codecsPyParser_NewPyParser_AddTokenPyTokenizer_GetPyParser_DeletePyTokenizer_Free_PyNode_FinalizeEndPosPyNode_NewPyNode_AddChildPyGrammar_FindDFAPyGrammar_AddAcceleratorsPyDict_Keys__ctype_b_locPyToken_TwoCharsPyToken_OneCharPyToken_ThreeCharsPyCodec_LookupErrorfeofPyOS_Readline_PyLong_FormatAdvancedWriter_PyUnicode_FormatAdvancedWriter_PyFloat_FormatAdvancedWriter_PyComplex_FormatAdvancedWriter_PyUnicode_ToDecimalDigit_PyUnicode_FindMaxChar_PyUnicode_FastFill_PyUnicode_FastCopyCharacters_PyUnicodeWriter_WriteSubstring_Py_Expression_Py_asdl_seq_new_Py_Module_Py_Interactive_Py_Pass_Py_TypeIgnore_Py_FunctionTypePyCodec_RegisterPyArena_Malloc_Py_Expr_Py_Assign_Py_Return_Py_If_Py_Import_Py_Delete_Py_Assert_Py_Raise_Py_Break_Py_Continue_Py_ExceptHandler_Py_Try_Py_Name_Py_While_Py_AugAssign_Py_ImportFrom_Py_Attribute_Py_AnnAssign_Py_Global_Py_Nonlocal_Py_Call_PyUnicode_IsAlpha_PyUnicode_IsDecimalDigit_PyUnicode_IsDigit_PyUnicode_IsNumeric_Py_Tuple_Py_UnaryOp_Py_Yield_Py_Starred_Py_Dict_Py_List_Py_BinOp_Py_ConstantPyArena_AddPyObject_Py_Await_Py_asdl_int_seq_new_Py_Compare_Py_Subscript_Py_BoolOp_Py_Lambda_Py_Set_Py_DictComp_Py_IfExp_Py_YieldFrom_Py_arguments_Py_Index_Py_ExtSlicePyThreadState_Get_PyUnicode_TypeRecordsPyUnicode_DecodeUTF8Stateful_PyBytes_DecodeEscape2PyBytes_ConcatAndDel_PyUnicode_ToDigitPyUnicode_AppendAndDel_Py_JoinedStrPyUnicode_Contains_Py_aliasPy_HasFileSystemDefaultEncodingPy_FileSystemDefaultEncodeErrors_Py_HasFileSystemDefaultEncodeErrorsPy_FileSystemDefaultEncoding_Py_ClearFileSystemEncodingPyOS_setsigPyInit__signalPyOS_getsig__libc_current_sigrtmin__libc_current_sigrtmaxPyErr_NewException_PySys_SetObjectId_Py_ClearStandardStreamEncoding_PyCodec_EncodeText_Py_ClassDef_Py_keywordPyInit__abc_Py_FunctionDef_Py_AsyncFunctionDefPyMapping_Items_PyObject_IsAbstract_Py_argPyDictProxy_NewPyDict_Items_Py_For_Py_AsyncForPyLong_FromSize_tPyOS_strtolPyOS_strtoulPyLong_FromStringPyOS_string_to_double_PyType_GetDocFromInternalDoc_PyLong_DigitValuePySet_Size_PySet_NextEntryPySet_ClearPyWeakref_GetObject_Py_SlicePySet_Contains_Py_HashPointermunmapPyFuture_FromASTObject_PyAST_OptimizePySymtable_BuildObjectPySymtable_Free_PyAST_GetDocStringPyErr_SyntaxLocationObject_PyUnicode_IsPrintablePy_hexdigitsPyLong_AsSize_tPyErr_SetImportErrorSubclass_PyIO_get_module_state_Py_device_encoding_PyIO_get_locale_module_PyCodec_LookupTextEncoding_PyCodecInfo_GetIncrementalDecoderPy_GetRecursionLimit_PyCodecInfo_GetIncrementalEncoderPySTEntry_Type_PyIOBase_check_writablePyUnicode_CopyCharactersPySet_DiscardPyInit__statPyMem_RawCalloccallocPyCallIter_NewPyBytesIter_TypePyBuffer_ToContiguousPyByteArrayIter_TypePySymtable_LookupPyCapsule_NewPyCapsule_GetPointerPyST_GetScopePyUnicode_ConcatPyDictIterKey_TypePyDictIterValue_TypePySequence_SizePyListRevIter_Type_PyCode_ConstantKeyPyRangeIter_TypePyCode_Optimize_PyUnicode_IsXidStart_PyUnicode_IsXidContinuePyObject_DirPySequence_DelItem_Py_ascii_whitespace_PyUnicode_IsWhitespacegeteuidgetuidgetegidgetgid_PyObject_FastCall_Prepend_PySequence_IterSearchPyUnicode_FromEncodedObjectPyUnicode_Decode_PyCodec_DecodeText_PyBytesWriter_Prepare_PyLong_FormatWriterPyByteArray_Resize_Py_With_Py_withitem_Py_AsyncWith_PyUnicode_DecodeUnicodeEscapeInternal2PyCapsule_Import_PyArg_UnpackStackPyMarshal_WriteObjectToString_Py_hashtable_compare_direct_Py_hashtable_hash_ptr_Py_hashtable_newPyState_FindModule_Py_hashtable_new_full_Py_hashtable_get_entry_Py_hashtable_setPyComplex_RealAsDoublePyComplex_ImagAsDouble_Py_ListComp_Py_GeneratorExp_Py_SetComp_Py_comprehensionPyInit__localePyParser_SimpleParseStringFlagsFilenamestrstr_Py_FormattedValuePyParser_ParseStringFlagsFilenamePyParser_ParseStringFlagsFilenameExPyUnicode_DecodeFSDefault_Py_hashtable_foreach_Py_hashtable_destroy_PyIOBase_check_closed_PyIO_trap_eintrPyBytes_AsStringAndSize_Py_BuildValue_SizeTPyAST_FromNodemkdirmkdirat_PyIncrementalNewlineDecoder_decode_PyIO_find_line_ending_PyLong_FormatPyNumber_Floatopenat64_Py_writerenamerenameat_PyBytesWriter_FinishPyByteArray_FromStringAndSize_Py_UnhandledKeyboardInterruptPy_RunMainPy_FinalizeEx_PyPathConfig_ComputeSysPath0PyRun_SimpleStringFlagsPyRun_AnyFileExFlags_Py_fopenPyRun_SimpleFileExFlagsungetcPyImport_GetImportergetpid_Py_wrealpathwcsrchrPyWrapper_NewPyErr_PrintExfflushPy_ExitPyDict_Clear_Py_HandleSystemExitPyFile_WriteObjectPyObject_Print_PyDictKeys_DecRef_Py_FinishPendingCallsPyOS_FiniInterrupts_PyGC_CollectIfEnabledPyImport_Cleanup_PyTraceMalloc_Fini_PyImport_Fini_PyType_Fini_PyFaulthandler_FiniPyInterpreterState_Clear_PySys_ClearAuditHooks_PyExc_FiniPyMethod_FiniPyFrame_FiniPyCFunction_FiniPyTuple_FiniPyList_FiniPySet_FiniPyBytes_FiniPyLong_FiniPyFloat_FiniPyDict_FiniPySlice_Fini_PyGC_Fini_PyWarnings_Fini_Py_HashRandomization_Fini_PyArg_FiniPyAsyncGen_Fini_PyContext_Fini_PyUnicode_FiniPyGrammar_RemoveAccelerators_PyGILState_FiniPyInterpreterState_Delete_PyRuntimeState_Fini_PyObject_DebugMallocStats_PyImport_GetModuleId_PyErr_PrintPyInit__operator_PyImport_LoadDynamicModuleWithSpec_Py_fopen_objPyUnicode_GetLength_PyImport_FindSharedFuncptr_PyUnicode_AsASCIIStringPyGC_CollectdlopendlsymdlerrorPyUnicode_ClearFreeListPyInit_itertools_PyType_NamePyInit__collectionsPySet_ClearFreeList_PyState_ClearModules_PyGC_CollectNoFail_PyGC_DumpShutdownStats_PyModule_Clear_PyModule_ClearDictPyInit__functoolsPy_ReprEnter_PyUnicodeWriter_Init_PyUnicodeWriter_WriteCharPy_ReprLeave_PyUnicodeWriter_DeallocPyThreadState_GetDictPyErr_WarnExplicitFormatPyErr_ResourceWarning_PyEval_FiniPyThread_tss_deletePyType_ClearCache_PyHash_FiniPyThreadState_Clear_PyHamt_Fini_PyUnicode_ClearStaticStringspthread_key_deletePySequence_ConcatPyDict_Merge_PyDict_HasOnlyStringKeysPyInit__sre_PySlice_GetLongIndices_PyBytesWriter_Init_PyBytesWriter_Alloc_PyBytesWriter_ResizePyObject_InitVar_PyUnicode_ToLowercase_PyUnicode_ToUppercase_Py_bytes_maketrans_PyFloat_Unpack8ldexp_PyDict_FromKeysPyMapping_Size_PyObject_RealIsInstance_Py_bytes_find_PyIOBase_check_seekablelog_Py_bytes_rfindPy_FdIsInteractivePyUnicode_TailmatchPyImport_GetMagicNumberftellrewindPyMarshal_ReadLongFromFilePyMarshal_ReadLastObjectFromFilePyUnicode_CompareWithASCIIStringPyFloat_FromString_PyUnicode_TransformDecimalAndSpaceToASCII_Py_string_to_number_with_underscores_Py_bytes_lower_Py_bytes_upper_Py_ctype_toupper_Py_get_387controlword_Py_set_387controlword_Py_dg_strtodPyParser_ASTFromFileObjectPyParser_ParseFileObjectPyTokenizer_FromFilePy_UniversalNewlineFgetsPyByteArray_AsStringPyBytes_Repr_Py_parse_inf_or_nan_Py_dg_infinity_Py_dg_stdnanPyUnicodeTranslateError_SetStart_PyUnicodeTranslateError_CreatePyUnicodeTranslateError_SetEndPyUnicodeTranslateError_SetReason_PyArg_ParseStackAndKeywordsPyFile_WriteStringflockfilefunlockfile__uflowPyUnicode_Partitionlocaleconv_Py_GetLocaleconvNumeric_PyMem_Strdup_PyUnicode_InsertThousandsGrouping_Py_bytes_startswithPyInit_errnoPyModule_AddStringConstant_Py_HashDouble_PyFloat_Pack8_PyUnicode_IsLinebreakPyThread_get_thread_native_idsyscallPyErr_NewExceptionWithDocPyInit_pwdPyObject_CallObject_PyDict_SetItem_KnownHash_PyImport_Fini2_PyPathConfig_ClearGlobal_Py_ClearArgcArgv_PyRuntime_FinalizeunamePyUnicode_Splitlines_PyBytesWriter_Dealloc_PyBytesWriter_WriteBytesPyInit__string_PyUnicode_ExtendedCasePyDict_MergeFromSeq2PyInit_atexit_Py_PyAtExit_PyUnicode_IsLowercase_PyUnicode_IsTitlecase_PyUnicode_IsUppercasePyBytes_FromFormatputenvPyBytes_FromFormatVPyCapsule_IsValidPyType_FromSpec_PyEval_SliceIndexNotNonesystemPyInit_gc_PyEval_GetBuiltinIdunlinkunlinkatPyNumber_AbsolutePyNumber_Divmodround_Py_dg_dtoa_Py_dg_freedtoa_PyUnicode_FormatLongPyNumber_ToBasefmod_PyOS_URandomNonblock_PyImport_SetModule_PyOS_URandomPyUnicodeDecodeError_CreatePyUnicodeDecodeError_GetObjectPyUnicodeDecodeError_SetStartPyUnicodeDecodeError_SetEndPyUnicodeDecodeError_SetReasonfchdir_PyThreadState_PreallocPyThread_start_new_threadpthread_attr_initpthread_attr_setscopepthread_createpthread_attr_destroypthread_detachpthread_attr_setstacksize_PyThreadState_InitPyEval_AcquireThreadPyThreadState_DeleteCurrent_Py_IsFinalizingPyInterpreterState_MainforkPyOS_BeforeForkgetloadavgPyList_GetSlicePyList_ReversePyOS_AfterFork_Parent_PyArg_ParseStack_SizeTwaitpidPyOS_double_to_stringPyUnicode_FillPyEval_ReleaseLockpthread_exit_PyTime_GetPerfCounterWithInfo_PyCrossInterpreterData_RegisterClassPyContextVar_New_PyTime_AsTimevalTime_tPy_GetProgramName_PyTime_gmtimegmtime_r_PyArg_Parse_SizeT_PyFloat_Pack4_PyFloat_Unpack4fchmodfchmodat_PyErr_TrySetFromCause_PyUnicode_EncodeUTF16PyUnicode_DecodeUTF16PyUnicode_DecodeUTF16Stateful_PyUnicode_EncodeUTF32PyUnicode_DecodeUTF32PyUnicode_DecodeUTF32StatefulPyInterpreterState_ThreadHeadPyThreadState_NextPyUnicode_SplitPyUnicode_DecodeRawUnicodeEscape_PySys_GetSizeOf_Py_DisplaySourceLinePyWeakref_NewProxy_PyUnicode_AsKind_Py_bytes_endswith_Py_bytes_containsPyByteArray_Concat_PyDict_Contains_Py_strhex_bytes_with_sepPyUnicodeEncodeError_SetStartPyUnicodeEncodeError_SetEndPyUnicodeEncodeError_SetReason_PyAccu_Destroy_PyAccu_Init_PyAccu_AccumulatePyUnicode_AsUCS4PyUnicode_Replace_PyAccu_Finishpipe2pipe_PySequence_BytesToCharpArray_Py_FreeCharPArrayPyObject_AsFileDescriptor_PyLong_UnsignedShort_Converter_PyUnicode_ToTitleFull_PyUnicode_ToLowerFull_PyUnicode_IsCaseIgnorable_PyUnicode_IsCased_Py_strhex_with_sep_PyUnicode_AsLatin1StringPyErr_ProgramTextObject_Py_bytes_capitalize_Py_bytes_count_Py_bytes_index_Py_bytes_isalnum_Py_bytes_isalpha_Py_bytes_isascii_Py_bytes_isdigit_Py_bytes_islower_Py_bytes_isspace_Py_bytes_istitle_Py_bytes_isupper_Py_bytes_rindex_Py_bytes_swapcase_Py_bytes_titlePyUnicode_DecodeLatin1_PyBytes_FromHex_PyBytes_FormatEx_PyLong_FormatBytesWriterPyCodec_EncodePyUnicode_BuildEncodingMap_PyUnicode_EncodeCharmapPyLong_AsVoidPtrfaccessataccess_PyArg_NoPositionalceilPyEval_SetTrace_Py_c_abshypot_Py_c_quot_Py_c_neg_Py_c_diffPyContextVar_Get_PyHamt_FindPyContextVar_Set_PyHamt_New_PyHamt_AssocPyComplex_FromDoubles_PyLong_GCDPyCodec_BackslashReplaceErrorsPyUnicodeDecodeError_GetStartPyUnicodeDecodeError_GetEndPyUnicodeEncodeError_GetStartPyUnicodeEncodeError_GetEndPyUnicodeEncodeError_GetObjectPyUnicodeTranslateError_GetStartPyUnicodeTranslateError_GetEndPyUnicodeTranslateError_GetObjectPyUnicode_DecodeCharmapPyUnicode_DecodeUTF7StatefulPyUnicode_AsRawUnicodeEscapeStringPyUnicode_AsUnicodeEscapeString_PyUnicode_EncodeUTF7_PyUnicode_AsUTF8String_PyObject_CallMethod_SizeT_PyUnicode_DecodeUnicodeEscapeStatefulPyCodec_IncrementalEncoderPyCodec_IncrementalDecoderPyCodec_ReplaceErrorsPyCodec_IgnoreErrorsPyCodec_DecodePyODict_SetItem_PyType_GetTextSignatureFromInternalDoc_Py_NamedExprPyInit__ast_PyCodec_Forget_PyUnicode_ToUpperFullPyUnicodeDecodeError_GetEncodingPyUnicodeEncodeError_GetEncodingPyCodec_NameReplaceErrorsPyCodec_XMLCharRefReplaceErrorsPySequence_SetItemPyUnicode_EncodeLocale_PyGen_SetStopIterationValue_Py_c_powatan2sincos_PyLong_Frexp_PyAST_ExprAsUnicodewcsftimetzset_PyTime_ObjectToTime_t_PyLong_AsTime_tunsetenvmktime_PyTime_AsTimevalselect_PyTime_ObjectToTimevalPy_DecRef_PyLong_DivmodNearPyUnicode_WriteCharPyDict_SizePyUnicode_FromUnicodePyEval_GetFuncNamePyErr_WarnExplicitObject_PyEval_GetSwitchInterval_PyEval_SetSwitchIntervalPyObject_GenericSetDictPySequence_GetSlice_PySlice_FromIndices_PyEval_SignalReceived_Py_write_noraise_PyEval_AddPendingCall_Py_strhex_PyLong_UnsignedLong_Converter_PyLong_UnsignedLongLong_Converter_PyTime_FromTimespecgetrusage_PyTime_FromTimevaltimes_PyTime_MulDivPyCFunction_GetFunction_PyAccu_FinishAsListPyMapping_GetItemStringPyLong_AsLongLongAndOverflow_PyLong_RshiftPySequence_CountPySequence_IndexPySequence_InPlaceConcatPyODict_DelItem_PyDict_SizeOfPyObject_Notrmdirfstatvfs64PyPickleBuffer_GetBufferPyMemoryView_FromMemory__ctype_toupper_locPyTuple_SetItemPyOS_mystrnicmpPyGILState_EnsurePyGILState_Release_PyFloat_Unpack2_PyFloat_Pack2_PyTime_FromNanosecondsObject_PyTime_AsNanosecondsObject_PyTime_AsMilliseconds_PyTime_ObjectToTimespecclock_settime_PyTime_GetMonotonicClockWithInfo_PyTime_GetSystemClockWithInfopthread_getcpuclockidPyUnicode_AsWideCharPyUnicode_EncodeDecimalPyUnicode_ReadChar_PyUnicodeWriter_WriteLatin1StringPyUnicode_TransformDecimalToASCII_PyUnicode_ToFoldedFull_PyTraceback_AddPyCode_NewEmptyPyFrame_Newsigfillsetpthread_sigmask_Py_DumpTracebackThreadsfputcfputs_Py_add_one_to_index_F_Py_add_one_to_index_Cwcstolabortgetrlimit64setrlimit64PyNode_ListTree_PyNode_SizeOfPyBuffer_GetPointerPyBuffer_FillContiguousStridesPyIndex_CheckPyIter_Check_Py_c_sum_Py_c_prodPyException_GetCausePyExceptionClass_NamePyGen_NeedsFinalizingPyFloat_GetMaxPyFloat_GetMinPyODict_NewPy_IncRef_Py_BreakPoint_PyObject_IsFreed_PyTrash_deposit_object_PyTrash_destroy_chain_PyMem_GetCurrentAllocatorNamePyMem_SetupDebugHooksPyObject_GetArenaAllocatorPyObject_SetArenaAllocator_Py_GetAllocatedBlocksPyStructSequence_SetItemPyStructSequence_GetItemPyUnicode_GetMaxPy_UNICODE_strlenPy_UNICODE_strcpyPy_UNICODE_strncpyPy_UNICODE_strcatPy_UNICODE_strcmpPy_UNICODE_strncmpPy_UNICODE_strchrPy_UNICODE_strrchr_PyUnicode_ToNumeric_PyUnicode_ToTitlecase_PyWeakref_GetWeakrefCountPyEval_ThreadsInitialized_PyEval_SignalAsyncExcPy_SetRecursionLimitPyEval_EvalFrame_PyEval_SetCoroutineOriginTrackingDepth_PyEval_GetCoroutineOriginTrackingDepth_PyEval_GetAsyncGenFirstiter_PyEval_GetAsyncGenFinalizerPyEval_GetFuncDesc_PyEval_RequestCodeExtraIndexPyCompile_OpcodeStackEffectWithJumpPyCompile_OpcodeStackEffectAnnotateRWLockDestroyAnnotateBarrierInitAnnotateBarrierWaitBeforeAnnotateBarrierWaitAfterAnnotateBarrierDestroyAnnotateCondVarWaitAnnotateCondVarSignalAnnotateCondVarSignalAllAnnotatePublishMemoryRangeAnnotateUnpublishMemoryRangeAnnotatePCQCreateAnnotatePCQDestroyAnnotatePCQPutAnnotatePCQGetAnnotateNewMemoryAnnotateExpectRaceAnnotateBenignRaceAnnotateBenignRaceSizedAnnotateMutexIsUsedAsCondVarAnnotateTraceMemoryAnnotateThreadNameAnnotateIgnoreReadsBeginAnnotateIgnoreReadsEndAnnotateIgnoreWritesBeginAnnotateIgnoreWritesEndAnnotateIgnoreSyncBeginAnnotateIgnoreSyncEndAnnotateEnableRaceDetectionAnnotateNoOpAnnotateFlushStateRunningOnValgrindPyObject_CheckReadBufferPyErr_GetExcInfoPyErr_SetExcInfo_PyHamt_LenPyImport_GetMagicTagPyImport_ExtendInittabPyImport_AppendInittabPyStatus_OkPyStatus_ErrorPyStatus_NoMemoryPyStatus_ExitPyStatus_IsErrorPyStatus_IsExitPyStatus_ExceptionPy_GetArgcArgvPyConfig_InitIsolatedConfig_PyDebugAllocatorStats_PyMethod_DebugMallocStats_PyFloat_DebugMallocStats_PyFrame_DebugMallocStats_PyList_DebugMallocStats_PyDict_DebugMallocStats_PyCFunction_DebugMallocStats_PyTuple_DebugMallocStats_PyObject_DebugTypeStatsPyPreConfig_InitIsolatedConfigPyFPE_dummy_Py_KeyedHash_Py_IsCoreInitializedPy_IsInitializedPy_SetStandardStreamEncodingPy_AtExit_Py_RestoreSignals_PyInterpreterState_RequiresIDRef_PyInterpreterState_RequireIDRefPyInterpreterState_HeadPyInterpreterState_Next_PyGILState_GetInterpreterStateUnsafe_PyCrossInterpreterData_NewObjectPyParser_ClearError_PyTime_AsTimeval_noraisePyThread_create_keyPyThread_delete_keyPyThread_delete_key_valuePyThread_set_key_valuePyThread_get_key_valuePyThread_ReInitTLSPyGILState_GetThisThreadStatePyThread_set_stacksize__sysconfPyThread_tss_allocPyThread_tss_freePyThread_tss_is_createdPyGILState_CheckPyOS_mystricmpPy_EncodeLocale_Py_DumpHexadecimal_Py_DumpASCII_Py_DumpDecimalPySignal_SetWakeupFd_PyOS_InterruptOccurred_PySignal_AfterFork_PyOS_IsMainThread_Py_hashtable_size_Py_hashtable_get_PyMem_DumpTraceback_PyDict_CheckConsistency_PyType_CheckConsistency_PyUnicode_CheckConsistency_PyObject_CheckConsistency_PyObject_GC_Calloc_PyEval_SetAsyncGenFinalizer_PyEval_SetAsyncGenFirstiterPyEval_SetProfilePyErr_WarnPyUnicodeEncodeError_CreatePyEval_CallFunctionPyGrammar_LabelRepr_PyParser_TokenNamesfseekfgets_PyPreCmdline_SetArgvPyConfig_SetWideStringListPyConfig_SetBytesStringPy_PreInitializeFromBytesArgsPy_PreInitializeFromArgsPy_PreInitializePyEval_ReleaseThreadPyEval_AcquireLock_Py_SetProgramFullPathPy_SetProgramNamePy_SetPythonHome_PyGILState_ReinitPyThread_get_stacksize_PyRuntimeState_ReInitThreadsPyArg_Parse_PyArg_ParseStack_Py_DumpTracebackPyUnicodeEncodeError_GetReasonPyUnicodeDecodeError_GetReasonPyUnicodeTranslateError_GetReasonPyPickleBuffer_ReleasePyNumber_InMatrixMultiplyPyInit_xxsubtypePyModule_GetWarningsModulePyOS_InitInterruptsPyPickleBuffer_FromObjectPyObject_AsWriteBufferPyObject_AsReadBufferPyObject_AsCharBufferPySequence_LengthPyMapping_LengthPyObject_LengthPyCapsule_GetNamePyCapsule_GetDestructorPyCapsule_GetContextPyCapsule_SetPointerPyCapsule_SetNamePyCapsule_SetDestructorPyCapsule_SetContextPyFile_SetOpenCodeHookPyContext_ExitPyContext_EnterPyArg_VaParsePy_VaBuildValue_PyInterpreterState_IDInitrefPyInterpreterState_GetIDPyCell_GetPyInstanceMethod_FunctionPyMethod_SelfPyMethod_Function_PyCode_SetExtra_PyCode_GetExtraPyFunction_SetAnnotationsPyFunction_GetAnnotationsPyFunction_SetClosurePyFunction_GetClosurePyFunction_SetKwDefaultsPyFunction_GetKwDefaultsPyFunction_SetDefaultsPyFunction_GetDefaultsPyFunction_GetModulePyFunction_GetGlobalsPyFunction_GetCodePyState_RemoveModule_PyLong_Size_t_Converter_PyLong_UnsignedInt_ConverterPySlice_GetIndicesPyCFunction_GetFlagsPyCFunction_GetSelfPySet_PopPyObject_DelItemStringPyType_GetSlot_PyHamt_EqPyErr_FormatVPyObject_CopyDataPyBuffer_FromContiguous_PyMethodDef_RawFastCallDict_PyCFunction_FastCallDict_PyEval_CallTracingPyUnicode_CountPyUnicode_AsUCS4Copy_Py_SuitePySys_AddAuditHook_PyUnicode_AsUnicodePyUnicode_GetSizePyUnicode_AsUnicodeCopyPySlice_GetIndicesEx_PyDict_DelItemIfPyUnicode_DecodeLocaleAndSize_PyImport_ReInitLock_PyCrossInterpreterData_Lookup_PyObject_CheckCrossInterpreterDataPyThreadState_SetAsyncExc_PyThreadState_DeleteExcept_PyEval_ReInitThreads_PyInterpreterState_IDIncref_PyInterpreterState_LookUpID_PyCrossInterpreterData_Release_PyObject_GetCrossInterpreterDataPyThreadState_Delete_PyObject_NewVargetppidPySequence_InPlaceRepeatPySequence_RepeatPyInstanceMethod_New_PyAsyncGenWrappedValue_Type_PyAsyncGenASend_TypePyGen_New_PyAsyncGenAThrow_TypePySequence_InsigismemberPyContext_Copy_PyHamt_NewIterKeys_PyHamt_NewIterItems_PyHamt_NewIterValuesPyDict_ValuesPySequence_DelSlicePySequence_SetSlicePyUnicode_EncodeUTF8PyUnicode_EncodeLatin1PyUnicode_EncodeASCIIPyUnicode_FromObjectPyUnicode_RSplitPyObject_HasAttrPyObject_HasAttrStringPyMemoryView_GetContiguous_PyUnicodeWriter_PrepareKindInternal_PyUnicode_DecodeUnicodeEscape_PyUnicode_DecodeUnicodeEscapeInternalPyUnicode_DecodeUTF7PyCFunction_NewPyUnicode_ResizePyFrame_FastToLocalsPyModule_GetFilenamePySys_SetPathPySys_AddWarnOptionUnicodePySys_AddWarnOptionPySys_HasWarnOptions_PyObject_HasAttrIdPyFile_OpenCodePyFile_FromFdPyMarshal_ReadShortFromFilePyUnicode_InternImmortalPyFunction_NewPySys_SetArgvExPySys_SetArgv_PyArg_ParseTupleAndKeywordsFast_PyArg_ParseTupleAndKeywordsFast_SizeT_PyArg_VaParseTupleAndKeywordsFast_PyArg_VaParseTupleAndKeywordsFast_SizeT_PyArg_ParseStackAndKeywords_SizeT_PyPreConfig_AsDict_Py_GetConfigsAsDictPyInterpreterState_GetDictPySys_AddXOptionPySys_GetXOptionsPyUnicode_EncodeRawUnicodeEscapePyUnicode_EncodeUnicodeEscapePyMarshal_WriteLongToFile_PyMethodDef_RawFastCallKeywordsPyCodec_DecoderPyCodec_EncoderPyCodec_KnownEncodingpausePyOS_StdioReadline_PyOS_ReadlineTStatePyOS_InputHookclearerrPyOS_ReadlineFunctionPointerPyByteArray_FromObjectPyCodec_StreamWriterPyCodec_StreamReaderPySys_WriteStdoutPySys_FormatStdoutPyFile_GetLine_PyDictView_Intersect_Py_set_blocking_Py_get_blocking_Py_set_inheritable_async_safe_Py_get_inheritablePyInit__tracemallocsigpendinggetgroupsgetresgidwaitidgetresuid__sched_cpuallocsched_getaffinity__sched_cpufree__sched_cpucountsched_getparamsched_getschedulersched_rr_get_intervalsched_setparamsched_setschedulersched_yieldopenptygetpgidwait4getsidsetsidsetpgidtcsetpgrpPyUnicode_AsEncodedUnicodePyUnicode_AsEncodedObjectPyUnicode_AsDecodedUnicodePyUnicode_AsDecodedObjectPyCode_NewPyMapping_ValuesPySys_ResetWarnOptionsPyMapping_HasKeyString_PyInterpreterState_GetMainModulePyMapping_HasKey_PyImport_FindBuiltinftruncate64sched_setaffinityfsyncfdatasyncnicegetprioritysetprioritycopy_file_rangeumasksched_get_priority_maxsched_get_priority_minwait3tcgetpgrpdup3readvpread64preadv64v2writevpwrite64pwritev64v2posix_fallocate64posix_fadvise64fpathconfalarmstrsignalsiginterrupt_Py_Sigset_Convertersigaddsetsigwaitinfosigwait_Py_Uid_Convertersetresuidsetreuidseteuidsetuid_Py_Gid_Convertersetresgidsetgidsetregidsetegidsetgroups_PyInterpreterID_LookUpsigtimedwait_PyTime_FromMillisecondsObjectPyLong_FromUnicodereadlinkatPyErr_SetFromErrnoWithFilenamegetpwuid_rsetpwentgetpwentendpwentttynamectermidgetloginstrcspnPyParser_SetErrorPyStructSequence_InitTypePyInit__symtable_PyFunction_FastCallDict_Py_strhex_bytesPyUnicode_AsCharmapStringPyUnicode_AsUTF32StringPyUnicode_AsUTF16Stringmknodatmknodmkfifoatmkfifochrootmemfd_create_Py_statgetpwnam_rPyUnicode_Encode_PyBytes_DecodeEscapeferror_PyObject_Dump_PyGC_Dumpgetgrouplistinitgroupsbindtextdomainwcscollwcsxfrmdcgettextbind_textdomain_codesetPyUnicode_TranslatePyUnicode_TranslateCharmap_PyArg_VaParse_SizeTsendfile64PyArg_VaParseTupleAndKeywords_PyArg_VaParseTupleAndKeywords_SizeTPyImport_ExecCodeModuleObjectPyImport_ExecCodeModuleWithPathnamesPyImport_ExecCodeModuleExPyImport_ExecCodeModulePyImport_ReloadModulePyUnicode_FindPyTokenizer_FindEncodingFilenamefdopenPyTokenizer_FindEncodingPyTraceBack_Print_PyErr_WriteUnraisableDefaultHook_PyErr_DisplayPyParser_ParseStringFlagsPyParser_SimpleParseStringFlagsPyParser_SimpleParseStringPyParser_ParseStringPyParser_ParseFileFlagsExPyParser_ParseFileFlagsPyParser_SimpleParseFileFlagsPyParser_SimpleParseFilePyParser_ParseFilePyEval_CallMethodPyErr_WarnExplicitPyMarshal_ReadObjectFromFile_PyThread_CurrentFrames_PyInterpreterState_DeleteExceptMainPyOS_AfterFork_ChildPyOS_AfterForkPyErr_SyntaxLocationExPyErr_SyntaxLocationPyFuture_FromASTPySymtable_BuildPyParser_ASTFromFile_Py_SymtableStringObjectFlagsPy_SymtableStringPy_SymtableStringObjectPyParser_ASTFromStringPyErr_ProgramTextPy_SetPathPy_GetPathPy_GetPrefixPy_GetExecPrefixPy_GetProgramFullPathPy_GetPythonHomepthread_killposix_spawn_file_actions_initposix_spawn_file_actions_addopenposix_spawn_file_actions_addcloseposix_spawn_file_actions_adddup2posix_spawn_file_actions_destroyposix_spawnattr_initposix_spawnattr_setpgroupposix_spawnattr_setsigmaskposix_spawnattr_setsigdefaultposix_spawnattr_setschedpolicyposix_spawnattr_setschedparamposix_spawnattr_setflagsposix_spawnattr_destroyposix_spawnpposix_spawnforkptyutimensatfutimensfchownlchownfchownatfgetxattrlgetxattrfsetxattrlsetxattrfremovexattrlremovexattrflistxattrllistxattrfexecvesymlinkatsymlinkexecvkillpglockf64setitimergetitimerPyAST_CompileExPyNode_CompilePyAST_CompilePy_CompileStringExFlagsPyCompileStringPy_CompileStringPy_CompileStringFlagsPyRun_StringPyRun_FileExFlagsPyRun_FilePyRun_FileExPyRun_FileFlags_PyContext_NewHamtForTestsPyContext_CopyCurrentPyContext_New_PyHamt_WithoutPyContextVar_ResetPy_EndInterpreter_PyInterpreterState_IDDecref_PyInterpreterID_New_PyInterpreterState_GetIDObject_PyTraceMalloc_GetTraceback_Py_hashtable_popPyTraceMalloc_Untrack_Py_hashtable_clearPyMarshal_WriteObjectToFilePy_FinalizePy_InitializeExPy_Initialize_Py_InitializeMainPyRun_SimpleStringPyRun_SimpleFilePyRun_SimpleFileExPyRun_InteractiveOneObjectPyRun_InteractiveOneFlagsPyRun_InteractiveOnePyRun_InteractiveLoopFlagsPyRun_AnyFilePyRun_AnyFileExPyRun_AnyFileFlagsPyRun_InteractiveLoopPy_NewInterpreterPy_AddPendingCallPyErr_SetInterruptPy_FrozenMainsetbufPy_MainPyTraceMalloc_Track_Py_hashtable_copy_Py_M__zipimport_Py_M__importlib_bootstrap_external_Py_M__importlib_bootstrap_PyImport_Inittab_PyOS_mystrnicmp_hackPyFPE_jbufPyFPE_counter_PySet_Dummy_Py_abstract_hack_Py_capitalize__doc___Py_count__doc___Py_endswith__doc___Py_find__doc___Py_index__doc___Py_isalnum__doc___Py_isalpha__doc___Py_isascii__doc___Py_isdigit__doc___Py_islower__doc___Py_isspace__doc___Py_istitle__doc___Py_isupper__doc___Py_lower__doc___Py_rfind__doc___Py_rindex__doc___Py_startswith__doc___Py_swapcase__doc___Py_title__doc___Py_upper__doc___Py_maketrans__doc__libm.so.6libc.so.6libpython3.8.so.1.0GLIBC_2.29GLIBC_2.2.5GLIBC_2.14GLIBC_2.7GLIBC_2.6GLIBC_2.28GLIBC_2.3.4GLIBC_2.25GLIBC_2.15GLIBC_2.26GLIBC_2.27GLIBC_2.4GLIBC_2.33GLIBC_2.3GLIBC_2.17GLIBC_2.32GLIBC_2.34GLIBC_2.3.2GLIBC_2.9/opt/alt/python38/lib64:/opt/alt/sqlite/usr/lib64                                    0ͩui ةii ii ti %0 ;ii F Pii [ ep{ri ii ui ةP- X-`-`--t -$t -$ -ot -p -o -r- -= -p -$t -s -Ut -= (-p 0-$t 8-s @-Ut `-=T h-<p-t x->---= -`?-= -\-= ->-G> -&-=> -@?-Q> -?-t -t -t (-t @-t H-t `-|u -r2 -u -u - -ٰ -r2 -u -s -= -p -$t -u - -v 0-v @-v P-v `-v p-v -v -v -v -v -v -v -v -v -v -v -v 0-v @-w P- w `-w p-w -%w --w -6w -?w -v -v -v -v -w - w -w 0-w @-#w P-+w `-4w p-=w -Fw -Pw -Xw -w -w -w -aw -hw -ow -ww -w 0-w @-w P-w `-w p-w -w -w - - - -I1 - -} -CX -} 0- 8-I1 P- X-I1 - -c= -!} - -= -p - -= -p - - -v0 -h - -4 -? 0-/ @-/ `-, h- p- -, - - -, -H -, - - -Q -, -1' -Q -, -1' -, (- 0- @-, H- P- `-, h- p- -u - - - - - - -Ƃ -ς -|= -|= 0-|= @- P- X- p-b x- -ٰ -ٰ -ٰ -|= -ٰ - -|= -ٰ - -4x - -|= @-ٰ H- P-|= `-ٰ h- -ٰ -{ -{ -{ -{ -{ -{ -{ -bl -bl -bl 0-ٰ 8- `-ٰ h-u p- x-Z -ٰ -u -Z -bl -bl -7 - -bl  -bl -ٰ ( - 0 -u 8 -Z P -{ X - p - -{ -; -; -18 -88 -G8 -ٰ -` -Zb !-{ !-ٰ (!-~ 0!-z 8!-Z @!-|= P!-ٰ X!-Z p!-ٰ x!-Z !-y, !-s !-~ !-B !-Z !-ٰ !-Z "-s "-~ "-V "-a @"-s H"-~ P"-V X"-a "-s "-~ "-1' "-l "-w "-ٰ "-Z "-2 "-2 "-2 "- #- #- #- #- #- (#-Ye @#-2 H#-2 P#-2 X#- `#- h#- p#- x#- #- #-Ye #- #- #-! #- #- #-ٰ #-u #-Z $-ٰ $-Z $-ٰ @$-s H$-~ P$-V X$-a `$-|= p$-ٰ $-ٰ $-{ $- $-bl $-{ $- $-ٰ $-{ $- $-Z $-|= $-bl $-u %-ٰ (%-u 0%-Z 8%-|= P%-ٰ `%-ٰ h%-u p%-Z x%- %-|= %-ٰ %-Z %-|= %-2 %-ω %-ۉ %- %- %- %- %- &-+ &-: &-G &-U &-d (&-r 0&- 8&- @&- H&- P&- X&- `&-Њ h&-݊ p&- x&- &- &- &-" &-1 &-? &-< &-< &- &- &-l &-2 &-"2 '-O> '-p @'-W] H'-_] P'-N] X'-D] p'- '-˚ '-@- '-M '- '-d '-/ '- '-! '-- '-K '- '- (-Xo (-" (-po (-" (-((-@(-ٰ H(-` P(-X X(-T `(-v h(-k p(-\ x(- (-S(-I(-*q (- (-.(-$(- (-.(-$(- )-.)-$ )-˜ 0)-.8)-$H)-՜ X)-.`)-$p)- )-.)-$)- )-.)-4$)- )-.)-L$)- )-`.*-d$*- *-.(*-|$8*- H*- .P*-$`*- p*-.x*-|$*-$ *-`.*-$*-s *-.*-$*-+ *-`.*-$+-7 +-.+-$(+-B 8+-.@+-$P+-L `+- .h+-$x+-V +-.+-$+-i +-@.+- $+-s +-.+-$$+-| ,-`.,-<$,- (,-.0,-T$@,- P,-.X,-l$h,- x,-@.,-$,- ,-.,-$,- ,-`.,-$,- ,-.,-$--˝ -- . --$0--ם @--.H--$X-- h--`.p--$-- --.--$-- -- .--$-- --.--$-- .-@..-$ .-- 0.-.8.-$H.-9 X.-`.`.-,$p.-E .-..-D$.-S .-..-\$.-_ .-..-t$.-m .- ./-4$/-x /-.(/-$8/- H/-.P/-$`/- p/-.x/-$/- /-./-$/- /-./-$/- /- ./-$0- 0-@.0-$(0- 80-`.@0-$P0- `0-.h0-$x0- 0-.0-$0-Ξ 0-`.0-$0-ڞ 0-.0-4$0- 1-.1-4$1- (1-@.01-L$@1- P1-.X1-L$h1- x1-`.1-L$1- 1-.1-d$1- 1-`.1-|$1-_ 1-.1-$2- 2-. 2-d$02- @2- .H2-d$X2- h2-.p2-d$2-% 2-`.2-d$2-0 2-.2-d$2-; 2-.2-d$2-@ 3- .3-d$ 3-G 03-.83-$H3-M X3-.`3-$p3-W 3-.3-$3-\ 3-.3-$3-j 3-.3-$3-r 3-.4-$4-M 4- .(4-$84- H4-.P4-$`4- p4- .x4- $4- 4-.4-$4- 4-`.4-$$4- 4- .4-<$5- 5-.5-$$(5-$ 85-.@5-$$P5- `5-~.h5-T$x5-ğ 5-}.5-$5-ɟ 5- }.5-l$5-ҟ 5-|.5-$5-ڟ 6- |.6-$6- (6-{.06-$@6- P6- {.X6-$h6- x6-z.6-$6- 6-y.6-d$6- 6-x.6-d$6- 6-v.6-$$7-3 7-"7-gK 7-(7-& 8-- 8-^(8-3 88-ޞ H8-ݴ X8-Ο h8-c x8-< 8-ן 8-|b 8-$ 8-C 8-Q 8-e8-L 8-/ 9-p 9-e~ (9-z 89-r =-p >-R >- >-} >-r ?-W ?-q ?-| H@-B-MB-B-fB-:B-B- B-2+B-MB-MB-gB-4$B-B-B-MB-MB-C-&C-KC-MC- C-(C-M0C-8C-S@C- HC-<PC-XC-3`C-8hC-*pC-MxC-MC-MC-MC-MC-MC-MC-MC-MC-MC-MC-MC-MC-MC-MC-MC-MC-MD-MD-MD-h_D-X D-W(D-0D-Y8D-@D- HD- PD-MXD-D'`D-hD- pD-3xD-rD-D-aD-yD-D-D-D-'D-]D-@D-8D-MD-LD-PD-(D-D-M)E-ME-E-%E- E-- (E-)0E-8E-@E-rHE-PE-L XE-)`E-hE-NpE- xE-E-|E-E-kE-ME-`E- E-E-E-E-E-E-E-$E-E-E-F-F-F-5F-I F-F(F-M0F-M8F-M@F-MHF-MPF-~XF-M`F-hF-pF-#xF-MF-MF-MF-F-?F-F-xF-MF-F- F-g F- #F-MF-MF-$F-KF-G-G-G-AG-q G-(G-0G-8G-+@G-HG-"PG-UXG- `G-YhG-pG-$xG-MG-PG-G-G-G-MG-MG-MG-MG-MG-MG-MG-MG-MG-MG-MG-MH-MH-MH-MH-M H-M(H-M0H-M8H-M@H-MHH-MPH-MXH-M`H-MhH-MpH-MxH-MH-MH-MH-MH-MH-MH-MH-MH-MH-MH-MH-MH-MH-MH-MH-MH-MI-MI-MI-MI-M I-M(I-M0I-M8I-M@I-MHI-MPI-MXI-M`I-MhI-MpI-MxI-MI-MI-MI-MI-MI-MI-MI-MI-MI-MI-MI-MI-MI-MI-MI-MI-MJ-MJ-MJ-MJ-M J-M(J-M0J-M8J-M@J-MHJ-MPJ-MXJ-M`J-MhJ-MpJ-MxJ-MJ-2 J- J-g J- J- J-ű J-r2 J- K- K-y K-x= K- (K-! 0K-u 8K- @K-á HK-' PK-С `K-gK hK-(pK-"xK-K-gK K-(K-"K-ʰ K-J K-S K- K- L- L- L-H 0L- 8L-H PL-= XL-p pL-u8 xL-T L-v8 L- L- L-' L-@ L-Ϫ L-} L-M? L-K L- L- M- M- 0M- 8M- PM- `M- hM-/ M- M-4x M-2 M- M-U M-_M-K M- M-_M-K N- N- N-v0 (N- 0N- 8N- @N- PN- XN- pN-)? N-״ N- N-ܴ N- N- N- N-f N-r N- N- O- O- O- O- O- (O-ʵ 0O-ӵ 8O-ߵ @O- HO- PO- XO- pO-2 xO- O- O- O-H O- O-H O- O- P- P-= P-p 0P-2 8P- PP- `P- hP-H P- P-H P- P- P- P-= P-p Q-\ Q-f Q-1 Q-k Q-r (Q-z 0Q- 8Q- @Q- HQ- PQ- XQ- `Q- hQ- pQ- xQ- Q-: Q- Q- Q- Q-ö Q-ȶ Q-ʷ Q-34 Q-ж Q-ض Q-߶ Q- Q- Q- Q- Q- R- R- R-) R-4 R-? (R-I 0R- 8R-ŷ @R-R HR-_ PR-j XR-t `R- hR- pR- xR- R- R- R-з R-ط R-߷ R- R-y4 R-{E R-B R- R- R- R- R-# R-( R-3 S-S-q 0S-  HS-q PS--`S-q hS--xS-q S--S--S--q - --"l - -q --l (- 8-q @-q H-kX-r `-r h-kx-%r -q --"l - -q --l (-( 8-q h--=r - -Cr -"---`-X-Mr (--8--h- -`r ȗ--З--- -# -SF-"-sr --@-}r H- X- "`-r h-~x-"-r --"-r -x-"- ș-ؙ-"-@$ -l-`"-r - -" -r (- %8-"@-r H-e%X-@"-r -"-@-- -`W-8 -s (- 8-@- s H- X-`-il h-x--T -~ -x-s - -X- < ț-E؛--k - --0s - - -l (-J 8-@@-;s H- X-x`-Qs h-H x--Zs - --bs - --os Ȝ-7 ؜-@(-[ 0-"@--P-p-r2 x-s -r2 -s - ȝ-=} Н-r2 ؝-( -s -r2 -s -} 8- X- x- -Ȟ-s x-s (-s ؠ-s -s @-u H-h- p- -s -b -̯ --"-s -`-" -^x (-8-"@-c H-OX-@"`- h- x-"- o -- "-8g -P-"-Kg ȣ- أ-@"- -b -"-+ -b -" -2 (-b 8- "@-s H-n\`- t h-i---0t -,t -0-"-м-X -Oȥ--إ-@--`-0-= -A-"- -A-"Ц-p ئ-A-" -V^ (- 8-"@-^x H-CX-`"`-c h- x-"-Kg -w -"- ȧ-v_ -C (-8-"@-"l H-X-"`--l h-x-"- -z$-"- Ȩ- -u -- - 8-p @-Db `-It h- p-uu -= - -s 8-Ut `-ԙ -V^ Ȫ-;ت- "-ct -m-@"-Kg - -" -^x (-8-"@-c H-X-"`- h-x-"-̯ --p"- -P-P"- ȫ-? ث-0"-+ - -"-2 - -" - (-A 8-Ж"@-8g H-X-"`- h- x-p"- o -#-@"Ȭ--Ь-C -\ (-^x H-8g h- -C - ȭ-̯ - -yt (--0-f h-t -t - --ct -u - (--l H- h- -+ -2 ȯ- ---t (-@-V^ H-S X-"`-^x h-x- "- -k -`"- - -@"-_ Ȱ- ذ-"-Kg -_ -" -u (-H- P-@p-u x- -t -ԙ @-V^ H-?`- h--̯ -- -?-+ Ȳ-:- -- -" -yt (-@-^x H-X-"`- h-Xx-"- --`"- --@"-_ ȳ-Cس-"-c -o-"-8g -[-" - (-c@- o H-BX-"`-t h- -u -ȴ- д-@-u - @-t h-ԙ -̯ ȵ--V^ -?- -? -2 (-F@- H-`- h-"-yt --Kg -|-"- o ȶ-Bض-"- -P-8g -[-" - (-c@-t H- -u - -^x - - - - (-@- H-`-_ h--Kg -- --+ ȸ--2 -y-̯ -? - (-3`-u h-- -@-u - -t (-ԙ -̯ --V^ -?- Ⱥ-?-+ -:-2 -F - (-@- H-"`-yt h-- -P-8g -[-"- Ȼ-c- o -B-"-^x --" - (-8-`"@- H-X-@"`-_ h-Cx-"-c -o-"- -X-"-Kg ȼ-|ؼ-"-t - (--0-0u h- -p-u -@--t - - (-_ H-Kg h- -+ -2 Ⱦ-̯ - - (-yt H-u h-^x - -u - Z-?u -+ - -" - (-Z8-`"@-2 H- X-"`-̯ h-@Zx-"- -<-"- -e -"- --"-Kg --`"-[u - -" - (- 8-"@- H-X-"`-c h-x-"-8 --"-^x -- "-fu -`-"-s --`"-8g -- " - o (-p 8-@"@-s H-[`- t h-Y-t ---@-u -P--- -`--tu -^x ->&-"- --"- - -" -Kg (-8-`"@-8g H- cX-`"`- h-px-"- o --l-"-̯ --`"- -PA- "-+ --"-2 -D-" - (-Щ8-@"@- H-X-"`-yt h-P-u --u -u - --u -<> -u @- h-ԙ -̯ ---u (- @-^x H-X-P"`- h-Wx-"- -Ɣ -Kg - -Ov -_v (- H-^x h-8g -ԙ --t-"- -r-"(- 0-`"@--P-P(X-`-----̯ -u - (- H--P- -= -p_-"-fv -M-"-Zk --@"-dk --"-+ --`" -|v (-q8- "@-qv H-X-"`-zv h-x-`"-v -N-"-v --"-v --@"(-W` 0-P"@---w -`-"- -`-"-w --"-ƅ --"-w -0-" -m (-08-"@-!v H-`X-"`-+v h-x-"- --"-ƅ - -"-w -P-"-< -PS- " -w (-@P8-"@-!v H-X-"`-+v h- x-"-x -x - x -*x -:x -Hx -^ -\x -; -A- # -cx (-A8- #@-mx H-X-@ #`-`g h-x-@ #-{x - - #-( - - #-x ->- #-x -@- #-x -`-`# -$b (-Џ8-#@-k H-- X-#`-x h-px-"-x -=2-"-Is - #--@-x H- "P--`-x h- -y --v -f0-y 8- &@--#8-1y P--Ey -- - -Xy (-`y 0-xy 8-y @-y H-y P-y X-y `-y h-y p-y x-z -z --"z -*z -Fz --Oz -Wz -uz -z - -@-%#-z - -@%# -oS (-"8-$#@-z H-] X-$#`-S h-P#x- $#-z - -##-`S - -@##-S -‚ -"#-z -?-@"#-~I -`6- # -I (-:8-#@-9S H-!X-#`-I h-=x-#-z -=-#-H -.-#-US -p"- #-z -2-#-S -=-# -z (- 8- #@-S H-X-#`-z h- x-@#-S -p&-#-z -4 -`#-S -P]- #-z -̓ -#-S -#-`#@- { H- P- -- -@&#---{ -+{ -П-@.# -3{ (-m 8--#@-;{ H-m X--#`-C{ h-x- -#-K{ -em -,#-T{ --`,#-\{ -0m - ,#-e{ -.m -+#-n{ -,m -+# -w{ (- m 8-@+#@-{ H-ܪ X-*#`-{ h- x-*#-{ -W -@*#-{ -.#--@-{ H-{ P-{ X-{ `-{ h-p-{ x-{ -{ --{ -{ -| -| -- -$ -`B#-0| --B#-o --@# -6| (-8-`@#@-g H-X->#`-@| h-}x->#-M| --=#-W| --@<#-Wl --@;#-g --`:#-a| -a - :# -n (-N8-9#@-1h H-{X-@9#`-g| h-.x-8#-r| -<-7#-z| --6#-h -- 6#-| -.-`5# -| (-`4#0-@-h-E| p-B#---2 -| - < --@J#- - -I# -k (- 8-@I#@-| H-2X-I#`-| h-| x-H#--| -K#------ -ԑ @-| H- X-@^#`- t h-x-^#-| -p-@^#-| --@^# -| (-68-`V#@-| H-X-@^#`- t h-x-^#-| -`-@^#- t --^#-| --@^# - t (-8-^#`-| h-x-@^#- t -Ь-^#-| --@^#- t -`-^# -| (-8-@^#`-| h- x-Y#-| - -@^#- t --^#-| --@^#- t -в-^# -t (-8-\#`-| h-x-@^#- t --^#-t --\#-| --@^#- t --^# -t (-8-\#`-| h- x-@^#- t --^#-t --\#-| --@^#- t --^#@-| H-X-@^#-| --@^#-| - -@^#-} -p- ]# -| (-д8-@^#`-| h-@x-@^#- t -з-^#-~ -P3-`#(-)} 0-`#@--x- t - -| -P--} (-0-0-} h--p-`} ---} ---1' (-~ @-> H-~ h--p-;~ ---} -~ --`j#-~ --i# -~ (- 8-@i#@-~ H-d X-h#`- h- x-g#-# --g#-? --`f#-E# -0-e#(- 0-k#@--x- -tR -M - -% -* 8-E `-) h--7 -p -8- -T-V-3a -Ӎ -Jz -HS(-U-`-O h-=x-p#-V - -@p#- - -p#-| -sS-o#-a -sS-o#-1' -Ԧ -`o# -_v (-8-o#@-f H-VX-n#`-^ h- x- n#-O^ -ۏ -m#-Q --m#-q -?-`m#-| - -q#-: -0?- m# -y (-8-l#@- H- X-l#`-E^ h-ʎ x-@l#-t -L -l#-} -s -@q#-| - _ -q# - (-8-r#@-a H- X-q#`-| h- x-q#-| --q#- -h -# -| -p-.E -0-@t#(- 0-t#@--x- -ش -M - - 0--`---- --@-@8-$-| -- #-| -- # -| (-8- #`-$ h-`x-@#-&Q --#-yQ --#-iQ -P-@#-P -`-#-Q --# -^ (-? 8-#@-Q H-X-@#`-Q h- x-#-> -`-#-Q --#-Q -@-@#-Q -@-#-x= -B-# -* (- 8-#@- H-0X-@#`- h-x-#-. -d -#-2 --#-Q --@#-Q -@-#-9 -` -# -F (- 8-#@-Q H- X-@#`-F h- x-#-Q -Ya -~#-Q -Xc -~#-> -P-@~#-Q -qb -~#-Q -a -}# -Q (-c 8-}#@-Q H-9b X-@}#`-Q h-b x-}#-Q - c -|#-Q -a -|#-Q -c -@|#-Q -b -|#-Q --{# -Q (-d 8-@{#@-qQ H-X-{#`-> h-px-z#-> --z#-Q -_-@z#-Q -b -z#-D-0-y#-r--y# - (-p 8-@y#@-D> H-PX-y#`-F h- x-x#-u: - -x#-{j -H-v#-P -`-`u#(.> 0.#@.`-x. .c= ..] .. .(@.| H.`. t h.. .`. .~ . (.]@.| H.P`.| h.}. .}.M ..#.B= .e.@#H. P.@#`...0.€ . .P.`#X.U`.p...?0.`.O@. H.0P. X. p. .C .I . . #.r^ . .#.Y . .@#. .К.#h.~^ p.... < ..#.C .~.#. F . 3.# .C (.8.#@.D H. X.#`.C h.x.#.>D .P.@#.+ ..#.1D .p.#.C ..#.#D ..@# .= (.0s8.#@.> H.{X.#`.C h.Ђx.#.8C ._. #.C .@.#.iD ..`#.D .. # .,>  .p| .# .X> ( .8 .#@ .qF H .pX .`#` .E h .x .# .E .Т .# .D . .@# . D .Ј .# .C .p .# . D  . .# .C ( .@8 .@#@ .B H .4X .#` .C h .@x .# .C .0 .# .IC .` .@# .tB .G .# .C .  .# .fB  .D .`# .DF ( .08 . #@ .l H .MX .#` .F h .x .# .F . .# .e ..H .-P . F .- .C .q .r .# .m .  .# .F  .P .# .Q ( .8 .#@ .w H .X .@#` .| h .x .# .֤ . .`# . . .# . .p .@# .| . .#. ..#@. H.PX.. .. . .h . H.`.7 h.`x.`#. ..#.ű ..#.7 .p. #.h ..`#. .>.# .S (.`8.#@.| H.X.#`. h.x.#.́ ..P.ց .0.. .,} @., `.h.= .. .. .X .q (.8.#@.F H.X.#. . .pA.`#. . .0# . (.8.#@. H.X.#`. h.x.#.$ ..@#.V ..H.`-P.q .@-.m . -.F .-.| H.-P.֤ .-.Q .-.w .-. H.`-P. .[ .h. .p..(.0-0. h.@-p.h .l .С..@.P.#.`..@...H. -P.S .-. .؂ .`L.` 8.p.@#.. ....@.`. h. p. x. . . . . .' .0 .: .A .P .Y .g .. #.j .u.# .p (.8.#`.y h.#p.`.. .#..(.{ 0.#@.`1. . . . . . .ƒ .˃ . . . . . . .. ..J .f (.6 0.o 8.x @. H.R P. X.`. h.p. x. . .ʄ . . . . .2 .: .C .L .T  .] .e 0 .m @ .v P .} ` . .{ .{ .{ .{ .{ . . . .H!.ƅ !. !.߅ !.΅ !. (!. @!. H!. `!.I h!.* p!.f: x!.4 !.@ !.N !.d !.t !. !.!. !.!.A !.". ".(".ٰ H".`". ". ".#". ".".#". ".:". #".{ ".".##. #.ן #.@# #. (#.; 8#.#`#.!v h#.P4#.+v #.@7#.̯ #.C#.{ #.p[#.P$$.C $. $.`L$ $. ($.8$.K$@$.; H$.@@X$.J$`$.v= h$.mx$.F$$.Ɇ $.q$.@F$$.gn $.a$.A$$.І $.nr$.`@$$.n $.s$.?$%.j %.%.@?$ %.׆ (%. 8%.>$@%.߆ H%.@8X%.>$`%. h%.x%. >$%.n %.?u%.`;$%.L %.n%.8$%.* %.%.7$%.+ %.%.`6$&. &.2v&.5$ &. (&.v8&.5$@&. H&.wX&. 5$`&.:n h&.Wx&.1$&.n &.Y&.-$&.j &.&.@,$&. &.By&.*$&.+ &. o&.($'.\ '.@'.&$ '.NR ('.P8'.@%$@'.n H'.xX'."$`'.f: h'.+x'.@"$'. '.{'.!$'.! '.'.!$'.: '.,'.$'.: '.0"'.@$(.Yn (.\(. $ (.~ ((.48(. $@(.' H(.L|X(.$`(.n h(.zx(.$(.n (.n(.$(.q< (.0H(.`$(.- (.`(. $(.> (.|(.$).U ).}).`$ ).?e ().;58).$@).Pe H).5X).$`).ee h).!6x). $).e ).6).@$).e ).7).`$).l ).7). $).f ).p).` $*.+e *.o2*. $ *.x (*.78*. $@*.In H*.2\X*. $`*. h*.x*. $*. *.*. $*. *.*. $*.:k *.%*. $*. *.20*.$+. +.8+.$ +. (+.j 8+.@$@+. H+.y X+.`$`+. h+.x+. $+. +.A+.$+.n +.B|+.$+. o +.|+.@$+. +.`+.$,.LJ ,.,.$ ,.h (,.8,.@$@,.χ H,.pX,.$`,.և h,.Ax,.$,.h ,.,.@$,.އ ,.,.$,.Lk ,./,.$,.v ,.U8,.$-.e -.8-.@$ -.# (-.88-.$@-. H-.~X-.$`-. h-.U9x-.@$-."e -.0-.#-.}< -.K-.#-.e -.:-.@#-. -.b:-.#..e ..:..# .. (..8.. #@..e H..:X..#`..h..0x..#..̯ ....#..g ..ז..@#.. ....`#.. ....#/. /.À/.# /.o (/.I}8/.#@/.7g H/.łX/.#`/.^x h/.x/.@#/.Dg /./.#/.=g /./.#/.Cg /.Y/.#/.Kg /./.`#0.Rg 0.a0.# 0.Jg (0.80.`#@0.Qg H0.X0.`#`0.}l h0.bx0.#0. 0.0.#0. 0.0. #0. 0.0.#0.# 0.0.#1.j 1.1. # 1.j (1.81. #@1.) H1.= X1.#`1./ h1. x1.`#1.g 1.Η1.#1.)o 1.(1.`#1. o 1.ϊ1.`#1.Yg 1.1.@#2.ig 2.Đ2.@# 2.9 (2.82.#@2.I H2.;X2.#`2. h2.р x2.@#2.5 2.2.#2.< 2.r2.`#2.d 2.+) 2. #2.B 2.Ms2.#3.L 3.o3.@# 3.V (3.՛83.`#@3.c H3.X3.#`3.n h3.Px3.#3.z 3.Q3.#3. 3.Q3.#3. 3.@3. #3. 3.3.#4. 4.-4. # 4. (4.84.#@4. H4.0X4.#`4. h4.Us x4.@#4.wg 4.'4.#4.xg 4.u4.#4. 4.C 4.#4. 4.H4.#5.5. 5. # 5.vh (5.85.#@5.h H5.X5. #`5.̈ h5.1x5.#5.ֈ 5.705. #5.pn 5.Cd5.#5.n 5.f5.#5.n 5.Aj5.#6.n 6.`l6.# 6. (6. 86.#@6. H6.` X6.#`6. h6.#x6.`#6.g 6.6.#6. 6.~6.@#6.g 6.6.#6.; 6.26.@#7. 7.r7. # 7. (7.r87.#@7.* H7.X7.#7.* 7. #7. .7. 7.#7.`!.7.N 7.#7.!.7. 7. #7.@!.8. 8. #8.. 8. (8.#08..@8. H8.@#P8. .8._ 8. T$8.#.8.-8. (9.@#-09.:n h9."-p9.n 9.$-9.gn 9.$-9.І (:.$-0:.n h:.%-p:.{ :.$-:.* :.-:. (;.0-0;. h;. -p;. ;. ;.-;.{ <. (<. -0<.- h<.`%-p<.C <.P%-<.; <. %-<.v= (=.p$-0=.j h=.@$-p=.n =. $-=.L =.#-=.+ (>.@"-0>.+ h>."-p>.\ >.!->.NR >.p!->.: (?.P!-0?.: h?. !-p?.Yn ?. -?.n ?."-?.j (@.!-0@.n h@. -p@.@.-@.j @.`-@.j (A.0-0A. o hA.-pA. A.`-A.xg A.@-A.pn (B.-0B.n hB.-pB.n B.-B.n B.-B.; (C. HC.!-PC.f: C.P-C.* C.e C.6D./ D.".D.".hE.$-pE.Ɇ E.#-E. E.#-E. (F."-0F. hF.!-pF.' F. -F.> F. -F.U G.t (G. -hG.p -pG. G.~ G.P -G. H. -H. HH.-PH. H.so H.} H. H.1' H. -H.5 I.-I.< HI.-PI.B I. I. I.Ë I.Ӌ I. I. I. I. J." J.. J.? 0J.G @J.b PJ.~ `J. pJ. J.ь J. J.J. J." J.= J.U J.r K. K. K.@K.ō PK.э `K. pK. K. K. K. K.' K.3 K.? K.K K.V L.e L.p L.| 0L. @L. PL. `L.Ύ pL. L. L. L. L. L.$ L.2 L.@ L.O M.[ M.d M.q 0M. @M. PM. `M. pM. M.Џ M. M. M. M. M. M.4 M.@ N.L N.X N.e 0N.p @N. PN. `N. pN. N.Ð N.א N. N. N. N. N. N.' O.9 O.E O.U 0O.c @O.n PO. `O. pO. O. O.ő O.ԑ O. O. O. O. O. P." P.6 P.J 0P.S @P._ PP.k `P.x pP. P. P. P. P. P.֒ P. P. P. Q. Q. Q.' 0Q./ @Q.A PQ.X `Q.l pQ.z Q. Q. Q. Q. Q. Q.Ɠ Q.ד Q. R. R. R. 0R.) @R.6 PR.D `R.W pR.b R.{ R.R. R. R.Ŕ R.ܔ R. R. S.% S.9 S.O 0S.Y @S.f PS.v `S. pS. S. S. S. S.ŕ S.ҕ S.ݕ S. S. T. T.% T.: 0T.I @T.[ PT.k `T.} pT. T. T. T.Ö T.ؖ T. T. T. -T.̯ (U.p-0U. hU.-pU.V U.-U.c U.-U.n (V.-0V.z hV.-pV. V.-V. V.-V. (W.@-0W. `W. hW. xW.`$W.s W.؟ W.@`$W. W.6 W._$W." W.uW.]$W., W.@ W.`]$X.6 X.O_ X.]$ X.k (X.i 8X.`\$@X.@ HX.(_ XX.\$`X.N hX.]xX.Z$X.:o X._X.Y$X.V X.׹ X. Y$X.` X.`X.X$X.m X. MX. X$Y.m Y.MY.W$ Y.m (Y.4 8Y.V$@Y.k HY. XY.U$`Y.t hY.T xY.U$Y."/ Y.`$Y.`W.(Z.&-0Z.N hZ.&-pZ.:o Z.ٰ Z.Z. Z. Z. '1Z. [.W] [.pt[.q6 `[._] [.N] [.D] \. \.^ H\.̯ h\.f \.\.ٰ \.@'-\.Pp ]. ].8]. ].` ].߅ (].@]. H].`i$P].].`].× h].p].͗ x].].ח ].].ݗ ]. ].2 ].h]."2 ].]. ].]. ].^. ^.H^. ^. ^. (^.p@^.T H^.! P^.b X^.$ `^.b h^.$ p^.' x^.0 ^.] ^.: ^.= ^.J ^.M ^.U ^.X ^.k ^.b ^.n ^.b ^.q ^.b ^.t ^.w ^. _.%` _. _.~` _. _.t` (_. 0_. 8_. `_.) h_. p_./ x_.ʘ _.ߘ _. _. _._. _. _.H< _. _.$_.$ _.p1_.`$`.f `.:`.$ `.* (`.88`.$@`.4 H`. X`.$``.m h`.?x`.$`. `.P`.`$`.F `.`.$`.,- `.1`.$`.( `.``.$a.O a.-> a. $ a.b (a. 8a.$@a.q Ha./ Xa. $`a. ha.pxa.$a. a.a. $a. a.Іa.@$a. a.a. ~$a.5? a.a.}$b./ b.p&b. |$ b./ (b.8b.{$@b.ҙ Hb. Xb.z$`b. hb.[7xb.y$b. b.7b.`y$b. b.`}b.w$b. b.|b.@w$b.& b.Rub.@u$c.Z c. c.t$ c.5 (c. 8c.t$@c.@ Hc.sXc.s$`c.C hc.[xc.`r$c.R c.@_c.q$c.5^ c.ƈ c.p$c.[ c. c.p$c.c.tc.n$d.d. d.@n$ d.m (d.8d.m$@d. Hd. Xd. m$`d.N hd.n)xd.k$d. d.[d.@k$d. d.[d.j$d.ٰ (e. 0e.$@e._.xe.e.> e./ e.t e.'-e.H< f.× (f.͗ Hf.њ hf. f.S f.po f. f. g. g.i$g.`]. g.ޚ (g. $0g.@^.@g. Hg.$Pg.`_.`g. hg.@j$pg.].g. g. g. g.= g.Kg h.'-h.Hh.p'-Ph. h.$ h. h.6 h.ֵ i. Hi.> pi.] i.B i.T j.X 8j.= Xj.Xo xj.gj.,- j.\ j.k j.v k.v0 8k. Xk." xk.s k.d k. k.B k. l.! 8l.4 Xl.po xl. l.l. l. l. l. m. (m. Hm.hm.po m.Xo m.u m.f m. n. (n.t Hn.`n.hn. n.  n.Nn.$n.] n.<n.`$n.}* n.n.$n. n.`n.@$Ho. Po.$`o.n.o.Kg o.^x o. o.\ p. (p.K8p.$@p. Hp.v Xp. $`p.w hp.xp. $p.w p.p.$p.} p.p.@$p.[ p.p.$p.ʛ p. p.$q.m q.>q.@$ q. (q.8q.$@q. Hq.`Xq.`$`q.- hq.`xq.$q.ٛ q.Pq.$q. q.q.`$q. q.q.$q.f q. jq.`$Hr.Pr.@$`r. p.r. r. r.Bc r. s.#8s. Xs.+ xs.4 s.D s.I s. t.'-t.f Ht.S ht.#t.{ t.P8 t.+ t.b u. u.C (u.@u.ش Hu.O{ `u. hu.u. u.* u.Ҵ u. u. u. v. v.q<Xv.{ v.(-v.7-v.$v.$w.$@w.$hw.$w.$w.$w.$x.p$0x.h$Xx.`$x.X$x.P$x.H$y.D$(y.@$Py.<$y.8$y.0$y.($z. $0z.$Xz.$z. $z.$z.$z.$({.$P{.$x{.${.${.${.$(|.$P|.$|.$|.$|.$}.$(}.$P}.$x}.$}.$}.$}.$ ~.$H~.$p~.$~.x$~.t$.h$0.`$X.P$.L$.H$.@$.8$(.4$P.0$x.($. $Ȁ.$.$.$@. $h.$.$.$.$.$0.$X.$.$.$Ђ.$.$ .$H.$p.$.$Ѓ.x$.p$(.h$P.`$x.P$.H$Є.@$.8$(.0$P. $x.$.$ȅ.$.$0.$X.$.$.$؆.$.$(.$P.$x.$.$Ї.$.$ .$H.$.`$.P$؈.H$.@$(.8$P.0$x.($.$$ȉ. $.$0.$X.$.$.$؊.$.$(.$P.$x.$.$Ћ.$.$0.$h.$.$Ȍ.$.x$(.p$P.h$.`$.X$.P$.L$8.H$h. $.$.$.$.$0.$h.$.$.$.$.$H.$p.$.$А.$.$ .$H.$.$.$ؑ.$.$(.$h.x$.p$Ȓ.h$.`$.X$@.T$h.P$.L$ȓ.H$.@$.<$@.8$h.0$.($.$$. $.$H.$p.$.$.$.$(.$P.$x.$.$Ȗ.$.$.$@.$h.$.$ȗ.$.$.$@.$h.$.$.$.$.$0.$X.t$.p$.h$.`$.\$8.X$`.T$.P$.H$ؚ.@$.8$(.0$P.,$x.($.$$Л. $.$ .$H.$p. $.$.$.$.$8.$`.$.$.$؝.$.$(.$P.$x.$.$О.$.|$0.x$X.p$.l$.h$.d$.`$8.X$h.T$.P$.H$.@$.8$H.0$p.($. $С.$.$(.$P.$x.$.$Ȣ.$.$.$@.$h.$.$.$.$.$0.$X.$.$.$Ф.$.$(.$P.$.$.$إ.x$.p$(.l$h.h$.d$Ȧ.`$.X$.T$H.P$p.L$.H$Ч.D$.0$0.($h.$$. $Ȩ.$.$.$H.$p.$.$Щ.$.$(.$P.$x.$.$Ȫ.$.$0.p$X.`$.X$.P$Ы.@$. $0.$h.$.$.$.$.$0.$h.$.$ȭ.$.$.$@.$h.$.$.$.p$.d$0.X$X.T$.H$.@$Я.8$.4$ .($H. $p.$.$.$.$.$8.$`.$.$.$ر.$.$(.$P.|$x.p$.h$Ȳ.X$.T$(.P$P.H$x.@$.<$ȳ.0$. $.$@.$h.$.$.$.$.$0.$X.$.$.$е.p$.h$ .P$H.8$p.0$. $.$.$.$8.$`.$.$.$ط.$.$(.h$P.P$x.L$.@$ȸ.0$. $.$@.$h.$.$.$.$.$0.$h.$.$.$.$.$0.$X.$.x$.p$л.h$.d$ .`$H.\$.X$.T$ؼ.P$.L$0.@$X.<$.8$.0$.,$.($8. $`.$.$.$ؾ. $.$0.$X.$.$.$.$.$8.$`.x h.x p. x x.*x .:x .Hx .^ .f .> .t .s .4 .d (.! H. h.B .N . .$.`.." .. (. H." `.ش h.>| x.$. . .@$.Ҵ .X .$. . .$.a . .@$. .e @.- H.<.{ . .ش (.G8.$@.C H.IX.$`. h.x.$. .A. .k . . @.2 H./ h.% .6H .ޠ . . .. .<.. . .(.p0.\ 8.h @.PP.X. `.' h.x.0. .@ .r..X .d ..8.\.\..t .t .{(.+v H.!v h.w . .! . . . (.+ H.{ h.{ .M .Q .h .| ..$ .| (.8.$`.| h.x.$. .`.`%.h ..%. .5.%.A .@h.% . (.g8.@%@.=T H.`zX.%`. h.x.`%.f .d.%.; .P.%. .`m.`%. .0. %.E .@.% . (.d8.%@.: H.P7X. %`. h.x. %.n .. %.) .. %. ..%. .u.%. .P.% .W (.38.@%@.A H.X.%`.$ h.1x.%.o .́.%. ..`%./ .Pg. %. .0Q. %.7 .pl.$ . (.08.$@. H.X.`$`. h.px. $.Z] .0I.`$. ..$. .k.$.Q ..$. .w.$ .@ (.[8.@$@. H.9X.@$`. h.@x.$.v* ..$. ..`$.v ..$(. 0.%@..x. . . .J-. (.: H.`. h. p. x. .L . K-. .I .p (.= H. h..Xo . ./ .K-.Q . (.po @. H.J-.J-. .M . .| . h. . .! .L .! 8.RX.4 x.. .a . .8 . .< 8.L X.C x.I .Q .9M .} .F .. 8.` X.i x. .] .m .{ .$ . ~ 8. X.E x.. . . .c= .M 8. X. x.# . . .Ҵ . . 8.3 X. x.!.\ .4x . . . 8.Ϣ X.Ƣ x.̢ .آ . .] . . 8. X. x. .N ." .B .~.{ .m . . ." .4x .B (. 0. 8. @." H.N P. `. h.] p. x.آ .̢ .Ƣ .Ϣ .] . .3 .B . . . . . .i .` .4x .9M .. .F .} 0. 8. @. H. P.$ X. `.4x h. p.4x x. ~ . .4x .E . .4x .. .4x . . .c= .] . .\ . .M (.4x 0.4x 8.4x @. H.# P. X.4x `.# p. x.# . .# . .Ҵ . . .3 . .] .3 . . .\ . .!. .4x . (. @.B H. P. X. `.4x h.Rp.R.! .R.L .R. .4 .3 .a . .. .8 . . .3 . . .3 . 0. 8.3 @. P. X.3 `. . . .3 . . . . .3 . . . .N .4x .< . (. 0.4x @.L H.4x P. X.L `.4x . .C . .3 .Q . .] .3 .Q .I . . .] .3 .Q .I (. @.B H. P. X. `.3 p. x.I .3 .3 .3 .! .~.B ." . (. H. h.$ .M . .t ..%.@l . .@%.9 .h.kc p.%...^ .K-.t .ʰ (.J 0.! 8.B @.! H.~ P.x X. x.p.q .߅ . ./ . 8.{ X.! x. . ..{ .{ . 8.yX.x..£ .ϣ .U[ @.H.\P.w `.. .mG .#H .Mr .EJ .J .K . .L .s . [ .!M .M .;N (.N 0.O 8.]P @. P.X X.Q `.Q h.q p.S x.T .U .cV .W .W .X .H .I .R .5S .;Y .Y .UZ .ϣ .{ .b (. 8.`. F h.x.&.\ .@.&.֤ ..&. ..&. .s.&. ..`& . (.28.&@.N H.X. &`.3A h.3x.&.1' .@.&. ..&.01 ..&.B .Ј.`&.^ .@.@& ._A (.@'8.&@.. H.X. &`.u8 h.x.`&./1 .p.`&.eA .4.@&.lA .*.&.T . .&.B .. & . (. 8.@&@.v8 H.PhX.&`.+ h.p5x.&.ot .p.@&.F .l.&.2 .О.&.v ..&.4 .M.& .< (.p8.&@.D H.PX. &`.L h.09x. &.T .].@&.\ .6.`&.f .M.&.n .7.&.x ..& . (.8.&@. H. X.&`. h.`8x.@&. .:.&.) .C.&. ..@&.yG .b.&.0 .p .`& .t (.E 8.&@. H..L.@..} ..&.| .`.&. t ..&@. H..X.`.ܤ h.`0x.. . .@. .> (.= 0.p H.K-P. .PL-. F .0L-.֤ .L-. H.L-P. . .D . .@.{ H. DP.0(h.( p.psx.2.tR .p .`." .3.P. . ..M .`0.# 8. @.-X.P `. ,.c .q .~ 8. `. . . . .P. & .X# (.8.&@. H.`X.0`. h.Wx.`&. .8.&. .pd.&.t . .@&.% ..*y . `.rA h.x.&.| ..&.* ..@&.ѥ ..&.yG .`U.`&.t .`. & . (. 8.&`. . . .. .. .M (.p0.8.. ..G ..M .p... ..G .h. .( .( .$ . .| (.. H.< h. .G .Y .f .n . (.z H. h. . . . . / (/Ŧ H/Φ h/צ / / / / / (/ H/ h/( /0 /> /K /S / (/# H/F h/d /m /u /T /3p / (/ H/ h/ / / / / / (/ǧ H/ӧ h/ۧ / / /f / / (/ H/ h/& /2 /: /C /K /T (/[ H/c h/p /~ / / / / (/ @/ X/è p/ʨ /Ѩ /ب /n /ߨ / / 8/ X/ x/ /# /: / /s  /ѥ @ /yH /0X /P / /è / /*  /8 ( / H /tR h /M /{ / /" /%  /y /S @ /2 X / x /2 /# /2 /F /2 /  / / /8 / H /'P /`+X /p /T /T /̚ /  /K /X / /h /S /d / e / / ( /d8 /2 P /# ` /ch /ep / /F /c /p\ /( / / /  /h / // /0/è @/H/P/h/ʨ x//P//Ѩ // /(/ب // /X/ߨ /$(/0/H/d X/`/h// /PV///m /a/D /H/u /a/=E /(/3p 8/@/3H/`/yp/P/H/ //F /2 / /^/// /]^ /(/@/ P/]X/`/`x/ //`// //0:// /Н/`/ / 0/Н8/0:@/@X/ h/p/`x/x/ //0://ӧ /@/`//ۧ /@/0: /8/ H/9P/`X/Hp/ /9/0://f /L/// /L/~ // (/`/0/8/@ P/ `/ph/p/\ / /p //X/ /0/F /x/ ///0/ @/E_H/`P/h/ x/E_/0:// /r`/`/0/& /r`/0:/h/2 /f(/`0/H/: X/f`/0:h//C /@ /`//K /@ /0:/8/T /S/`/p(/[ 8/S@/0:H/`/ p/x/// /p///Ŧ // e//Φ /`  / e(/P@/צ P/X/ e`/x/ /p/ e// / /// /@/ e/0 / 0/P8/ e@/hX/ h/ p/ ex// // e//( /0 / e//c //` /H8/p H/P/0:X/p/~ //`// //0://0 // e/(/> (/0/ e8/`P/ `/ph/p// //`//ǧ //0:/H/ // e/0/ @/mH/P+P/h/n x/p/ e// /a/b//z /a/;/X/ /m(/P+0/H/ `/ eh// /0/x/ /0//n // u /(/ 8/-b@/*t H/`/z p/-bx/t /X/ /@/ 2//Ŧ / e//צ /0(// /0/p&/^ /'/&/1' //& / /! /( /G0 /8 /$X / /} /I /@& /| /` /& / t / /&!/ !/| (!/h!/L-p!/=!/ !/ !/ !/ "/| "/@"/ h"/@$ "/} "/ʩ "/S "/ &#/| #/^ #/&@#/} H#/X#/&`#/| h#/Px#/&#/Q #/#/&#/ #/#/`&#/ #/#/&$/a $/ H$/& $/ҩ ($/@8$/&@$/$ H$/ X$/&`$/9 h$/x$/&$/ک $/$/&$/ $/p$/&$/ $/`$/`&$/ $/$/ &%/ %/N%/& %/Q (%/`8%/ &@%/| H%/X%/&`%/: h%/^x%/&%/t %/ %/`&%/ %/ %/&%// %/@%/@&%/K %/,%/&&/&/0&/&H&/p&/4&/@ &/ ;&/'/'/p '/0`'/ h'/x'/&'/a '/'/&'/$ '/ '/&'/ک '/'/&'/ '/`'/`&(/ (/(/ & (/ ((/N8(/&@(/| H(/X(/&`(/t h(/ x(/`&(/ (/ (/&(/K (/,(/&(/[)/H)/p)/4)/@ )/ ;`*/*/x*/ */M */{0*/ */@$ +/} `+/y h+/ x+/0&+/| +/+/1' +/ +/&+/^ +/= +/`&,/,/0n ,/8,/X,/P,/h -/} -/0J-/&-/| -/-/`&-/ t -/-/ & ./} (./7 8./&@./| H./N>X./`&`./ t h./x x./ &./ ./ ./t ././@&//ƅ // //&@//H//˚ x// //0/@//0/80/ 0/ H0/./0/1/P1/@" 1/1/(1/1/01/ 1/81/ 1/@1/01/H1/01/P1/@1/X1/@1/`1/P1/h1/P1/p1/`1/x1/`1/1/p1/1/p1/1/1/1/1/1/1/1/1/1/1/1/1/1/1/1/1/1/1/1/1/1/1/1/1/1/1/1/1/2/1/2/1/2/2/2/2/ 2/2/(2/2/02/ 2/82/ 2/@2/02/H2/02/P2/@2/X2/@2/`2/P2/h2/P2/p2/`2/x2/`2/2/p2/2/p2/2/2/2/2/2/2/2/2/2/2/2/2/2/2/2/2/2/2/2/2/2/2/2/2/2/2/2/2/3/2/3/2/3/3/3/3/(3/003/583/ {@3/#h3/0p3/5x3/ {3/#3/p3/ O3/3/3/03/53/ {3/#4/04/5 4/ {(4/#H4/pP4/ OX4/`4/4/ܗ 5/| 5/5/ 6/ (6/ϣ H6/ `6/M 6/| 6/_ 6/&7/M `7/ h7/dx7/h7/+ 7/{ 7/ 8/ (8/- H8/ h8/M 8/{ 8/# 8/L-8/! 9/+ (9/! H9/b h9/# 9/{ 9/# 9/W9/{ 9/9/( 9/W:/ :/@:/P H:/P:/" ;/| ;/H;/ h;/( ;/ ;/P;/&;/ ;/ ;/ &;/} ;/;/&;/& /o >/0>/& >/v (>/@ 8>/ &@>/{ H>/`X>/&`>/!v h>/0S>/+v >/W>/>/0$>/>/>/PS?/?/P?/ch?/M-p?/A ?/> ?/) ?/4 ?/0 ?/p?/@&@/t @/@/&& @/| (@/p8@/&@@// H@/0X@/@&`@/Q h@/x@/&@/ @/@/&@/Ҵ @/и@/&@/ @/@@/&@/ @/P @/&A/A/@A/& A/ (A/P8A/&@A/a HA/XA/@&`A/y hA/pxA/&A/ A/pA/`&A/A/| A/A/' B/y (B/`B/y hB/B/y B/B/`M-B// (C/ HC/M hC/ C/ C/ C/Ҵ C/M-C/0 D/ (D// HD/PM-PD/ D/0M-D/ D/ D/bD/`'D/n D/0%D/0'E/t E/PE/' E/ش (E/K8E/'@E// HE/P4XE/'`E/Q hE/.xE/ 'E/ E/0E/`'E/Ҵ E/VE/ 'E/ E/0E/'E/ E/WE/'F/F/pF/' F/0 (F/V8F/'@F/ HF/2XF/'`F/a hF/xF/'F/y F/ F/@'F/F/0%F/F/} F/ F/'G/| G/RG/@'@G/ HG/ XG/@ '`G/y hG/o xG/'G/pTG/7H/ H/ H/@ ' H/y (H/O 8H/ '`H/pTH/H/y H// H/ 'I/pTXI/Ҵ xI/9 I/ I/I// I/ J/ PJ/&J/ J/0J/J/ J/Y J/J/ J/0J/J/ K/ K/(`K/ hK/0xK/`K/ K/K/'K// K/IK/'K/ K/`K/ 'K/ K/K/ 'L/Ȭ L/0L/ L/Ҭ (L/08L/@L/ܬ HL/0XL/`L/: hL/xL/L/ L/L/p 'L/yG L/\L/@ 'L/t L/P L/ 'M/pJM/0fM/M/t M/7(M/0M/=8M/@M/ 7HM/+PM/ XM/@`M/04hM/pM/xM/M/M/M/ kM/N/ N/ (N/ 0N/ 8N/h@N/ HN/PN/0 XN/N/R N/'N/ N/N/M-N/ N/M-N// (O/M-0O/ hO/A O/XO/n O/PpO/_ O/y O/XO/'O/t O/ O/@'P/ P/jP/' P/a (P/R 8P/'@P/O HP/@1XP/`'`P/O^ hP/0xP/ 'P/_v P/P/'P/Q P/P/ 'P/: P/PP/'P/^ P/RP/'Q/1' Q/@Q/' Q/ (Q/8Q/`'@Q/HQ/ XQ/'Q/LQ/PpQ/0Q/LQ/VQ/pQ/qQ/PQ/Q/pdQ/, R/} R/5R/@' R/| (R/ 8R/'@R/ t HR/`XR/'R/} R/@TR/@'R/| R/=R/'R/ t R/n R/'S/j(S/ HS/N-PS/S/} S/bS/'S/| S/=S/'S/ t S/fn S/'T/| T/t=T/'HT/ hT/ U/G U/G U/$ U/ U/í U/# V/ϭ 8V/" V/ۭ W/ۭ hW/ N-pW/' W/ W/ W/ W/D W/NW/ W/E X/Z0 @X/ hX/ X/ X/' X/1 Y/9 0Y/G Y/ Y/sY/`%'Y/t Y/m Y/ %'Y/I Z/ Z/Z/W Z/0 Z/_ (Z/x0Z/ 8Z/@Z/j HZ/PZ/r XZ/@`Z/ hZ/} pZ/ xZ/Z/ Z/Z/ Z/Z/ Z/ Z/ Z/iZ/Z/ Z/i[/@[/ H[/ CX[/.'`[/Ȭ h[/x[/.'[/: [/:[/-'[/ [/[/`,'[/A [/` [/+'[/A [/`[/*'\/ɮ \/`_\/*' \/ (\/8\/P*'@\/A; H\/ X\/('`\/] h\/c x\/&'\/yG \/I\/&'\/@8\/J\/P\/\/<\/B\/\/i]/6]/`u@]/@ P]/i]/;]/A]/Ԯ ]/%']/Z/^/u ^/0A^/u (^/= 0^/A@^/ P^/u X^//= h^/u ^/̯ ^/^/2 ^/ ^/^/2 ^/ ^/Y^/2 _/ _/( _/2 _/Kg (_/B;8_/2 h_/_/ _/Kg _/c _/`/{ `/ `/@`/ (`/( 0`/08`/@`/P`/ X`/h`/(`/) `/2 `/= @a/{ Ha/ Pa/@Xa/E ha/( pa/0xa/a/Xa/[ a/Ba/xa/d b/m 0b/x Xb/ b/ b/ b/Eeb/0'c/9 c/fc/ 0' c/̯ (c/ae8c//'`c/{ hc/ pc/@xc/ c/( c/0c/c/c/ c/Bc/xd/ (d/ Pd/ï d/ d/jd/1'd/8 d/$d/@1'd/˯ d/Nd/1' e/ (e/d8e/2'@e/9 He/KfXe/2'`e/̯ he/ xe/1'e/ e/fe/2'e/9 e/jee/2'e/̯ e/ e/1'(f/9 Hf/̯ `f/ f/| f/f/ t f/g/ g/tg/2'@g/4x `g/ g/v0 g/ h/4 h/ (h/ Hh/ Ph/ٰ ph/Ұ h/| h/[h/ ^ h/C h/Ys @i/{ `i/ް hi/ i/ i/! i/ i/ i/ j/| (j/ `j/4 j/* j/! j/ j/B j/8 j/ j/I k/d k/Z (k/s Hk/i k/= k/ k/> k/ k/ k/ k/ű l/ l/ӱ @l/ɱ pl/l/l/!l/h0m/ڱ 8m/P@@m/hm//m/g n/@n/Xn/pn/hn/ n/P@o/h@o//ho/go/p/p/0p/hp/ p/P@p/hq//(q/gq/q/q/q/hpr/ xr/P@r/hr//r/g`s/s/s/s/h0t/8t/P@@t/ht//t/g u/@u/Xu/pu/hu/(u/P@v/h@v//hv/gv/w/w/0w/hw/- w/P@w/hx//(x/gx/x/x/x/hpy/= xy/P@y/hy//y/g`z/z/z/z/h0{/R 8{/P@@{/h{//{/g |/@|/X|/zp|/h|/d |/P@}/h@}//h}/g}/~/~/c0~/h~/x ~/P@~/h//(/g///Q/hp/ x/P@/h///g`///A/h0/ 8/P@@/h///g8/1P/hЃ/ ؃/P@/h //H/g///!/h/ɲ /P@/h///g///І/`P/PX/`/@`/ /ȇ/؇/_@/`/x//`// /@``/ ///_/ /8/P/`Њ/؊//@` / /H/X/_////`/`//@`/ ///_///Ѝ/`P/X/`/@`/ /Ȏ/؎/_@/`/x//`// /@``/ ///_/ /8/P/`Б/8ؑ//@` / /H/X/_////`/h//@`/ ///_///Д/`P/X/`/@`/ /ȕ/ؕ/_@/`/x//`// /@``/ ///_/ /8/P/`И/ ؘ//@` //H/X/_////`/۲ //@`////_/~/@0/ 8/@/@`//// /@/X/op/`/H//@`@//h/x/_///c0/`/x//@`//(/8/_//ؠ/Q/`p/(x//@`////_`///C/`0/h8/@/@`////_ /@/X/0p/`///@`@//h/x/_/// 0/`///@`//(/8/_//ا//`p/ x//@`////_x//<// /p / =P/k/`/`//tv /_/0/</pz/% /p/ =/k//`/(/;8/_/Ь/<(/Ї P/= X/p`/ =/k//`/ȭ/ح/_@/`/x//`/U / /@``////_/0/`///@`//(/8/_//ر//`H/Ip/l x//@`/ //x//`/ / /@``/ ///_/ /8/P/`е/ ص//@` //H/X/_//////0</0//////и/P/ X/0<`/0/@/ȹ/X/p/Ⱥ//Գ /0</00/`j/@//h//t/`/ //@`////_///bн/`P/8X/`/@`/`/Ⱦ/ؾ/_@/`/x/X/`/ / /@``////_/ /8/DP/`/h//@` //H/X/_///5/`/ //@`////_///(/`P/, X/`/@`////_@/`/x//`/H / /@``////_/0/h/`[//P@/h/ j//@i//h///(/g8/`d//// np/a x/G/pn///0m`///! / n/b0/8/G@/pnh/h/p/h////0m /@/X/p/`/s //@`@/0h/x/_///0/h//A/Ph/g//0(/////`p/ x//@`/0//_`////0/@8/@/p/@g////0 /@/X/p/`/p//@`@//h/x/_//`/ //@`////_////`P/X/`/@`/0//_@/0H/`/P//X//`/@/h/`/p/ x/ٰ /// //////ٰ / /////| /d^ / 5'@/} H/9X/`5'`/| h/^ x/ 5'/ t /n /4'/y /PN-/F /# (/H/( P/ p/P x/J/# /< /( / @/# H/= h/( p/ /# //( / /P /G `/ /{ /| /` / (/Q H/{ P/p/( x/Y /# /( /P /l / /| //ش /8//Ҵ /@</ / / /8 / (/p 8/`@/a H/X//@+// b/ /``/״ / /ܴ /# @/ H/ X/6'`/ h/x/@6'/ /P/6'/pN-/> /( (/N-0/ah/# /ش /Ҵ / / /a (/ H/ `/ // // /U /`:'/ /0* /yG (/!8/:'`/h/ap/0 x// / /@b/P /`h///qH/ P//N-/>/Z /f /r 0/ X/ / / / / /ʵ H/ӵ p/ߵ / / / / 8/ /t / /\ /(/;'/N-/\ @/# H/s/ۭ // / /| (/0`/# h/w /ۭ //( 8/ X/{ / /"A /ϧ ///@///p/`8/Фx/@J/} /K/`Z'/| /pJ/ Z'/ t /J/Y'/ϣ / (/= 0/p H/pO-P/ot /O-/֤ /O-/ /O-/ H/P-P/ /ϣ / /P-/C /O-/A @/7H/7P/LX/p`/`/*/} / '/y'/| /p2/y'/ t /2/@y' / (/= 0/p H/0P-P/ot /`P-/֤ /P-/ /PP-/ H/P-P/ / /M /P-/C /P-/A / //h/ /Ҵ / / / / (/Ȭ H/yG h/} /% /tR /c //9t /"/ -/-/f /`/LP/@"X/O`///-/-/-/P0X/t p/P/@"(/ -8/-h//t /@"/@-/t /p/$L0/ "8/O@/ `/Pkh/-p/-x/`-/@80u P0"?0"0С 0f 0-0-H0Q!0u 0p0$Lp0"x0O0 0-0@-0-0Bx0,u 0p0$L0@"0O 0 @0PkH0@-P0-X0 -00pu 000 "0;0 0 0-0-(0@800u 00KP0"X0O`0Ϫ 0-0@-0-0@}0}@0M h0u p0@08g 0 0@"0 0 0" 0 o  0  0`" 0 ( 08 0"@ 0̯ H 0pX 0`"` 0 h 0?x 0" 0+ 0pE 0 " 02 0`? 0" 0u 0u 0v 0v @ 0 H 0aX 0"` 0 h 0@ x 0" 0!v 0Ј 0+v 0 0c 0sD 0`" 08 0P 0`" 0[u  0l 0"X 04v p 0@R 0" 0 R 0  0  0R( 008 0@0 0  0@v 0p" 0@-0x 0\0[/ h0-080x P0*x0,/ 0-03} 00p0`]#x00`0-0x0D} 0o0Z#0@0H0-0@m0V} 00Po0R#0`0j0`-80g0m} 0pP0^#X000`-0X0} p00`0`U#0 3 0P(0-x0P-0} 00S#0A0P0@-0 0000Q#80Ч`0h0-080} P00P#0 0`0`-X000} 0 p0`S#x00P0-00x 0} 0@!0X#!0@!0`H!0`-!0з"0~ 0"0"0V#"0"0"0-8#00 #0!~ #0P$0@N#X$0 $0@$0-$0`X%01~ p%0%0 L#%0 &0P(&0@-x&0&0C~ '0 '0N#'0`'0'0-(0(0W~ (00)0O#8)0P`)0@h)0`-)0`8*0k~ P*0*0 P#*0@+0P+0 -X+0P+0}~ +0p,0T#x,0,0,0-,0@x-0~ -0.00@.0H.0-.0P/0~ 0/0 /0M#/0p/0 /0-80000~ 00 9P10N#X10`10@91010 -100X20; p20x30 30 408400 40r#4040# 40 -40-5050 50860K `60>h60-60870 P70Px70 70@-70-70p#707070 70`80`-80-H80`X808080x90K 90a 90-90x:0H :00:0:0@;0#;0H;0-;0<0\ 0<0X<0<0`<0#<0R<0-8=0@O=0p =0=0 >0P>0`#X>0 >0 ->0P@?0M ?0M @0߀ 0@0P,X@0@0@*@0#@0&@0@.@0.@0@?08A0'A0 A00XC0. pC0 gC0fC0AD0BD0`f0D0.D0 E0`7E0`4E0`#.hF07F0_ F0{ F0 F0V F0e F0~^ F0 F0> G0 G0 G0)} 0G0| @G0E| PG0{ `G0 pG0Is G0W` G0 G0[ G0r G0sr G0Cr G0 G0H0 H0 H0 0H0"/ @H0kc PH0 H0Rx H00I0i$8I0f@I0P]hI0\.pI0`[.xI0[.I08J0E PJ0xJ0XkK0h.K0n L0 IHL0 v.PL0v.L0rL0PIL0} L0@ L0 u.M0,M0 M0 M0u.8N0 @N0 `N0C 8O0 PO0 O0u.O0 O0 P0C P0Ҵ P0 0Q0u.xQ0 Q0 Q0C xR0s R0M S0s T0 0T0 T0 U0 U0IXV0 rXW0Ƞ W0S= X0Lj Y0@q8Y0Y0 Y0pqY0.Z0] Z0 J Z0+ Z0gZ0po8[0ܛ @[06 h[0 .p[0.[0u 8\0֠ P\0T\0`.\0@.\0`r\0U\0~ \0a ]0`.X]0O]0 ]0`p^0 $x^0g^0^0 .^0`x_0_0v`0 $`02@`0H`0`.`0ta0P0a0pea0@$a0ga0ra0.8b0db0M c00 0c0c0c00Bc0.c0b0(d0d0٣ d0`d0. e0.e0`.e0@. e0v (e00e0@8e0Xe0Y`e0, he0 xe0( e0p Xf0 pf0`f0. f0.f0`.f0@.f0f0@f0f0Yg0, g0 g0( g0p (g0.g0] h0p*8h0X Xh0 `h0h0Yh0, h0PDh0.i0i0i0Li0i0@i0 j0@0j0/j0@B1k0% k02`l00hl0 B18m07 Pm0~m0n0}n0.n0r n0!o0p o0.(o0i00o0.8o00Ho0P_po0&o0|o0`.o0xp0] p00p0p0ap0Wp0q0`&q0 q0 Hq0.Pq0.Xq0@.q0q0bq0PTr0 0r0Xr0. r0pr0&r0Ԛ r0`.s0(s0`s0> s0s0p*(t00Pt0&ht0$t0`.t0.t0t0Xu0; pu0u0u0 /u0 /u0 u0&u0Pv0pv0P(v0/xv0rv0x w0`w0dw0гw0 /x0 x0 hy0"/y0F 8z0 ~ Pz0xz0. z0@&z00z0 {0"/{0@"/X{0{0Q |0W% 8|0G= }0b }0\8~0`~0p[h~0@#/80C P0x00@&/0(/0&0@d0@!0z0X0#/H0X0P؀0W00 0@)/(0(/80-p0&x0@d0@!0z0X0`'/0Ex0o 0^@0H0 ./0s 0o0-/0p* Ѕ0?0 0,/0 ,/0,/0x P0`&h0x0@<0`+/0*/؆02x0 0$ 0;= H05/0MF 0 00$ X0`04/80F ؊0Ҫ 00Pp0@&x000 B0Z 06/0`6/0wY0Px0! 0` 000&0p 00H0`7/P07/00 0 Џ0Й0`0 wX0Xh0Ч0;/0:/09/X0 p00_0?/0>/00>/0&0Q05 0P(0=/80;/x00 0`$0P0 0M 0 080P0A/0&0000ȕ0?/ؕ0000ӫ X0h0 B/80ޫ 0J0`B/ؙ0 0P0B/x0 0p0@0`H0A/h0qН0|؝0#0 0؞0@0I/80X0 Wh0H/80 P0$ؠ0@00F/ء0߫ 00@ 0`0(0`H/x0000H/x0ԫ 00@0`0ȣ0G/0(080VH0@G/0 00$0@0A0F/0* Ц0$X0@00F/X0< p0$0@ 0eC (0F/0V 0$0@0eC Ȫ0F/0o 0$80@`0eC h0F/80 P0Пx0000F/Э0'ح0`T00 0A0D/H0aX0`خ0 0 0M/80@Cp0'0@/0`K/0J/0x0< 0 80 vȰ0Q/а0Q/0'0] 0(080LH0O/0U0z 00pZ0` 00R/0 г0 TX00pM0R/X0 p000Pg 0 (0T/0y 0G0 0`ȷ0S/0 0eظ0T. 0T/0 0w. 00@'H00ğ 0 (0H000+H0JE P0 X00p0WE x0p0B 0! 00 0M 0{ 00P0( 0 0`0 h0a0M 0 0a0M x0s00"'0Y 0PP0W/X00p0T0`0200 0 '00Y0@0V/0`00&(00' п0 0J 0WP0'X0@`0p0U/0 00;0X0 p0 \010 00(0Y/00@X/80W/0080w@0\/X0p0@/'0`0@[/0Z/000 0@. h0^/x0^/0B 0 0 802'@09 H0#X02'`0̯ h0_x01'0 00'09 0#0 0'0̯ 0_0/'000 0l0( 80`0`ih0 0p0`/x0`/80Q P0lp0b/x0. 0000a/0@a/0ү 0K x0 Ax0 0l0 00+. 0q H0d/P0d/X0`c/0 00 P0@00 0>e0 e/0 0j P0X0] 0Re0b/X0( p0 0`00 0*i(0e/0M 0] 0 0J00? 80@0 X0M `00]h0OA p0Y 0k 00A 0u 00`80- h0000@`0f/0`f/0000_0F0003'80`0`h0/0P80jP005'00P0@/X0` 0 00- @0kx0R0/0`/0/0p@x0 00- 0RP0`/X0@/p0зx00 00X0- 0R0/0`/0/00P0' 00- 0bX0R0/0`/0 /0YX0, p00- 0R(0/00`/80 /P00> 080,H0/P0/h0@0030#} 0@0/0/0a0006'80P@0p2h0@/p0`/x0/000p80K P0@Ax0>0 00a00 0/0 /0 /0>0 0`/80p0:'00/0`/0pcx0v0 0 03- 00@='(0H0/P0/00 00 +X0 x0b: 00H0@>'0c0w 0 /0/0@/0 80b0 _ 0@B0 0m 000 P0>'X0@h0w 0/0`/0 0 X0g p00- 0>'00`0s~ 80/x02 0& 0u80, 0?'0 0C0 0p:03A 0:0`W'01' 000C 00`U' 0v (0@0 H0<X0T'`001 h0@0A 0 D0S'0A 0 0R'0^ 0>0 0>0x 0> 04 (0>@0f H0?`0< h0?0T 0 ?0L 00?0D 0@?0 0|0Q'0_A 0P?0`P' 0. (0@@0u8 H0@BX0O'`00 h0Sx0N'0B 0 K0M'0\ 0F0K'0/1 00eA 0@0lA 0@0 K' 0B (0pL80`I'@0 H0X0G'`0T h0x0F'0֤ 00@E'0 00`D'02 0Б0v8 00C'0+ 0ج 0N (0B@0ot H0жX0@B'`0F h0 0 0B0A'00 0Rx0I0m0/x0U 000`/0/0/00g000/0X'(080QH000)0? 00v' 0| (0 80y'@0rA H0X0`v'`0t h0&x0v'0O 00u'0 003A 0`0t'0 0"0t'0a 0%0`t' 01' (0@0C H0%X0@r'`0v h0'0 00 0q'0_v 0P0p'001 0 0A 00o'0A 00)0m' 0^ (0` @0O^ H00X0 m'`0 h0 0x 0P 04 0 0f 0P 0< 0 0T 0P 0L (0@0D H0`0 h00x0@l'0_A 00k'0. 0P0u8 00k'00 00R0i'0B 0060 h' 0Q (0P'80 g'@0: H08X0f'`0\ h0`x0`e'0 0`90e'0/1 00eA 00lA 00`d'0B 070b' 0 (080`'@0T H0X0_'`0֤ h0x0@^'0 0P0`]'02 0(0v8 00\'0+ 0l 0N 0p 0ot (0^80@['@0F H0``0 h00x0Z'0L00:0qi000010I 00R0(00/1LB 1`11/101P/(1p@1@/P1 w'h1@x1@R1011-1+1@/01 '13S-F S-m8S- S-kS-S-}`-0h-p-x---u---5-p-'-e-Ȇ-`І-6؆--// 0-K--H1h1-]-J-- -(-t0-T8-@-H-P-X-"`-Oh-p-Zx----[------ȇ-#Ї-؇-3-----h--)-i -(-0-8-000@000 00`0 0!0@#0$0&0 (0)0`+0-0.0@0010 50`80@A0S0@U0V0 Z0[0_0`0@b0@d0 i0q0@s0v0`0000`000@00`00@-H-dP-mX-`-Ih-p-Qx-=-Q-{- -O-V--w--Ȉ-0Ј-؈-l-a--{0-----8 -(-0-}8-@-H-P-kX-`-h-p-x-@-0-X-l--r-o0`0---ȉ-Љ-o؉-#--~@0~c0~8t0~X0~0~0~x0~0~80~--$0$-|--k- -,(-0-8-4@-H-P-X-`-zh-_p-x-Y----+----{-bȊ-rЊ-؊-o-( ---A- -b- - -(-0-8->@-H-P-X-E`-Wh-p-Vx- -----x-"---0ȋ-Ћ-؋---r- --<00<P0<0<0<00<0<p0<0<0<P0< 0<"0<0$0<%0<p'0<)0<*0<P,0<-0</0<p40<60<70<P90<:0<<0<0>0<@0<C0<I0<J0<pL0<N0<O0<PQ0<R0<T0<0V0<W0<pY0<[0<\0<P^0<_0<a0<c0<pj0<l0<m0<Po0<0t0<u0<pw0<y0<z0<~0<0<P0<0<0<00<P0<00<Б0<p0<0<0<0<P0<0<0<00<0<P0<0<0<00<е0<p0<0<p0<0<0<0<P0<0<0<00<0<p0<0<0<P0<0<0<00<0<p0<0<0<P0<0<0<P0<0<0<01<--- -(-0-8-@-0(0A0HC0H0(J0K0hR0T0U0HW0X0Z0(\0]0h_0a0c0d0Hf0g0i0k0(m0n0hp0r0s0Hu0v0x0(z0{0}0(0Ȁ0h000h00Ȋ0h000H0000(0ș0h00(0ȡ0h000H000(0Ȯ0h000H000h000H0000(00h000H00(00h000H000(00h000H000h0011H-xP-X-7 `-7h-p-x-A --]-u------Ȍ-wЌ-،--l-o-----X-\70\XL0\R0\xT0\V0\XY0\\0\z0\0\0\ذ0\ -(-?1?0-:8-@-H-P-2X-`-h-p-x- ----X----0 -ȍ-Ѝ-o؍--t-----w-- -s(-0-p0t000000018-@-H-EP-X-z`-h-p-x---'---)----OȎ-Ў-؎---- -----N -(-0-8-@-H-P-DX-E`-fh-p-x-00p3050P80^0`00b00d0i00s0t0P00000P0000000P0001- 0--e--p---~-Iȏ-_Џ-؏--/x//X000x 08d08s000080010f0f80f0fx0f0f0fX0f0f0f8!0f"0fx$0f&0f'0fX)0f*0f,0f8.0fx10fX60f90fE0fXN0fO0fQ0f^0f8`0fa0fj0fXl0fm0fw0fX~0f80f؄0f80f0fإ0fx0f0f0fX0fز0fx0f0f0f(0f@0f`0fX0f0fx0f0fX0f0f0f0fH0H?0?0b00Ⱥ0000 0 0 0( 0%P?0?0b00к0000F0F0F0F0/F0PF0F0F0G0G0(G0n8G0HG0XG0hG0CxG0KG05G0G0G08G0BG0G0G0xH0z8H0 HH0XH0<K0K0i05i0o0;t0@0 0980ȝ0(0<0<0000s0^0^08080x0x000800x00 0 800X00x0 0 000800.X0.8000:0:00000s0s800x0?X0?0 V-V- V-(V-0V-8V-@V-HV-uPV-XV-`V-hV-xpV-xV-V-$V-+ V-V-6V-V-V-V-rV-V-^V-V-cV-V-V-V-mW-"W-W-W- W-(W-0W-8W-^@W-HW-6PW-XW- `W-hW-BpW- xW-W- W-W-W-W-W-W-9W-yW-W- W- W-W-W-W-W-&X-X-X-X- X-? (X-0X-8X-S@X-HX-PX-XX-`X- hX-pX-& xX-X-X-X-1X-X-X-,X-X-9X-X-+X-X-X-X-4X- X-tY-Y-IY-7Y- Y-g(Y-0Y-8Y-@Y-@HY-PY-XY-`Y-hY-pY-xY-Y-Y-Y-Y-Y--Y-=Y-Y-UY-VY-Y-Y-Y- Y-JY-=Y-QZ-Z-Z-$ Z-Q Z-(Z- 0Z-8Z-!@Z-,HZ-PZ-XZ-#`Z-hZ-pZ-xZ-Z-Z-Z-fZ-Z-$Z-%Z-Z-(Z-&Z-'Z-Z-RZ-MZ-Z-(Z-)[-m[-([-*[-? [-+([-0[-8[-l@[-PH[-%P[-X[-D`[-,h[-vp[-x[-[-[-[-{[-h[--[-[-[-_[-.[-[-O[-/[-0[-1[-2[-\-\-\-\-\ \-(\-0\-8\-a@\-H\-UP\-X\-`\-/h\- p\-x\-, \-\-\-\-4\-\-\-5\-g\-\-6\-7\-8\-\-> \-g\-8]-]-]-9]-D ]-(]-0]-8]-,@]-H]-:P]-sX]-`]-h]-;p]- x]-]-<]-]-]-]-]-]-]-]-U]-]-G]-]-V]-]-]-6 ^-^-^-^-= ^-(^-a0^->8^-q@^-?H^-P^-@X^-A`^-kh^-p^-x^- ^- ^-^-^-B^-C^-^-*^-^-^-^-^-^-^-^-^-_-<_-9_-i_- _-D(_-0_-E8_-k@_-RH_-*P_-@X_-P`_-~h_- p_-x_-_-_-F_-G_-_-_-_-_-H_-_-I_-_-_-U_-_-J_-K`-`-L`-`-c `-(`-M0`-N8`-@`-H`-P`-)X`-N``- h`-- p`-x`-`-`-'`-G`-t`-O`-P`-d`-S`-Q`-`-R`-`-`-S`-T`-a-Pa-a-a- a-y(a-d0a-8a-X@a-Ha-Pa-Xa-`a-ha-pa-Uxa-a-Va-Wa-a-%a-Xa-Ya-.a-a-}a-%a-a-a-a-Za-7a-[b-;b-b-Xb- b-(b-0b-8b-@b-Hb-Pb-@ Xb-`b-hb-Wpb-xb-\b-]b-Pb-b-vb-/b-^b-b-b-_b-+b-`b-b-b-ab-!b-c- c-1c-%c- c-b(c-w0c-8c-@c-Hc-#Pc-Xc-`c-:hc-pc-3xc-. c-c-cc-c-c-dc-c-c-ec-c-Gc-{c-Vc-'c-fc-c-Fd-d-&d-d-g d-h(d-i0d-8d-@d-Hd-lPd-kXd-`d-hd-Mpd-xd-Rd-d-d-dd- d-qd-d-d-d-md-d-nd-d-Qd-d-od-e-e-e-e- e-(e-@0e-8e-@e-CHe-pPe-4Xe-`e-1 he-qpe-xe-e-ke-e-e-~e-re-\e-e-e-je-se-?e-te-ue-e-ve-f-f-nf-wf- f-(f-0f-x8f-@f-yHf-' Pf-Xf-`f-hf-pf-xf-f-<f-zf-*f-f-f-f-{f-f-f->f-]f-f-f-|f-%f-}g-jg-3g-2g-U g-(g-~0g-8g-@g-]Hg-Pg-Xg-`g-hg-Apg-xg-g-1g-0g-g-@g-g-g-g-Eg-g-g-g-g-Zg-g-g-h-h-h-h- h-(h-0h-8h-@h-iHh-Ph-Xh-`h-hh-ph-xh-h--h->h-h-h-nh-ih-h-xh-h-h-eh-&h-h-h-h-i-7i-i-i- i-(i-0i-8i-@i-YHi-Pi-+Xi-r`i-~hi-!pi-exi- i-i-i-i-i-yi-i-i-i-,i-i-i-i-i-i-i-j-j-j-j- j-:(j-0j-q8j-@j-Hj-Pj-^Xj-`j-hj-upj-xj-j-Zj-j-j-j-j-j-j-Fj-j-j-Jj-j-Lj-j-j-k-2k-hk-k- k-(k-0k-C8k-@k-Hk-Pk-Xk-5`k-hk-pk-xk- k-k-k-k-k-k-8k-k-gk-4k--k-k-k-k-k-0k-7l-Tl-l-7l- l-(l-0l-8l-A@l-Hl-Pl-tXl-`l-hl-pl-xl-l-l-l-l-l-l- l-l-|l-l-l-Sl-dl-l-ql-l-mm-m-m-m- m-(m-W0m-8m-@m-Hm- Pm- Xm-`m-hm-Gpm-xm-m- m-m-m-m-Qm-m-m-{m-m-m-m-m-m-m-m-n-n-n-n- n-(n-<0n-8n-@n-JHn-Pn-<Xn-`n-hn-gpn-xn-n-<n-n-n-n-n-n-)n-n-n-n-n-n-n-n-n-o-o-o-o- o-(o-0o-8o-@o-Ho-Po-Xo-~`o-ho-po-xo-o-_o-o-o-o-o-@o-Ao- o-o-o- o-o-o-;o-) o-p-9p-p-Jp- p-(p-j0p-[8p-@p-7 Hp-,Pp-Xp-n`p-Bhp-Opp-0xp-p-Ap-Hp-zp-p-zp-Sp-1p-=p-p-p-p-kp-p-p-p-q-q-q--q- q-(q-0q-8q-@q-Hq-(Pq-RXq-`q-Dhq-pq-xq-|q-q-q-lq-q-q-q-q-'q-q-q-5 q-3q-/q-q-Rq-r-Dr-Fr-'r- r-(r-0r-v8r-@r-Hr-Pr-Xr- `r-hr-pr-Lxr-r-r-r-or-r-r-"r-r-4r-5r-or-r-r-r-lr-r-s-s-s-Ys- s-(s-0s-h8s-@s-Hs-Ps-Xs-`s-hs-ps- xs-s-s-s-s-s-s-s-s-s-s-s-s-s-s-s-ps-pt-t-t-t-_ t-=(t-0t-m8t-@t-Ht-Pt-hXt-`t-/ ht-pt- xt-t-xt-t-t-t-t-t-.t-t-t-t-t-t-t-t-\t-ju-6u-u-u- u-(u-0u-8u-@u-Hu-Pu-Xu-e`u-Lhu-pu-\xu->u-u-% u-u-u-u-u-u-Au-u-u-Au-=u-:u-Ku-u-v-v-Vv-v- v-s(v-0v-8v- @v- Hv-Pv-Xv-`v-yhv-pv-xv-=v- v-v-8v-)v-v-v-v-3v-v-v-fv-v-v-v-v-Xw-2w-w-w- w-(w--0w-8w-@w-WHw-hPw-Xw-B`w-/hw-pw-8xw-w-w-w-w-w-w-8 w-w-&w-w-w-w-]w-w-w-w-x-Yx-2 x-x- x-v(x-0x-B8x-.@x-Hx-Px-Xx-`x-B hx-epx-`xx-{x- x-rx-x-x-`x-x-x-x-x-x-#x-x-Cx-x-x- y-Ry-y-y- y-(y-0y-8y-@y-Hy-Py-fXy-`y- hy-py-axy-y-y- y-y-y-y-y-y-qy-y- y-y-ny-!y-y- y-z- z-z-z- z- (z-0z- 8z-@z-iHz- Pz-0Xz-D`z-hz-pz-xz-z-|z-z-bz-z-z-z-Zz-z-Nz-z->z-z-Sz-z-z-K{-{-{-{-J {-({-i0{-8{-@{-H{-P{-X{-`{-h{-(p{-x{-{-{-{-~{-{-0{-{-{-N{-{-{-!{-F{-{-{-{-|-|-G|-|- |-(|-0|-8|-^@|-H|-P|-X|-z`|-mh|-Ip|-x|-||-|-|-T|-|-|-/|-|-_|-|-|-|-|-}|-m|- |-}-v}-}-}-  }-N(}- 0}-8}-@}-H}-CP}-!X}-`}-"h}-bp}-Lx}-J}-$}-}-}-}-}-#}-}-}-3}-$}-}-G}-}-%}-}-~-O~-~-~- ~-&(~-0~-E8~-@~-H~-P~-'X~-Z`~-h~-p~-(x~-~-~-c~-~-I~-~-~-~- ~-~-*~-+~-u~-,~--~-g~---w--. -(-0-t8-@-H-P-}X-/`-h-0p-0x-1-3-2-3---4-5--s-F--q-s-6-" --7-1-L-8 -9(-:0-;8-|@-~H-EP- X-<`-h-=p-x-L--P-->- -3---?Ȁ-@Ѐ-r؀-<---I-W-A-B-x- -(-90-8-C@-H-P-X-k`-h-Yp-x--x---D-----ȁ- Ё-؁-t--E-[---H- - -?(-0-28-|@-FH-GP-HX-`-h-# p-x-I-J--`-K-----LȂ-Ђ-؂----M--N-)-$- -N(-0-< 8-O@-9 H-jP-X-P`-ah->p-x-- -Q--R--S-T--Uȃ-Ѓ-V؃-W---c-X-Y-(-y-Z -* (-y0-[8-@-H- P-X-F`-\h-p-x-g-\--E --L-&--]- Ȅ-Є-؄-^-----: --- -(-0-8-@-`H-P-aX-`-Oh-p-bx--c---- ----4ȅ-dЅ-Z؅--k----e-f-g- -(-0-h8-_@-jH-P-X-HHG'HtH5'%'@%'h%'h%'h%'h%'h%'h%'h%'hp%'h`%'h P%'h @%'h 0%z'h %r'h %j'h%b'h%Z'h%R'h%J'h%B'h%:'h%2'h%*'h%"'hp%'h`%'hP% 'h@%'h0%'h %'h%'h%'h%'h %'h!%'h"%'h#%'h$%'h%%'h&%'h'p%'h(`%'h)P%'h*@%'h+0%z'h, %r'h-%j'h.%b'h/%Z'h0%R'h1%J'h2%B'h3%:'h4%2'h5%*'h6%"'h7p%'h8`%'h9P% 'h:@%'h;0%'h< %'h=%'h>%'h?%'h@%'hA%'hB%'hC%'hD%'hE%'hF%'hGp%'hH`%'hIP%'hJ@%'hK0%z'hL %r'hM%j'hN%b'hO%Z'hP%R'hQ%J'hR%B'hS%:'hT%2'hU%*'hV%"'hWp%'hX`%'hYP% 'hZ@%'h[0%'h\ %'h]%'h^%'h_%'h`%'ha%'hb%'hc%'hd%'he%'hf%'hgp%'hh`%'hiP%'hj@%'hk0%z'hl %r'hm%j'hn%b'ho%Z'hp%R'hq%J'hr%B'hs%:'ht%2'hu%*'hv%"'hwp%'hx`%'hyP% 'hz@%'h{0%'h| %'h}%'h~%'h%'h%'h%'h%'h%'h%'h%'h%'hp%'h`%'hP%'h@%'h0%z'h %r'h%j'h%b'h%Z'h%R'h%J'h%B'h%:'h%2'h%*'h%"'hp%'h`%'hP% 'h@%'h0%'h %'h%'h%'h%'h%'h%'h%'h%'h%'h%'h%'hp%'h`%'hP%'h@%'h0%z'h %r'h%j'h%b'h%Z'h%R'h%J'h%B'h%:'h%2'h%*'h%"'hp%'h`%'hP% 'h@%'h0%'h %'h%'h%'h%'h%'h%'h%'h%'h%'h%'h%'hp%'h`%'hP%'h@%'h0%z'h %r'h%j'h%b'h%Z'h%R'h%J'h%B'h%:'h%2'h%*'h%"'hp%'h`%'hP% 'h@%'h0%'h %'h%'h%'h%'h%'h%'h%'h%'h%'h%'h%'hp%'h`%'hP%'h@%'h0%z'h %r'h%j'h%b'h%Z'h%R'h%J'h%B'h%:'h%2'h%*'h%"'hp%'h`%'hP% 'h@%'h0% 'h % 'h% 'h% 'h% 'h% 'h% 'h% 'h% 'h% 'h% 'h% 'hp% 'h`% 'h P% 'h @% 'h 0%z 'h  %r 'h %j 'h%b 'h%Z 'h%R 'h%J 'h%B 'h%: 'h%2 'h%* 'h%" 'hp% 'h`% 'hP% 'h@% 'h0% 'h % 'h% 'h% 'h% 'h % 'h!% 'h"% 'h#% 'h$% 'h%% 'h&% 'h'p% 'h(`% 'h)P% 'h*@% 'h+0%z 'h, %r 'h-%j 'h.%b 'h/%Z 'h0%R 'h1%J 'h2%B 'h3%: 'h4%2 'h5%* 'h6%" 'h7p% 'h8`% 'h9P% 'h:@% 'h;0% 'h< % 'h=% 'h>% 'h?% 'h@% 'hA% 'hB% 'hC% 'hD% 'hE% 'hF% 'hGp% 'hH`% 'hIP% 'hJ@% 'hK0%z 'hL %r 'hM%j 'hN%b 'hO%Z 'hP%R 'hQ%J 'hR%B 'hS%: 'hT%2 'hU%* 'hV%" 'hWp% 'hX`% 'hYP% 'hZ@% 'h[0% 'h\ % 'h]% 'h^% 'h_% 'h`% 'ha% 'hb% 'hc% 'hd% 'he% 'hf% 'hgp% 'hh`% 'hiP% 'hj@% 'hk0%z 'hl %r 'hm%j 'hn%b 'ho%Z 'hp%R 'hq%J 'hr%B 'hs%: 'ht%2 'hu%* 'hv%" 'hwp% 'hx`% 'hyP% 'hz@% 'h{0% 'h| % 'h}% 'h~% 'h% 'h% 'h% 'h% 'h% 'h% 'h% 'h% 'hp% 'h`% 'hP% 'h@% 'h0%z 'h %r 'h%j 'h%b 'h%Z 'h%R 'h%J 'h%B 'h%: 'h%2 'h%* 'h%" 'hp% 'h`% 'hP% 'h@% 'h0%'h %'h%'h%'h%'h%'h%'h%'h%'h%'h%'h%'hp%'h`%'hP%'h@%'h0%z'h %r'h%j'h%b'h%Z'h%R'h%J'h%B'h%:'h%2'h%*'h%"'hp%'h`%'hP% 'h@%'h0%'h %'h%'h%'h%'h%'h%'h%'h%'h%'h%'h%'hp%'h`%'hP%'h@%'h0%z'h %r'h%j'h%b'h%Z'h%R'h%J'h%B'h%:'h%2'h%*'h%"'hp%'h`%'hP% 'h@%'h0%'h %'h%'h%'h%'h%'h%'h%'h%'h%'h%'h%'hp%'h`%'hP%'h@%'h0%z'h %r'h%j'h%b'h%Z'h%R'h%J'h%B'h%:'h%2'h%*'h%"'hp%'h`%'hP% 'h@%'h0%'h %'h%'h%'h%'h%'h%'h%'h%'h%'h%'h%'hp%'h`%'h P%'h @%'h 0%z'h  %r'h %j'h%b'h%Z'h%R'h%J'h%B'h%:'h%2'h%*'h%"'hp%'h`%'hP% 'h@%'h0%'h %'h%'h%'h%'h %'h!%'h"%'h#%'h$%'h%%'h&%'h'p%'h(`%'h)P%'h*@%'h+0%z'h, %r'h-%j'h.%b'h/%Z'h0%R'h1%J'h2%B'h3%:'h4%2'h5%*'h6%"'h7p%'h8`%'h9P% 'h:@%'h;0%'h< %'h=%'h>%'h?%'h@%'hA%'hB%'hC%'hD%'hE%'hF%'hGp%'hH`%'hIP%'hJ@%'hK0%z'hL %r'hM%j'hN%b'hO%Z'hP%R'hQ%J'hR%B'hS%:'hT%2'hU%*'hV%"'hWp%'hX`%'hYP% 'hZ@%'h[0%'h\ %'h]%'h^%'h_%'h`%'ha%'hb%'hc%'hd%'he%'hf%'hgp%'hh`%'hiP%'hj@%'hk0%z'hl %r'hm%j'hn%b'ho%Z'hp%R'hq%J'hr%B'hs%:'ht%2'hu%*'hv%"'hwp%'hx`%'hyP% 'hz@%'h{0%'h| %'h}%'h~%'h%'h%'h%'h%'h%'h%'h%'h%'hp%'h`%'hP%'h@%'h0%z'h %r'h%j'h%b'h%Z'h%R'h%J'h%B'h%:'h%2'h%*'h%"'hp%'h`%'hP% 'h@%'h0%'h %'h%'h%'h%'h%'h%'h%'h%'h%'h%'h%'hp%'h`%'hP%'h@%'h0%z'h %r'h%j'h%b'h%Z'h%R'h%J'h%B'h%:'h%2'h%*'h%"'hp%'h`%'hP% 'h@%'h0%&h %&h%&h%&h%&h%&h%&h%&h%&h%&h%&h%&hp%&h`%&hP%&h@%&h0%z&h %r&h%j&h%b&h%Z&h%R&h%J&h%B&h%:&h%2&h%*&h%"&hp%&h`%&hP% &h@%&h0%&h %&h%&h%&h%&h%&h%&h%&h%&h%&h%&h%&hp%&h`%&hP%&h@%&h0%z&h %r&h%j&h%b&h%Z&h%R&h%J&h%B&h%:&h%2&h%*&h%"&hp%&h`%&hP% &h@%&h0%&h %&h%&h%&h%&h%&h%&h%&h%&h%&h%&h%&hp%&h`%&h P%&h @%&h 0%z&h  %r&h %j&h%b&h%Z&h%R&h%J&h%B&h%:&h%2&h%*&h%"&hp%&h`%&hP% &h@%&h0%&h %&h%&h%&h%&h %&h!%&h"%&h#%&h$%&h%%&h&%&h'p%&h(`%&h)P%&h*@%&h+0%z&h, %r&h-%j&h.%b&h/%Z&h0%R&h1%J&h2%B&h3%:&h4%2&h5%*&h6%"&h7p%&h8`%&h9P% &h:@%&h;0%&h< %&h=%&h>%&h?%&h@%&hA%&hB%&hC%&hD%&hE%&hF%&hGp%&hH`%&hIP%&hJ@%&hK0%z&hL %r&hM%j&hN%b&hO%Z&hP%R&hQ%J&hR%B&hS%:&hT%2&hU%*&hV%"&hWp%&hX`%&hYP% &hZ@%&h[0%&h\ %&h]%&h^%&h_%&h`%&ha%&hb%&hc%&hd%&he%&hf%&hgp%&hh`%&hiP%&hj@%&hk0%z&hl %r&hm%j&hn%b&ho%Z&hp%R&hq%J&hr%B&hs%:&ht%2&hu%*&hv%"&hwp%&hx`%&hyP% &hz@%&h{0%&h| %&h}%&h~%&h%&h%&h%&h%&h%&h%&h%&h%&hp%&h`%&hP%&h@%&h0%z&h %r&h%j&h%b&h%Z&h%R&h%J&h%B&h%:&h%2&h%*&h%"&hp%&h`%&hP% &h@%&h0%&h %&h%&h%&h%&h%&h%&h%&h%&h%&h%&h%&hp%&h`%&hP%&h@%&h0%z&h %r&h%j&h%b&h%Z&h%R&h%J&h%B&h%:&h%2&h%*&h%"&hp%&h`%&hP% &h@%&h0%&h %&h%&h%&h%&h%&h%&h%&h%&h%&h%&h%&hp%&h`%&hP%&h@%&h0%z&h %r&h%j&h%b&h%Z&h%R&h%J&h%B&h%:&h%2&h%*&h%"&hp%&h`%&hP% &h@%&h0%&h %&h%&h%&h%&h%&h%&h%&h%&h%&h%&h%&hp%&h`%&hP%&h@%&h0%z&h %r&h%j&h%b&h%Z&h%R&h%J&h%B&h%:&h%2&h%*&h%"&hp%&h`%&hP% &h@%&h0%&h %&h%&h%&h%&h%&hп%&h%&h鰿%&h頿%&h鐿%&h逿%&hp%&h`%&h P%&h @%&h 0%z&h  %r&h %j&h%b&h%Z&h%R&hо%J&h%B&h鰾%:&h頾%2&h鐾%*&h逾%"&hp%&h`%&hP% &h@%&h0%&h %&h%&h%&h%&h %&h!н%&h"%&h#鰽%&h$頽%&h%鐽%&h&逽%&h'p%&h(`%&h)P%&h*@%&h+0%z&h, %r&h-%j&h.%b&h/%Z&h0%R&h1м%J&h2%B&h3鰼%:&h4頼%2&h5鐼%*&h6逼%"&h7p%&h8`%&h9P% &h:@%&h;0%&h< %&h=%&h>%&h?%&h@%&hAл%&hB%&hC鰻%&hD頻%&hE鐻%&hF逻%&hGp%&hH`%&hIP%&hJ@%&hK0%z&hL %r&hM%j&hN%b&hO%Z&hP%R&hQк%J&hR%B&hS鰺%:&hT頺%2&hU鐺%*&hV逺%"&hWp%&hX`%&hYP% &hZ@%&h[0%&h\ %&h]%&h^%&h_%&h`%&haй%&hb%&hc鰹%&hd頹%&he鐹%&hf逹%&hgp%&hh`%&hiP%&hj@%&hk0%z&hl %r&hm%j&hn%b&ho%Z&hp%R&hqи%J&hr%B&hs鰸%:&ht頸%2&hu鐸%*&hv逸%"&hwp%&hx`%&hyP% &hz@%&h{0%&h| %&h}%&h~%&h%&h%&hз%&h%&h鰷%&h頷%&h鐷%&h逷%&hp%&h`%&hP%&h@%&h0%z&h %r&h%j&h%b&h%Z&h%R&hж%J&h%B&h鰶%:&h頶%2&h鐶%*&h逶%"&hp%&h`%&hP% &h@%&h0%&h %&h%&h%&h%&h%&hе%&h%&h鰵%&h頵%&h鐵%&h逵%&hp%&h`%&hP%&h@%&h0%z&h %r&h%j&h%b&h%Z&h%R&hд%J&h%B&h鰴%:&h頴%2&h鐴%*&h逴%"&hp%&h`%&hP% &h@%&h0%&h %&h%&h%&h%&h%&hг%&h%&h鰳%&h頳%&h鐳%&h逳%&hp%&h`%&hP%&h@%&h0%z&h %r&h%j&h%b&h%Z&h%R&hв%J&h%B&h鰲%:&h頲%2&h鐲%*&h進%"&hp%&h`%&hP% &h@%&h0%&h %&h%&h%&h%&h%&hб%&h%&h鰱%&h頱%&h鐱%&h週%&hp%&h`%&hP%&h@%&h0%z&h %r&h%j&h%b&h%Z&h%R&hа%J&h%B&h鰰%:&h頰%2&h鐰%*&h逰%"&hp%&h`%&hP% &h@%&h0%&h %&h%&h%&h%&h%&hЯ%&h%&h鰯%&h頯%&h鐯%&h逯%&hp%&h`%&h P%&h @%&h 0%z&h  %r&h %j&h%b&h%Z&h%R&hЮ%J&h%B&h鰮%:&h頮%2&h鐮%*&h逮%"&hp%&h`%&hP% &h@%&h0%&h %&h%&h%&h%&h %&h!Э%&h"%&h#鰭%&h$頭%&h%鐭%&h&逭%&h'p%&h(`%&h)P%&h*@%&h+0%z&h, %r&h-%j&h.%b&h/%Z&h0%R&h1Ь%J&h2%B&h3鰬%:&h4頬%2&h5鐬%*&h6逬%"&h7p%&h8`%&h9P% &h:@%&h;0%&h< %&h=%&h>%&h?%&h@%&hAЫ%&hB%&hC鰫%&hD頫%&hE鐫%&hF逫%&hGp%&hH`%&hIP%&hJ@%&hK0%z&hL %r&hM%j&hN%b&hO%Z&hP%R&hQЪ%J&hR%B&hS鰪%:&hT頪%2&hU鐪%*&hV逪%"&hWp%&hX`%&hYP% &hZ@%&h[0%&h\ %&h]%&h^%&h_%&h`%&haЩ%&hb%&hc鰩%&hd頩%&he鐩%&hf逩%&hgp%&hh`%&hiP%&hj@%&hk0%z&hl %r&hm%j&hn%b&ho%Z&hp%R&hqШ%J&hr%B&hs鰨%:&ht頨%2&hu鐨%*&hv逨%"&hwp%&hx`%&hyP% &hz@%&h{0%&h| %&h}%&h~%&h%&h%&hЧ%&h%&h鰧%&h頧%&h鐧%&h逧%&hp%&h`%&hP%&h@%&h0%z&h %r&h%j&h%b&h%Z&h%R&hЦ%J&h%B&h鰦%:&h頦%2&h鐦%*&h逦%"&hp%&h`%&hP% &h@%&h0%&h %&h%&h%&h%&h%&hХ%&h%&h鰥%&h頥%&h鐥%&h逥%&hp%&h`%&hP%&h@%&h0%z&h %r&h%j&h%b&h%Z&h%R&hФ%J&h%B&h鰤%:&h頤%2&h鐤%*&h逤%"&hp%&h`%&hP% &h@%&h0%&h %&h%&h%&h%&h%&hУ%&h%&h鰣%&h頣%&h鐣%&h連%&hp%&h`%&hP%&h@%&h0%z&h %r&h%j&h%b&h%Z&h%R&hТ%J&h%B&h鰢%:&h頢%2&h鐢%*&h逢%"&hp%&h`%&hP% &h@%&h0%&h %&h%&h%&h%&h%&hС%&h%&h鰡%&h頡%&h鐡%&h逡%&hp%&h`%&hP%&h@%&h0%z&h %r&h%j&h%b&h%Z&h%R&hР%J&h%B&h鰠%:&h頠%2&h鐠%*&h造%"&hp%&h`%&hP% &h@%&h0%&h %&h%&h%&h%&h%&hП%&h%&h鰟%&h頟%&h鐟%&h速%&hp%&h`%&h P[?H@DA\foD$H foL$ D$ $HKHLHQ$|HLkS~HLS;~E1~A~H5( HH5( HH=֑( H=( H=xLLE1W# 1KHD$HD$# H5H1fHnA$fH:"AD$1L܀fo $foT$A $AT$H|$(1AHDH5FHǾ=HHHH5H|$80H|$8H5HqK1LAH5DŽ$H$H$fo$fDo$)|$`D)D$p陃HC锂{xd{ xlL&E+EDk鯀H54HD$8+ C܂fDo|$`foT$pE<$AT$鏃H5C&.kLE&A8AEDS xL$L|${$C$镂Ht$\HxDD$\DC$l1LAHpHDŽ$fHnH5RfH:"$fDo4$1LA$Et$鮂H|$8H5+Hi,fDol$1LA$El$cL$ H5سHD$8H|$8u{鴀H5u{x/C{陀{`C`CHVH|$ Ht$ LHT$(Onfo$1LA$AT$VH|$ 9H|$LL HL}MD1A$Mt$ML$MPHI$E1B陃鏃酃HDD$HL$HT$H4$޼DD$H4$HHT$HL$At~AAAHH9H<HL$HT$H4$-HHtuLHH4$HD$HHT$DMQEtYxEYHIE1EuaHT$H$H<$HL$HtH)HHuFAH D[]A\AAAHt MI)ILH>E1A{LGALLH誻LxHI9J<6IHHD$8LHHHL$8IyLLD$(LL$ HL$Ht$H|$ L\$Ht$HHLL$ LD$(HHL$wSEQA(vKABHI)MIMuHt LL)HH;M$1C;HtHtEu;LHt$ Ht Ht$H)H3H,$Ht9L%FLeMIHAQHcƒHH݅HԅH˅H…H鹅H鰅H駅H鞅H镅H錅C(鞆oD$D\$(E$E\$AD$鋆C نI_̇L'&A8u(A_!L&LTLy'IL "&AH51A_I9G݇L-&A}tH-&AH5E1A_H}駇L%&A<$iL=&H=gEA_IjAtRL%}&E1MHT$I?D2HtoHAH5|&McIIIAVL=&A?H&H=DAH A׆H&;HE&H=&H5DA_HH?1HT镆LAL'tIL &MM9}CNlH-&MZMEg LmQIAhCIA7Eg .L5&A>L%;&JTH5ץ1I<$A_^L)HH遆fo$1LA$AT$RLH|0HH $H)H+H $Ljfo$1LA$A\$1LA$AD$8 1A1À8[D$?H-LQ1fHnLfI:"A$AD$1L݇1鳈H&LH55H81 |H&H=1H 3d1zIއ8ՇH11:fo$foL$A$AL$錉fo $foT$A $AT$Hl$@HH{XtMt%LHLt铉1HLt遉HS`HKhfHLD$(HT$ HT$ HL$8tQH5Ld$1H|$L tBfHnfI:"A$A|$fDo|$`fol$pD)|$@)l$PL|$\$@Lt$Hfot$@Ll$Pfo\$PA7A_׌H$L$fo$fo$)$)$$H$fDo$L$fDo$D)d$`D)l$pH$L$fo$fo$)$)$H|$(عL@HjfDo$H$DfDo$L$D)$D)$,H$L$fDo$fDo$D)$D)$H$L$fDo$fDo$D)$D)$fHnꉜ$fI:"$fo$fo$)t$`)\$p驊H|$(عLHH|$(عLH{fo$fo$)d$`)D$p?H$L$fo$fo$)$)$fLnꉜ$fM:"D$fDo$fDo$D)t$`D)|$p̉H$L>HV뙉H$L>H0pH$L$fo$fDo$)$D)$7H$L>HH$Lx>HH$L$fDo$fDo$D)$D)$H$L$fDo$fDo$D)$D)$oH$L=H&fHnډ$1fI:"$fo$fo$)d$`)D$pH$L$fo$fo$)$)$H$1L<HeH$L$fo$fo$)$)$$1H$fDo$L$fDo$D)L$`D)T$pMH$L$fo$fDo$)$D)$댉H$LHcIXHHiHLLL轌L$LLL觾$1LE11wLHD$HT$Lt$Ll$\$`Lt$hfDol$`Ll$pfDot$pD)l$@D)t$PعLL ;H}1عLL:HWH$L$fo$fo$)\$`)d$p鳅LL&$ fo$H$fo$L$)l$`)t$pfH\$fod$@foD$P#Cąfo4$fo|$AuA}cH5H81fHnLfH:"AEAm+H=ĜoLd$L-:M,$闊HT$H=:H:郊Î1HDjEEA?wGAwH=tRHtVJ@Ӄ|r1kaW=uF<15+! ZDkA?w9w;1=э9黍鱍駍1=閍H5H71fHnLfH:"A$AD$鏎fo $foT$A $AT$tHvIĜ%HHMuzD$EtvH%Af1H5AfLnD$$fL:"D$fo$Dfo$)$)$bHLg&E =HHtNHxHuK$xAD$EW$鰔HHou<$x1AW$uDŽ$H1H5AHhAG(ALJAH 1LH%y$ƐD$L$fo$H$fo$D\$ )$)$L$H$D$ L4$Ht$ %|$ H5*7vH=F71d1E1H$1L$L$L$LL$ БI_`鱏H|$1Hd4H5e锗輼HH@4LH$1L$L$L $H4LL\$ @H$H$)$H4$HL$ )$IHHU&H;L4LբHZL H3INHND0IHqHL$pHL$(ELsH$1H43L1HHtn:HH$jH4$HtxLX>t%MML<5IH讲^H H$1AH2H5D$H$H$$>tIuH4$HHLIL˜L\$ PH4$L\$ D$EM9-H4$ILLLxHD$H4$E H軱H$fDo$H$$fDo$D)$D)$HqH$fo$fo$H$$)$)$IWpH LH荈$fo$H$fo$H$$)$)$$H$fo$H$$fo$)$)$kIGpHH$1Hq0H5H5HtH5VHIHLL艇$L$H$$L$L$fo$fo$L$LL$ )$)$H$H$fDo$$fDo$D)$D)$ALLHHH fHN=$Lvo$fDo$L$H$D)$$fDo$D)$MH LLHj=$BH<$LL(D$H4$Efo$H$fo$H$$)$)$`=H8IHH複HҍI~IGPHAH'.H5pDH11H SILLHD$Efo$H$fo$H$$)$)$ H 2ߏL5&GH=IIH$1H5 HHٺ&H=11H$L$E1H$L$Ht$ FHt$H FHpD$fo$fo$H$H$$)$)$E"JH=6ILHՃD$EH$H$fDo$$fDo$D)$D)$D$H$H$$=HHt+HxHu$4(H>EaAG TH$H$fDo$$fDo$D)$D)$饎H|$DHN+H5W1|L=:Ll$1H|$fMnH5+fL:"AEEu鬎A&A-A8AAAIAQAZAaAhAoAAAAH&;@@AfDo$HT$fo$D:b髍ALJ1ALJMALJjH2&AWH 0&9AwH-G&DEEL H&EEL&E#EL-d&EuEH=E&AHX& AH&3AH-&}AEErL&A:AEEaL-&A}AAAOH&8AAAG48AG8DH5-H肼L$M LLL$A;uH91HALLKDŽ$fMn1H2LfM:"D$fo$fo$)$)$D$H$H$$@LH5#1HHH$H4$H8k$fDo$H$L$fDo$D$D)$D)$tH|$@H|$PD\$8LL$ HT$ D$8LT$@fDo$L$fDo$LL$ D)$D)$IsH$H$fDo$$fDo$D)$D)$H$H$fDo$$fDo$D)$D)$D$H$H$$fDo$fDo$D)$D)$D$H$H$$gH$H$fDo$$fDo$D)$D)$AG,鑃ILLHkD$EuUII隇I采IxIkufo$H$fo$H$$)$)$#AG0H &1鴃Lt$XH5(HD$XLHH<$AGX~~H|$P9Gfo$H$fo$H$$)$)$IH$H$fDo$$fDo$D)$D)$LH ~LH{D$鿄IH鿄AGIGوw fo$foL$A$AL$闍fo$foL$A$AL$ÍHHHt$|$Ht$u H[foD$foL$ A$AL$I<$I\$LIݢ8CIHLHL>I LLD$HT$Ht$-1|$ Ht$HT$LD$u HCfoD$ foL$0A$AL$<HUHsxL@<$u HmKfo$foL$A$AL$QHt$ HB8 D$ xD$ 9`YD$ HԎH ƎH0$鳎H\$H|$1fot$0stfo|$@D$A)<$HHl$fDo$DD$DeDEDU2L1蓳jH|$P1AL1pDl$hDl$띋$DoD$xT$D)D$ fDoL$ D) $tAH}(HH}(HE(bH H5|ҒHEH H5W鲒Hl$֓H|$LtL L H|$ 1fInAfI:"QH|$LB$uH|$L uH|$LuL$H$ fo$fDo$ )$QD)$QD$QH|$PfMnfL:"D?DgDg鱛L;MIL$Q:LtHHLLE1H5LALd$PfDot$pA$AD$Et$0H,$H踞H谞H訞$t1H<$H\$PfDo|$`CD{ٚH<$H5=sIM)LHI@ܖ{0HsH<$H4$LHdWD$0L$8H$@Dt$EpN1@LL $sH<$LH5L$tLL莘L$L:Hm:H踱HtHS HL螜$Qfo$Qfo$Qo$Q)$)$)|$ foD$ $)D$0LL$PfDoD$0A1AQEALLE1腹L~LWALt$PfMnfM:"EEfEN C(8HkoLLԕfo$LT$PAABAJIM)LxIOtIt?sLpDŽ$ 5D$H$H$t^D$HdLfMn\$fL:"D$fDo$$D)$@ D$H=LOL$H$fDo$fDo$D)$D)$eL誙D$H$D$LH/H<$L1LD$LHCH4$H$LL=+H|$ D$L$H$DD$ELd$L$$LJrHS H|$ LHD$0贙$L$H$H|$ LL腙$L$H$L2NHT$0LDŽ$^HsH<$Ld$辔HS H4$H|$ D$L$H$DL$EH4$H|$ L͘D$L$H$DT$EH<$&2uBC,H4$HL{$L$H$T$iC,~HLL$QHHpHU HLH$$QsHH(L$QRH虛H$HDŽ j$ uHHsHAHS HL芗$QHHLi$QH.C(铎{0uVHsHD$Ȓ$xiHS HH$ $Do$D)L$0P$L K&7H=z}D$I nD$뀾a$0/t6LLLLL莖$ uELLS饋LLy1HD$PfDo$(pDXZDo$($8D)$HL軑y(D$1Hl$P\$fod$@]ue L藔L菔io$8$H)\$@H$1It$L$QL$QD$QqE1L{LAUE1H5LADH$QAH5{L`HC(H轓]Ld$L g&:H={I 莺ZD$H*{L遐ۣAאtDHcHt$LD?NIHt;L9d$sHLHLlLzDt$鋐{AwgAcHAD#AOiH $H|$vLCLtLHGfo $1LAEAMfo\$fod$ A]Ae̐HLLx驐fo$AEAU钐E1HE14H5Haw1fHnLfH:"A$AD$eLE1+E1ؑH=%*H|$LXLMt?LT$4HLT$豬LT$I*4L蚬'H5N%*Ht$LD$E11E1EfDL$HKH{@AtYC,1LHLLT$fn1fA:"fK,ZsLT$HD$@C,HC0 A`E1H{8AAOE1GE1?IWHLAWx,M?Muf|$H|$H螫AMt1H|$8LT$gsH|$@LT$H/tL,AD$HD$LT$AC0DK,HEyC0K,LT$H\$HELd$MtM $HD$Ht H'HLt`贍鵐eIIHT$HtHLt耍郐StfkldkU1~NA鯑HAfHH=ΑH5]HE1ҧH A驑uґL&I:T黑ƒى|$11QTHcg|$t_|$襜|$DA tAtA ur&1|$b|$uL&I;Ǹ.Ů&1|$ |$3!L &I9{MHI$E1鈑PFd&^&ZHH5t1fHnLfH:"A$AD$鱑foD$foL$ A$AL$1LH|$tL-h HAA$IT$Ml$̑1Hב1H{鎓H&1 H8pmLq& 1I8UmvH=&1 H?5mL 6&1 I9mL& 1I:l HFHtiL &E1iCIÞ&AAGTIu@HH5r1fHnLfH:"A$AD$H=&A&t:t5 ME<LD$裟R\&E=Y&1H=45xAƅ =3&5DcD5&H4$LDyHH]I)H$M1ҒfLJ&H5 1I;w骒T$ D k1H= nAŅ H4$LDmHޘ8tDbR=^&Ht$ IL5&苘w$HHuL&H5@qI:耪Ht$ D{ufoD$ D5ڪ&۪&DFbEI)H$MD&b1鈑L &LH5p1I9dvH5&H9t$ 1H=y&H9|$(D5W&E0EH A&H9LD$ΐH1HH菊Zr1HHC茙H{?HZH5h1fHnLfH:"A$AD$E1!L ɤ&H5RpI9LE1߆H{zܖH=e DD$DD$4~LH)xmLH<TH=j]nHi!I}IH= DD$PDD$H= DD$*DD$zH=hoӨE1naH= ZH=jo譨SHHXMZuRHݯuNH-ZuJH软uFǃHH{Ht mHC[H=# ;H=o/H=(o#H=DoH=  1H=EoH=ioH=oاH= ̧H=eoH= 货C$CH=o蕧H=o艧H=o}H=pqH=ZoeH= Yfo$1LA$At$1fol$1LA$Al$ fot$ 1LA$At$fo|$01LA$A|$žfDoD$@1LA$ED$霞fDoL$P1LA$EL$vfDoT$`1LA$ET$PfDo\$p1LA$E\$*fDo$1LA$Ed$fDo$1LA$El$؝fDo$1LA$Et$鯝fDo$1LA$E|$醝fo$1LA$AL$^fo$1LA$AT$6fo$1LA$A\$fo$1LA$Ad$fo$1LA$AD$龜fo$1LA$Al$閜fo$ 1LA$At$nfo$01LA$A|$FfDo$@1LA$ED$fDo$P1LA$EL$fDo$`1LA$ET$˛fDo$p1LA$E\$颛fDo$1LA$Ed$yfDo$1LA$El$PfDo$1LA$Et$'fDo$1LA$E|$fo$1LA$AL$֚fo$1LA$AT$鮚fo$1LA$A\$醚fo$1LA$Ad$^fo$1LA$AD$6fo$1LA$Al$fo$ 1LA$At$fo$01LA$A|$龙fDo$@1LA$ED$镙fDo$P1LA$EL$lfDo$1LA$ET$GfDo$`1LA$E\$fDo$p1LA$Ed$fDo$1LA$El$̘fDo$1LA$Et$飘fDo$1LA$E|$zfo$1LA$AL$Rfo$1LA$AT$*fo$1LA$A\$fo$1LA$Ad$ڗfo$1LA$AD$鲗fo$1LA$Al$銗fo$1LA$At$bfo$ 1LA$A|$:fDo$01LA$ED$fDo$@1LA$EL$fDo$P1LA$ET$鿖fDo$`1LA$E\$閖fDo$p1LA$Ed$mfDo$1LA$El$DfDo4$1LA$Et$fDo$1LA$E|$fo$1LA$AL$Εfo$1LA$AT$馕fo$1LA$A\$~fo$1LA$Ad$Vfo$1LA$AD$.fo$1LA$Al$IHmu H H&H5KlH:ILH8ԖH;I,$uL趖L謖(I/uL虖HPcMtI{`H;&II/uLTHmvHAiH4SH'_Hm$HLI/LLG&H5k1I;NgIxhH;w@iHH;w(L蘕MtIS`H;iI]MtMC`I;-I!MtIS`H;IM@hI;@HpeH=3&IUH5j1H?~fI/LLڔmMt I; I HmH褔HmH茔HmHt|HgH-{&INH5i1IUH}eIMtI{`H;IMtMC`I;I|MtIS`H;jI^MtM[`M;MMtIS`H;tIhI/L耓H/sX[A\YUH=iE1艖SL̉I$H=i^E1L螉HlHHV[]A\X1\H+L=+IW H+%8AEDP$L-ޕ&I}AAG?A)MMGo1L髐HH|$H|$HHHH|L)$跈I$fo$8LH6+H9H%SL)$tfo$鰐LbH=nh街CDL\$8 CD  11 HP*HHH1rHLH H HH/ MI)I1I.p~?U]gIgDPA€A@փqI?+1@v pxDHDvA?wKtMuwmD_A?wEAI?wF HA)7w1LMH U  Y[]A\A]A^A_TH&H55fE1H;BJ H ~&H5eE1H9$, L臅 LRH陎Hm HHD$юHD$ 11 HM*H HH  HWH> H/tHM*HtHH v11 HM*HtHHX[]ޏLH|$tg HxH|$tGHD$ H H H] HMH;K  H4IH xpH]  H9]HMIHHtЅH|$L&HL9G H  I9\$tjHkuHD yU1 E H=d訐1 L +IHHEHD$ILML +ImI}  HE HL$LLHPHH N4JI IH}LLt$t5H5E+HM(HLvH IwLg[@ L&HI(v@ _@ ; |$4t H A H=+*tH="*]\H=YqH=DH*H&Ivh uI~HxtL&I(GvxM6a@ HL@ 趀R@ @ ~C H[qC OYH+D$H袆J4+HH=lXi? HuM6? HgHt$< IVINL1HR[AH5HL= H=CXV< H$HL1L)AIJ<#qKHIA IcH5e&H=^&1LLM9t MHH4$H==W1@IXHD$9 H9 H G HG H{HwL 1kL HzfDo$1LA$ED$fDoL$1LA$EL$ĉfDoT$ 1LA$ET$鞉fDo\$01LA$E\$xfo|$@1LA$A|$S|龈镉HEE1HHLIB{IVHU鳉D A1:hB逋H=4WgL=LeMl$LmMFHD$ Z|D$ 1Ly=!Hmt_AcL)|VImuLA|>L|H{魋I.uLA{ HA{ND$ {D$ <H=V脁H=VxfDoT$1LA$ET$關Hj{~Hfo<$1LA$A|$^L1{Lfo4$1LA$At$%Hz鉛Hfo,$1LA$Al$LzLrfDo$1LA$ED$鲛Hz陚H8fDo $1LA$EL$xHKzHfDo$1LA$ET$>Lz颙LfDo$1LA$E\$Hy&HfDo$$1LA$Ed$ʚHy骘HPfDo,$1LA$El$鐚Lcy/LfDo4$1LA$Et$VH)y鳗HfDo<$1LA$E|$Hx7Hfo$$1LA$Ad$Lx齖Lifo $1LA$AL$骙H}xBH0fo$1LA$AT$qLDxΕLfo$1LA$A\$8H xSHfo$1LA$AD$LwߔLfo<$1LA$A|$ƘHwkHLfo4$1LA$At$鍘L`wLfo,$1LA$Al$TfDoD$01LA$ED$.fDoL$ 1LA$EL$I,$tE1K LE1v{K HL@]A[HmtE1HvHE1vۙ1sH靚Z[A\'H]L{L}H;H([]A\A]A^A_jL%h&H5OKI<$qQ H]}MIMrR (a*Q IDUM $A/bH}H_H]H/MU HR R LkS HkS M/L]I{H}I+EMH([]A\A]A^A_Pxu/HEL@LEM $L(A9# M;L'IH(LL[]A\A]A^A_0A˃L]MxAL}HLL=P L-m&IEP A/veH}H_H]L%j&Hc/H5II<$X-T ImuLjH=0g&H5E1H?o?P DAH}D]HINAH+ $}LHD$<Ht$H.uHmjL ImLE1OjO INAH+ $}HLI<ImeLE1jO A/v7HUHJHMLi&Hc*H5HI;WDAHUDUDAH}DULf&H5E1I8nAL}HL; O ]L IHHE1xIHt{M9HLM HbIuJIDMA/v"LUIRHUA:H([]A\A]A^A_LdEALUDMىHEuBAL]HL:MN I$;]u HI$7N ImuLhL%d&H5E1I<$m N IDUM $t9A/v}H}H_H]L'MtML-4j&IEM A/v3HUHJHMLg&Lc"H5FI;2Ut:DAHUDUDAH}DU{INAغ]HL)L9ImLE1g-M I/uLgHc&H5zE1H:lR AIL$LHL)En9I/tE1R LE1;gR AE1ELLH/9hR APHhc&H5FH8l1ZI,$tE1XLE1fHUH=FiHR [A\A^j,L2]I$Mt$S I,$tE1nLE1vf^L jh&H5+FI9{kIT gH=>i0T +#T +T 1U E1V H=u>AMyAۉ< HE1MtAOaH1XIYZHHt$HMnMfL|$`H|$pIvM~I~ Mi E1IK| IqHt EQ11E1AHHH9vSc HyE1E11DL7"MnMfHt$QAKHi H|$8E1^ Hfi H]e v&MnH|$LD$`LL$pMfI~MFMN Mh AAAAL!W HHG 4j HHJj HvHAlH]Ãk RH=77Bcj Kl Ol KH9H<+HoHkLSL(+LWHKLk Iyl H +HoHkIHYH+H_(k Lا+HoHkMXIL+L_k L+HoHkIpIH5+Hw`k H+HoHkLCLt+LGI8k Fm IbZH[]HH](Hm 1HOm X[]AI,$tE1鏗LE1^I,$tE1魗LE1^靗H|^p H$l^$p I/uLV^HmtWo HD$;^D$p 1|$ 8r LmMHmuH^I/uL^qo H]ao I/uL]Ko HD$]D$}n |$ u1'q L$]$%p HU^&H5H;bn LD$r]l$8n LLD$D$P]t$LD$n HD$LD$)]LD$D$\n H=?4J`{n I9AEN4m HmuH\I/}L\5n |$ 1o LD$\D$vn >HmuH~\I/%Ll\m EuHmn HL\n HKHmuH0\I/L\m H9H4s I,$tE1鋖1H@LE1[hHmt:1'F]H]&H HmuHHD$[HD$HHD${[HD$ݖ(H5(Hdt_H5qHdtVH5ZHdtMH5HdtDH5Hld鶖鬖颖阖鎖H V&H5DE1H9_tt`` E1֖LL$t$ILH=W&H51IQRH?Hc HXZHtHNH+t&E1郖HNV&H5E1H8L_eHE1ZUIXHt IX0t I@Hs 0H=9+]E1\u H= !_IpH1t Ip0(t 11 H*Hu HIu HG@Ht+HuHW(:vjHIxDLZ]A\H/uaYL%z*MtI$11H^*HtHIHmAuHY$ HmIu鯕HD$ XD$ 隕HD$ XD$ 鄖H5V&@ÕH=9[ZRH=8[9LL V&H5nV&y@C1~H=y/[u vu H5vW&LH6 IHt'LLH]A\A]cLH=8踱4u ,Ht%u H ET&H58H9\[]A\Hn H="0Z醖HM HV&H58H:\`Lv Y[]A\A]&HmtD1tv H H=|.1Z\v Rv I9H<u H1W(v H9H<K*\x K*\x H+tE1hHV[HE1VKfo\$1LA$A\$Mfo$$1LA$Ad$)HʝH5)1fHnLfH:"A$AD$/P1LH5hH7A$fHnfH:"AD$鵣HU霣HD$ UD$ JHD$ UD$ HH|$NOHtH|$HH]gRH1]ImtAHEHhH`I,$tE1LE1VUHEL?UHEH=6 [PH U&H5 7H92Z1ZH1]A\H5R&=H R&H57H9YHD$ TD$ LCH5HH Q&H81&=)Ht鮥HQ&H56H:Y鐥fDod$P1LAEEe%H5T H(TNfo<$1LAEA}fDoD$1LAEEE龦H=r1LfDoL$ 1LAEEM醦fDoT$01LAEEUafDo\$@1LAEE]<H=M61qbHD$ -SD$ M1LSH )P&LH5G61H9u$Hmt鹦HR驦LHHta61IaIHtHH5hL Imt-H=M&L1H55H?#:L_RH}Ht t] @t 1t SXL[H]A\A]aJ鷦LL$L|$DI)teE1 HT$DH*uHQLM&H55E1I8V I.uLQLM&H55I:V` LQS HH} LM&H55I;V- 17I LUf.Y fI~zrup%HtfE1v L I%IHuIH=M&H55H?Vv LL&H5r6E1I8Uv L̗f.Y f(zuD$_%L$HhfIn6]IDžEv LHI2v HtL {L&H55E1I9yUv $HL|_H$HDžuAH$1L9Lr HL$MQIHLTH$H=K&H55H?Tyu j$Hyw E1x E11x E11E1x HD$E11E1ux HD$E11E1HD$Vx HD$E11E1HD$HD$.x HD$E11E1HD$HD$HD$ w I/LE1Nt #HtRH$H/uNE1zt H=J&111~H$HHbu%L$Ct HK&H533H8SL٣H$I.M\$L|$GLAN{ "HuLKK&H543I;I|s HD$E11E1HD$E1HD$HD$ HD$(v HJ&H5\E1H:R!s LHHT${HHHT$|FH$IHv L=I&H50I?E1*Rr H$H/Lr HH&H50H8Qr LLTs H$H/uLI,$LL1JH$HDžu81r H$H0HDŽ$H/ML{r L1计H$dr Ht?H$H/uLA<z E1y I.LE1Ky LI&H5B1I:PLʒf.T zuD$a D$Hj=IDžLq LHI9q L=G&H5)1I?E1Pq LDIHtH"IDžp LL菠Ip HH?`AMQAUm AMH F&H5E1H9O?n ^H$HDžH$cLSm IHL?m IHH$HL\MIMuLDJI,$uL5JH-KL@Hy 1w LHHy 11JH*Hy HIy I,$tE1aLE1EQH1S} LH$L$D\$ L$RL$D\$ L$H$0{ 1} IY{ H_A&H5H8`J1| H=+hH1| 1| HHD$8HD$| HL$L$D\$ H$IRH$D\$ L$L$z IH==JH Ru:!F~ HD F߀ LEHHULI9b # Hl$E @` ~  L:- H L#DHHHw H=3A&HJH5*HP1H?z鬁 HHt$Ht$} 鉁 HE1ߙPH=*II,$tWE1BLC5H*A&IH:EH5fA&q+LE1ICL@鄚HvHR>&LH50*H81VHC5IA鉚HB鿌 H5dL $HHHH=*IEIIE1LdHH I/p LBc D$BD$ H= I~Xu IՉ 3 LD$HLHL# Av 铃 L%>&Ho)LE1I4$Hq L=,?&HMpI1H)LI7a ŋ I麉 H|$01H\$(1QLt$Lt$0L|$(D$$ILd$Lt$(|$$;}HMHHcT$$E1E1Hl$0LtHl$JlI9HLCFAMcM9ÃD$$Hl$0E1KhuIIL9|$隈 E1q Lt$Ld$LD$(u"Im LLD$@LD$ H=bHHtILHH+IuH@Mt(H5=&HMp1MH'LH6I/t?L9M LLi7tLt$Ld$HLN7uL:@I.tzE1 L6I$ID$@逍 LI.uLE1?Ӎ MLHT$L $n6L$$Lc[HT$v SHtID$8d L?錍 I,$nLE1?q ?I,$a 5 LeH}HLH|$0"?H|$0HD$(H/I,$HL$(HMH+ EPE9 H)ML+$ALD ) fE A?H5 %D[hIA@@fAHE>L<$H)IcHALDM<ŏ י L HE1HLH靖 Lo>'e>LHl$(H HHD$(A>LD$(M- )> MIH\$0LI(Dd$(MtULLD)HHtG LJ:&H1LH+*I3;I,$ L= LL\$(=L\$(H߉L$(CL@&L$(H5H1I8IH 9&HJLH1CQ {lD9D$HD9D$L-H{ H$D$D$DL$HDT$Lsh;t$h|;t$HuPLc {l|$(I|$hMLHIHC MDHxpgMHL)HHD‹L$(shALt$h Me@M EU,E M}PClHkHsh9t$L9t$H9t$h;t$Hu {XCl{Y#Lc{hHCHD|$hIL<$Ht HCHHE l LHnLIRHl$0HnHVMBLFGH|$0=H5H|$(HoHH/u]/McH )IMDLH+$AL[ fEQ A7H>%ChIAD@fAJE.LT$X I*L.E1 I(uLk.L|$(HuLL M'Ld$0IM'< H|$(8.- ALKLT$X鎡 LLL$(~ H|$(IH/u-M HkHML 1Ht$PHT$0-HT$0Ht$P H-# -I,$ G L- L*&HD$(LLH1I2L\$(L'LLL I}X 1/ H~|$0HC8fH:"{0)$Ht[fLn1ɺH|$0H$L$fL:"D$(D)$襄H|$0H/ HD$0,HD$0 H.&Mt I}XbL'&HLI2 31x ,L<$HC)IcHALDM<} 邁 R, HE, LHD$(3,Ht$( H5,&HCLH62I,$ L+ HMLaML$PMMAMHL$(HAL\$(II+uL+M9I|$LWPM4Iz)LeAP| H5>)ML+ $AL| f{| EH=h%DKhIDEAfJDXH{0LXH L=#(&HL$(1LHEIL$HI7MHT$(H*ȱ H*黱 H - *H q)ED+$ALD { Ht$0*Ht$0H.1 Hh*$ ^*H H&&HLH005 I,$uL,*H E'&HLE1H10E1H|$(H5f'Ll$0Hl$PH\$XIHH &&H@H1M\$|$`HLL WH LAsLDIDHT1LD$@AXAYLL$0I)uLa)I,$LN) I,$L3) HHL1LD$0HLL$0뛃ܿ (s L!$&HRLI0o/鱿 LL$((LL$(MQIJ8A ѡ L( L(& L( ([ w( HE_ L=~%&HOHE1HLI7I,$- L+( LHt$0L\$((L\$(Ht$0 L' H(uH'H|$0H=ޝHD$(_IHtpE1L L% $&HLI4$5.HL$(H1Ht$0HH1 H'x LL$(I9H|$0HI9^ L\'Q H|$(LT$0HT$0闻 H=wc'IH H{8HHHt@H(I '? LD$(&L$(" L& & Lk$&LI0: L:H H{8LHHD$( Ht$(AH.uHx&Ei 髷 I,$ LHD$(R&HT$(顺 I,$H\$(2 L0&% &&; LH L=#&LI79 L(&LHoLI0JϬ HHD$XL\$PLD$0%L\$PLD$0HD$XI+# LHD$PLD$0%LD$0HD$P H5!&LL1HH6[ H='&LHښH7L: L!&LL1HI0 HL$(%HL$(H) ] H|$(L$0$L$0 A@ 111LL\$(|L\$(HHGI/ LHD$0$L\$(Ht$0 $I,$ L !&H]LL\$(I1*L\$(E1HHLFIx HL$McNdLHV H=!&H7L7 L*H{(L^H L=~!&LI77Ū HT&&LHDLH0餪 L# # ALH=H)LH+4$f?t EL%shIEEAfAKErHLHHLL$0LD$('Hl$0HL$(d L|$IH'L7#&H LHI0Zߩ t "I,$ "I L"魦 ILM L"鑩 Mt I}X H %&HΗLH1(c H=^'HHK H{(Hj L=&LI75 L$&HlLI2( H-#&H$H!L$H$IML$IM_IwH H鷪 L=m"&H LI7+(鐨 H L!&LI3F5h LJ Ht$DLaF MtLI}XtEI)0 L.!# Mt I}X H=R#&H\'H7L- H54#&H\'LLL$(H6-LL$(Hզ A}0I]3q I}@Ht!IuPE1HLL "&ŽI}8Ht&IuHE1HLL o"&蘎p p [ H )ED+$ALdq L=&HLI7&HI}@Hu+ IuPHL L|$HIH$L% &HLHI4$6黦 H-!&LLT$(LT$( L鹦 HT$McH{0NdL uqAPp L-)LH+$ALErp fEhp EHU%ChIDEAfJDF ګ L=&LI72 LL%t!&HgLI4$Aƥ L I( L颥 黨 LD$(L&H LLL$0I0 %LD$(LL$0_ LHD$(_HD$(I LMB H|$(HD$09HD$0F LHD$0"HD$0 H|$(HH}m LD$0HL$(HL$(LD$0H隰 H5&H9w( H/uH}H/uH}H/uH8!IHULELD$0H8LHHLULXLL$XLPHmL\$PHhH|$X H|$PHl$0閭 LEHLD$(d HHt$0Ht$0H p I}X L LEң Ȇ LLl$PH\$(LL &MI10L\$PuI+ L鋣 H|$0L&1L\$(HWI0LHJH9 L\$(H{ HF GH )ED+$AL0Pm ! LT$0HD$(HD$(T$0} I,$uiLE 8. DI(H\$(L L鴢 H &HTLH11"関 D1Ll$0Hl$PH\$X>5 L=&LHHI7!H|$(D M\$It$@MT$H=d&AIt$hLHMHfInM MfI:"AL$MP E1y HuH=R&HHt I1l HE1耙A PH=HZþH=  H9 L)$I$fo$ L1HXE $r DFDB A AC ID9 H}HGH L!tL=&H5' LL$L\$I?H\$LL$H+u HLL$L`I.t1stL1sITIAHHHuI+uLHD$]LL$HL$HH=a&HL$I1H50 H?HL$H+.1sH.PHLL$LL$9Iu|$ HHNtIT$L &H5011I9<1rLn&HT$H1H5=I8HL$h11rD$ rqE1E111irE111]rLLLT$ LL$ELL$LT$ H \'roMrLHLT$ LL$ LL$LT$ H H\'[r3HHL$HL$E111qE111qL5&H51I>qH-&H5y1H}qL%&H531I<$q+IpE111IJqH`&H5qH:QE1N I$Z]A\I|$@tTH'HHtRHAT$@HH H &HP1H5H9LH H1 H H^ LL&H5=HD$I8I,$HD$uLHD$_Ld$ E1 L f&HPH5C1E1I9 H! HHnQ HSLMMD$HtHJAIDL&H H5n1I;D[1]A\LJHSMD$HtHZHDL%&H eH51I<$HWMD$HtHBHDH=v&H &H5X1H?u4 H1[]A\A]A^A_   z X I 6   HmuHH&H8MtQLH51 H&H:MtLH5_1 LH5y1 LH51 1Lm@HhE1I9vS  M HEPH/  E11| Hm H DD9 L&HW1E1H5cI;#b IM e I}F U E1I,$IuLfH<$H|$pL LE1 H|$`H5o' H|$`H56' L5&HT$`1H5AI>fI,$uLhDD$ADD$, D$ I,$L-'&LQH$I}IRHmuHE1<E1E1HT$`Lx1H|$`H#&H5H;H|$`H/E1 I/E1E1b H|$`AH/C9IuNE1 H= &H5ՆE1H?4 H &H5E1H:tHt$p L\$`D$y .E1 uD|$L\$`Y HmHE1L &IQ1E1H5<I8TiHt$ L &1E1HVI9H5+@H= &H5!E1H?"H &H5:E1H9E1E1E1L &Mu LE1E1,H= &H5)H?110 H=υAD D$<$2 H= H H Mt9LH5H &1H;#H|$P : l H L-L5 &LH51I>H|$P` H=+H jMt6LH5nL &H5I9,H|$PN H yL-XH|$PD, HHt$HD$AQMIt$8^_H HL$HqH3 L &H5VI8 3/ HCHPHSLMuLT$ $LT$ $IENAsD A/! HCHPHSH0MNHt$H$ MEAH=LLLHX[]A\A]A^A_ZL;-&tI]h H=L$$I$- LLH=LL;-&t?MEAY H= LLH=LkH=u L,$IEt IO D H=m: H-&H5zH}_ LLH=LaIB H<$HT$HLLL$qeL$L$H-@H=< L6 &H5L$DD$I;D DD$L$A/HCHPHSHE1 LLH=L9At;/ LCIpHsIMNHD$H I}L\$(HHT$ A H5x&H9J LT$L$L $L $L$LT$# LD$ L\$(H=ЁA1LLLT$L$L $L $L$HLT$HLXL@ L$A~# LT$(L &Ht$H5I:L$ LD$*Ht$LD$L$ LT$(M H.r E16 DAHCD tHbLLLH=( LLLH=H|$HLLLI I L5Y &H5I>jLLLH=I LL $ L $/ LLH=~LLL $L $ H-&H5H} 3 L $qL $H H=% LL $ L $$ H-{ &H5H} LLLH=I MmH A/H{L_L[L;- &Hu Az6MEL$ADHt$HL&H $HHqH $HL$HE1LAHL$McjL=t$MNEeIM*EbI]M}! 3/vFLSMBLCI}M2L $'  LL $HHfA ALS3븅D#A/L{IwHsMMMN /HKLQLSI}HH5&H9tL $L $tLL $+L $HLLH=~LDA/vHH{HwHsHH5)&I}H9tL $wL $t^L+ уHKODAH{DLL $ L $Ht5I}4I}t2ME(A8@; LLH=LE} D;f L&LLH=p}LLLH=LLH-&H5-}H} LLLH= I L$H &H5LL$H9D$D$LL$L$e/HCHpHsL;-&H1 HT$HLLT$H4$_H $LT$xYMcjH!MNA}IM*AzIMIUE H|$HLLL+I IH H|$HLLLI L $L $H ЃHC'DAH{D /H{HGHCL?LLL$f $fD$~ $LL$H~T$P fAfAO^ DA/vUH{HGHCL?I}L $#  L"L $HI9E/ σH{ YDAH{D막HC3H=&H5H$H?jL$/L[ICHCII1DAzI E1A111HL$L$HT$HHL\L$H|$HLLLI EAL{D#WLLH=zLI L $L $H E1 LLH=hL3AӃL[DAHCD ALC;LLH=yLL5&H5WyI>LLLH=5+I LLH=yLI}IEME LH<$:M]IEL$Mt ME(LL&L LLT$(Ht$ LL$LD$H;$HL$Lt$H\$ LT$(t#H+uHLLH=LL,$LT$(HL$ IH\$LLt${HT$Ht$HHD$LL$ HL|$(H8uH.uHT McgLcHt$L\$H$LAt$IM'AwLMD$I<$I;LD$L $IHI LL $*L $ D A/L[I{H{HD$IMNLt$I HD$H$H8LrHL93Ht$LLLL$[LL$LD$L,$L+IO;/vHCHPHSHH\$1tHC;HE1X EAL[D 8H.uH2LLH=&wL0MmLL$4Ht$ LT$8LD$(LL$Ht$L\$(HHNjT$4HL$8HHD$Ht$ !LcQLT$(LHt$ LEJILHD$DII:H|$MBH?6Dt$(LL$LD$ EIH<$HYIHH-F&H5uH}VLLLH=4HL$LcLM9|XHt$LLLL$LL$LD$H.uHH HL-%H$H511I}>" H.tHKHHl$Hc]L|$D$$E'FL/L%H5uE1I8ZH w%H5pE1H9eZH=Y%HS1E1H5H?Z跼 K ȃ`<` E1 ImM L ` | ]N$/ HuHB Iw HFH( HL\$(LD$ LT$LL$HL$H$ H$HL$LL$LT$LD$ L\$(tU}  HL\$(LD$ LT$LL$HL$H$ H$HL$LL$LT$LD$ L\$( H=%L HzH eH9\$e I8E9ft D$D HD$/HD$ZH AL9DJ AL9H 1/ H H 1]HD$HH H %H5H9. HS I H=%H5sH? H%H5sH; Hq%H5sH:o L S%H56sI9Q L5%H50sI83 H$Ll$HkIELkHufL<$ HH=ruT L%H5rI:% H%ISH5;H81a H1 H%1IHHL$H59r E1 LL$Mt&IAtL;KtHLE L%xL ~%H5I9oE1[ H@HZ[]A\A]X[]A\A]1]H{@t>H HHt(HC@HY[]H %HP1H5H9eZ1[]H=%HSH1H5H?@I,$uLHLL[]A\A]A^A_FI4$1H~I<$H LH$sH$m HH$^H$M LH$IH$C HHT$cW} HT$H?H2  11HXE $~ DGDF A ACID9  HKHAH  1WHD$ D$ uWHr 7WHz,WL%H5I8;W3WH=y%H5H?jWH=fq1\ I$LO L6%HP1H5 I8An L%H5I:AO HLH|$H/uWW1XE1W1E1E1E1WWLGAP0(H |$ 1 LM H=k%HP1H5FH?1 HMH$HQ0H$ L1E1C LM8 L=9%I?tx13 I$L/ LwH$AV0H$ L1E1 L%I;C7&H MV L HSMMMD$HtHBHDH=o%H H51H?1+ 1$ H?H]?H?H鵵H?HHHZH%H> L;%H5 nI81! H?Ht3H·# # H# H=H %1HXLLjI9$~'IHHtI|HH1$ Lף# E1JHmuHLE10GKHs:K賕KHD$ UD$ KK艕IYLE1QLHL]A\HUHD$HR0HD$$ 1$ I?LH5G\1o$ HE1$ HEH %H5HPH91:Z1]A\A]A^1IL4$) AHKA1LL)LLT$菳LL$MK,I9I?H/uRIE1.) IE1) E1AL%H5 OLT$I8&LL$AcAXAML94$tLE1( E1( LHt@1* AGRE9) ) H=-uHs(H^H) HE) H%HS(HMH5YH8H1ı1) H=al1p* L >%HH1HVH55I9腱1I* iJI,$t2E1 + H}(t-HH;%It$ * * * LHE Hp ɺI9:I(, AH, AL9@@Lk, I+ H%H5H8i+ H$;H+H$+ HH$!H$+ H=%H5ZH?"HC1k+ HֹH=MYtHsH;, 1[AG I. H=#YD. Im. LA-- ,H. HHL[]A\A]A^A_^ HR, DD9, , L}M, - Hn` HmAo/ HUHR0`/ E1X/ HR%0 AGDmD970 $0 H%0 M_LAS0L1 HHtFL=%1K1 MGt$LAP0DL$E/ 60 HML{L90 k/ 0 HC1 H=HD$HD$/ L@HAP0/ LXHAS0/ 12 1 2 HHt$菜Ht$"1 11 PH=pWPH=|WH=%H51H?%V9 7 IA@IXD7 HI H|$HHPfD$0xA D$xA H[%H5#WH;\8 LCI9 CH8 Hm8 H}8 Hmr8 He8 6 E11E1W< L5%H5]VI>58 SA B A H=:AE HHL$HL$uF LmH@I9@@xE I9VE jE H螚uF Il$HtF 1F A0HLmHL)H ID$@G MT$HE1<H @)HIOHHIO IMw(k<霎I?8IpLN`MtQItGL%LI3ef IHu gHuEHLH]A\Po HUd 1td L%HV11H5 I:Qd 1Jd 1d 1d H q%HRH51H9輟1d H-f mLE1f L%H1HI8zf I,$f LE1_f HHXH5fH=NI1HHt$H|$A1g Ah PH:%H5H:1ZHph lH=E1i Li 1j HAHH!XH5>fH=HZ1[]A\A]H}H/l *m n L%HQH5v1I84H1[]A\A]A^A_H=%HQH5I1H?m vn lm bm Xm Hmt"E1BH<BH/AHE1AHmuHE1AL 4HmIAHAHmuHL%%I$|AHoAHm\HWAHmDH?AHm,Hp'ALLH=F1ALL1AH8 BHmAH1AE13D|$ 踟Hc|$ HDH1]A\H5%DDH5%۲t HC l I1l L%LH51I8D:Ht8D8DL%LH51I:՛lDL %LH5L1I9貛ID1HHD$H|$DLL+t1l L-"%IXL5%q q A;6l H=k& l AC[A9Ml =l HH=蝹l [1]A\E1l I9AEN<DTEE1\DH-EHJDPH=]L!%H5I821@o Ǝ14o 1LAEA]GqGH5H=7b1zGH=<- IHKLEwrGfDod$ 1LAEEeGfDol$1LAEEmdGfDoL$01LAEEM?GfDoT$@fDo\$PEUE]"GfDo$1LAEEEF1LE FH)T$) $fDo4$fDo|$HHtvH{HHD)4$H53}Hmfo<$tnF1LAEA}pFH5%%H=H1LAEE}(FHfo<$냃mFEuAF=FH y%AH95FEuYLCAHMGH!GALEGH%H5IL\$H;H|$FL[%H5$I:lAE1GH5%H>GH %AH9GLT$tH|$tI,$tbAJLKLT$LT$iKHHD$H)H8Ht$HD$H~H!H|$IJLAJH{RJH%H:gJILMIL@IL3HL&LIH蘊IHHH5AHj{I.EHL8HLHLGLjGLGLFLBFLFI,$tE1mJLE1f]J1IHt8HH'{I$uHI$qJL)dJHI$tE1RJLE1BJ1*IHt8HHzI$uHI$JLtJHI$tE1bJLE1RJ=1LH5HA$fHnfH:"AD$eJH\MJH=Hj HL$H'r LL$ 虏L-gq)L)ILL|$HD$H|$H+=E1zL %H5<E1I9_Lּ%H5<I:GH=%L\$H5}H?5L\$j sL %H5<I;XLHD$˾HD$j LL$LD1M@ƐLL$Cl HT$L#HT$k =I%u9HT$l)ފHT$Hl)Ik Im l Kh L %HT$7H=I HT$%L%)%H5A;I<$k H%H5;H8k IL1mh Im}k g IpH5;vk l 菽l H=%H5H?LHD$bHD$i A1Ҿ.LL\$HHHL\$t A i L(%H5)I8)LML\$h 11p2m ATUHHHSHIHu"HtH}XuH%HSHH0sL[]A\Ãj)?DZH]A\郼H=HT$H4$ξm H4$HT$dm AC[m I,$tH=e?)H5G:E1NDL!E1EH$EH-#%HRH51H}mE1EHH=FEFH%H59H81"F1qFgF_F1XFH=>)H591ZH= H4$½H4$m H-m%H1H5qH}踌H1[]A\A]A^E1tl AC[A9Dm 4m Qm H=HT$H4$LH4$HT$uLALXE$HAP DJEH Al AGRE9l l 1EAFL %H5AI9蒿xFH=f%H58AH?sYFHW%H5AH:T:FH=^1m H|$8H >~t"H=!%HT$8H5u1H?kTv H5JVH ]aHt$8L2%DD1H5I83H$趺p L%H51I; H$茺p L ص%HL$hH1H588I9׊H$Zp H %H57H9OH$2zp ~1np H$\p p H$@p H|$8MEDKH }uL0UH C`L\$8Hҵ%HT$8H5NH81H$蟹o H %H5=-H9蔽H$wo $q n H-%H5H}XH$;o 9\$Yo Yq DL$H _LCL.H.E9ENALDE9LMH|$8H |H-%ARH5e1ASHT$HH}+H$许ZYn H=%H5(6H?衼H$脸n Hг%H5YH:yH$\n L%H5aI8QH$4|n 1n L-|SLl$8:袺CHCH5LE1H=a2AAL%M%I$AHAE1AH [%LH51H9藄AHHdz%H5HD$H:HD$HLrMPHALL.`'HL$Q1jj H HHAAL tLmALuALH=H51H=HIAHHi=H5KH=f1$1A\H h%LH5V1H9褃H芿AH=8%LH51H?t뮃AE1$BL{  H=vz{ MIl$(LM!LHHH;{ { L荱1{ LD$zD${ Il$(v~ D$,HL$ LD$H|$OH|$LD$HL$ D$,} D$ HL$LD$H|$H|$LD$HL$D$ a| H5 %H>蘅 {~ LްH~ LͰH~ P dHZL r%H5I9õHC饁 H=wjLVHr  W II鬃 IIՃ II LH=AAIL+~\Hk#BLx%H5qE1I;iAHRH5~L%1E1I:ZEAMNH5IQAL路ALˬ%H5E1I8蹴ALE1HL讣ItA1HM9AAH=v4DD$HL$t$H|$nH|$t$HL$DD$t'HGH99 H: HX H_H\ HC H=vŴH~AImuLͮH{-I,$tE1JHmuH覮LE1虮II.uL膮I/uLvI.uLfI/uLVI.uLFtI/jL/]I.SLFIm;L.Hm#HIm LЭI/L蹭HmtIH蝭IH[H HquH9j HHHH[]A\A]Hĩ%H5E1H:jJ[]A\rI,$t rE1JL H鋇 LLH]A\A].KHT$H4$H4$HT$+KH]陉H]ЬH=,x I,$tE1jLLE1褬ZLI/uL葬I.tz1^H|^LofMHb MLUMHmuHAI/t7I.uL1+z^I.uL1e^L X^LH*I,$uLZ[]A\A]A^A_H̫^q`I.`L諫`L螫j`Hl`H-%H5ֺH}蕰I,$tE1bLE1[bIDŽ$qL%H5N1I;MHD%HP1H5H;|I.uLH%1LHtH;b]I.SLFHD$诪D$aH=%H50H?谯MFAtI^`LrsbH-̦%H5[0H}tPHRH51H Z%H9{1ZCcGcEc1UcAȁC c11? Hi)HdHIdCcI,$ LHD$让HD$h HZpHX0HH H %LHHpHX8HLAIxfInI H7fI:"HIp LB順 H߉D$ 1D$ _ I,$t!1髆 L L鱆 L1邆 HELc@HDCML[XM聱IHCXICH}HCXHr  HNv 脨i Lw H%H:3Ӈ H;%H-%H} H[H;%H;|%H5eH-HDL+%I:#̇ L%H@H5_A1I:Z H %H5H9鍇 L H%I9耟y H5-N H5HG`HEH/ w鞉 HE`I) LXH} H 选 HE`H/S /I H=H͋ Hu~h Hg{H H襃霋 lN HT$Ht$H|$貕L1H1mHHt H(u蠦HVHT$Ht$H|$bM 1ċ 1齋 Imt1鲍 LHD$THD$雍 L-V1ҹLDtHu L-VHLytHuHwHs H}ڌ :Y HT$H4$HD$Ht>H $LD$A A H|$LD$H4$FeH $LD$ HD$f L %HRH5}1I9vHD$< <ADEo H;$r ! Ht$H^H' L\$I[H HDT$,LD$ HL$DL$H$dҕ H$DL$IHL$LD$ B HZDT$,@ɏ A MMH| 11Hc)H HI{ L=%H5I?蒩L LLD$ HL$DT$D $c( AE ImID $DT$@HL$LD$  A LDT$ LD$HL$D $c˔ A} IEID $HL$@@LD$DT$ Ӎ Q LDT$,HT$ LD$HL$D $2ch AE ImID $HL$@LD$HT$ DT$, A飏 <H='z1۔ bt 1Ɣ E11 HH鲕 L@0fA( L@HHxH/ Hx0L@H$_HxH^Hx0^L@0 _H轢H f HPHğ%H5eH81t1_Y[]Dh1`H=ѤuIv(LvMƖ 1 AGRE9 H H%H511H9G`L芯tMLmk`H=%H5.1H?`L`I`I`}vHtH1`Lڞ%H5{1I8ɦi`LH,H5M(1H=Y(eE`I_at&E @ 骖 HsH[]A\ҢHsH[]A\H1I H͜ H=%H5E1H?%K L設^ M\$LK1E1L%H5'IKIQI8Gr }fE1 HL$H7 I9T$u I$ @ H=:%H53H?蛥队 H%H5r'H:}Hí H]E1I 镡 HH<+E1H5&H=>'鶡 HwtH]E1Y I ^ H='111HHmIu HUHR0Mt5IL$ H=%HQ1H5xH?qI,$tE1} It$LE1V0j Lp e; L%H%H5YI<$E1U ]A\A]þFH=^Y~_[dE1 [L]A\A]A^ӈ[]A\A]A^馁H=f躤M9 l LLuHuH{0HH E1铱 AGRE9 r H=ڠtHmuHE1dV It$(LfM 1C L]%IQH51I:o1 H=%H5#H?+1 FT D! JLK<$II)MM)H9}TD$DE9HHmH& H[Hs 邵 U DD$ H $]H $DD$ t-{  HDD$ H $\H $DD$ p  E$*]E$iSD+_DkU1մ I,$uLHmt,E1]HΜ]I,$uLE1跜]HE1觜u]L %H5\|I9謡I,$ Ly{ Ll鱸 "bI,$d LO1n L@V I/> L)1H 1]HԜ%H5|#H:%蠖1LLH57#A$fInfH:"AD$]H=s#1詆]LD$ 訛D$ ]*]H=ð1t]Hw[]H="1TH=#]HH]לH=#1)M]远C]E1]E1 I/H L; H %H5 I)E1H9vٸ LݚH IH toIHt'E1騸 ImtE1ݸ LE1蚚͸ H.%HH:vr E1A]1釺 {]E1^L-X)u^`L %H5"I9U_H5z{'_H5n{^`IT$ H.%fHnIL$IT$L%HfI:"IH_fHnAT$H H fH:"A\$HO+ H=%> LHT$H4$H4$HT$I$t HmHAE˼ g X1 LPH C< A 7 B|Ҽ L5B AILL9 _ L! 114HW)Hݻ HIѻ IT$HB`H  1k H=%H5l!H?贝v H%H.HH31y o 1h PHH=p艛Zþ)H=ps_ME1MMI"__H- %H5wH}_H=)YHz)#`H͗`HHD$軗HD$`fo$$1LA$Ad$z`fo\$1LA$A\$U`H0NL LbML$A$MT$AD$aH5H1fHnLfH:"A$AD$`\L H<$yL%H5I8ԃzaLWs\1lHdVaH蔖aL臖`1II#bE1bH%LH5H81gA3b\A%b1~cH5%H>葥1hcH! L %H5I90 H|$H/ ޕ I,$ Lƕ H=ڒ%H5H?˚I,$޾ L蘕Ѿ 1ž 1龾 +jHuqH%H5ȬAH:|rcHObcՖXcImuL1H=%H5AH?7-cL bAcL%H5uAI8bL %H5=AI9b1$dH诔 ddH={vHD$ 芔D$ cH=2Ubd[]A\Hy%H5H8jH%H5:HD$H:MHD$dLDHYD$XfHD$`LD$@HD$ )D$0T$HT$hPLB&1LL$AQAjjH IHl$0HtKH8HdtDL$  dtWHmSLHl$Lu LmHELjL92ID$Mt$ HmdHҒdLeH=%H5cHH1IT$H?(dImuL虒HQH|$G1vdLMAAcMCHEA|$A|$HPH5HHDML$MI $LqHL%R1HVI:^_HHMHD$Hoc-1۹mH5٩H HDuHuA|$ED$H^uPEL L8MDMD$MtYI$H 5qHtaL5v%PH561SI>bZYEL ZLMDtcL LL8LH z8H듃~bF(E1FbHlbMD$Mt8I$H pHt1L%%H51I<$bbLH 7HH>H/u\H% HT%H5H:UHmt1 H1 HHD$ HD$鴹 HKH5&[1L %]HQA\I8]aHsH=%1HJH?HVH5f9aI,$tE1鹹 LE1蟏驹 uwH=%LD$PLt$HsH5M1H?MHUZYIHtH賃I,$t^E1bHM%H5E1H:KHSPbt TE1bH%H5E1H8mbLE1]bTE1b\zE1bE H=nE1bLE1OH=%H5XH?誓bHGHbLOHcLO0cLc%H5<E1I;qc!|IHtlID$H5%LBL%+ID$DUI$ET$ [cUH+L$Mt I$=c"|IHu []A\SID$H5%L͋ID$DEfED$ DMI$N$bIHL`cE1cILt|cLo McHK%Hl}H5H81^bcPH&%HH5H81^ZPH%HH5H81_^ZH=謒H=Z蠒H=Z蔒H=舒H=Ѧ|H=pH=ZdH=ZXH=ɦLHLq 輒PHHH\ 角LIE1LDH=U1~IcH=+PIUcɄc)cHcL`cHdI9$8efI|$H+_tMH|$eH5dH98e1ID$HeH|$: LE1/ eE1ILKX{fLLL$L$L$LL$H-%EfH58%LH6MyHC`Hef_HWffLH$H$4fH5cH98fHHtHxH,^t1H|$HL$HT$ Ht$(LD$HetH|$H/t3wfLL$LD$Ht$HHL$ HT$(.eLfO?fB\fAG Ia H=脌 ImtR HD$ D$ ^HuHHL[]A\A]A^A_1D 4v\ L軉鮶 H= L%H$H5 1I8[} I.uLnHmtL8L8I,$tE1X H@LE13> L G%H$1E1H5I9Z LD$ T$ 0 HHL$HT$Ht$yHHt$HT$HL$x>}  HHt$HL$HT$EHݺ HT$HL$Ht${ ĺ IR II H=OBM+ AILLLUIH I M{H錼 IIH Mt,AILLLTIHĻ I鼻 I鴻 HC@H/ ˇ dIpHHLHj M@H 11HF)H HI L%H5 I8脌E1 HT$Ht$H|$FLD$Ht$HT$t\IxHH9HNH H9 H%I9X Ax ! LLD$FLD$t I E1 IpHIPHHHL IPH訆Md螆(dHEXH/Ud肆KdI,$tE1UeLE1cEeH饁H霁E1.fE1E1#fH1g 1` ImuLLE14H|$X4H|$P4H|$H4H|$@4 I)uLЅLl$ImtuE1 I/uL謅LE1Q4 H|$ H/u茅E1 L=}%H5I?E1苊 E1HL{Mo: LE1B\ JR USQHY%HXHhcI1L;CHu 1H9k(Z[] L\{Mt$ L%%eH(3eH褄&eL%H9%LLD$H81UH|$3adHEH5HT$H8v{HT$eHsH=^%1IMLFH?H5UH1[]A\A]HL$HT$eIHmuHImtNE1z H= K赉H)uHǃ[ L $Gz $ L%*II$4 LE1萃$ L%%H5I<$蔈pI,$teLXeLKeH=r1h H=OZZ E1 DA# HD$HT$ HT$ HHT$Ht)D+A/vZHCHCHT$ H= 3 H p@v:t6LDH HH AM /wAD+? H= H* HtDA/v-HCDJH= EQA HHT$ ADEu L%%H5`I<$ou/vHC1L 踁d讁dZL[]A\A]隁1/ 1 H( l$)Vl$H2 fEE*fA(AX} H MHE1 E1 E1 E1 E1E1 E1H8AeNbE1HyfH|%Ht$XH:_eImfHRE1L 3&1LT$ ARjjH HHtnHdH|$ H|$d|$DD$AŃtKaDI>LH\Ht31藏IHeIAPeLL$ LL$E1eL{%Ht$XI8dI_a|$H#=HK\ePE111LD$ APL 2&jj'H HHcHt$ Ht$HiL fD$HHD$PLL$0H)D$ T$8T$XI,$uLpH {%Ht$XH9cIdHlodL?MdI.uL,I,$AdLdI,$zdL~mdqxIc~ D 1 H<$ 1H$HLIG IW(I_I9_uIA L$$MA dHE L}(IM!MIMI<$g L}( HE HHt$D$LT$"~LT$D$Ht$T HHt$D$L$}L$D$Ht$ 1dHt$w=Ht$KdH=D蝃H{HddHvHqdHHt$4=Ht$d1ҹHH=g~mu[1]A\5 PH vz%Hc1HZ>%HH9H57N1ZE1Ƀ|$CtI 1ALHLL$P LL$Hj IM9u\ HSH< h 1ALHLL$P LL$H IM9tCtMIr LmH HSH<tuC  H;t\C O?E1II9tP HHHI Ct J4E1AH9t' MHIM H(1[]A\A]A^A_ x;bE1bRAL9)&HHT$R1jjzH HccM9VQ _ M9VB P H=BILD$ ]{HmD$ c HD$ B{D$ N 1 H#{%H L;x%HWH5Ȗ1I8L19 HuH @HmuHzI,$tQE1 Hz HmuHz HJ: HmuHE1z LE1z 11H9)Hy HIm HH=z[A\A]>HI< H=]|uqID$L LM9Y  Lw%IU1H5GI8gKI,$ ML$LE1AQ0 L0 HL[A\A]m 'xH|$AH H胸H|$AH/ w A A Lw H5v%H_tpIt$LC1HH=?w%HNH?|HmE,  L$\w$ $ MD$HK1H5L Gt%IPI9HHm%N$$ Hv$ Hm-$,$ Hv$ WAH1L%HD$PjjuH HHE^1f^HL^HH5H=A12^H ss%HP1H5H9G1^HHD$*vHD$w^1p^HH]A\N)I!_E1_H q%H5FH9zHT$hHt$`H|$Xd1H5!%1LtHT$hHt$`H|$XH08HXI.uLuI1b+JHuD$<aHauSaHeq%H5E1H8czbH|$0LWAtnHt$hQBHD$0Ht)HLH;D$hOeL q%H5I;zE1bIHHp%H5H:yHL$0HE1H5DH={aHHH5H=YE1aL%SbH np%H5H9oyLHD$@tHD$|`L-Oq%H5jE1I}D`L-n%H5E1I}w_H=n%H5E1H?w_Ln%H5vE1I8w_T$ T$ T$H q%H5 H9a_ڃ\$i9fH|$DL1H567IHtHpuHH(uHpHm%H5H;uZcH 4l%LH9THqEI/uL`p1҃}dDHL-Ol%UH51I}AE@u EbHxbAdHl%H5 AH:udH5q%Ht$buDHubAdH=l%H5mfAH?tjdH\x?dBhmc7L5l%H5/fI>A{t,dD$  bHHQH5H=rY AcL%aH- k%H5H} tLzMI_PLA1L`%LHD$8PjjnH IH`H j%LH51H9@[L p%D$ L%lLL$EaHI2eI,$eLE1WneLkk%1H5rI8?I,$eLE1$ndI,$eLE1 nd]H _e$fHi%H8N}fP?1ZHm Hn%HXH~' H[J !o D$ mD$ Hi%H5H8rZ1[]LbMPAL %LHL$Q1jjlH HHefE1fL m#fAHuIfHj%H5cH:qfH(uHlH=Zmk1fHHD$lHD$fH Ht$lHt$ PHh%H5H8q1ZL lh%H5 I9mqgH=l%H5H?OqgB7f1g;-ff@HgH g%LH5ǎ1IH9Y=gPHg%H5GH8p1ZHh%H5H8pH1[]A\A]A^A_^8hE1hHtkh@HHhHWm%H06hlMtHSH5BL1HRv|$ ;hkIEI,$uLf H=Ŋ jS H`]Iu1HHnD. HF( 1H 1H訖IEI,$t!I} Lf4, LdfHT$Ht$(MtI,$tE1kLE14fkHg"jE1kH b%{H:tH5E1kkH54E1kkej`gjHekH!jHT$Ht$H|$TjHa%Lt4H5RLjkHD$ `eD$ kkH5L`jik#c H1a%H5HD$H:-jHD$ HT$(Ht$ H|$S}uKHmHT$(Ht$ D$ H|$Y'D$ kE1kI,$uLE1dkHHHHt H(u d fHAmMLkHu$1 lHRdkH>f%HkHmuH.d1k"dlH|$LcI,$XlLcKl1lVHI/@H_%A$H8HT$HRL\$`EMH $Ht3H}]%MH5 1H;1H 4H: + H HH$M $ȉD$M : H=qj1"c L[H ` HD$ Ht$H|$ H 1 LH= H H HH ? H=i1b LH H |#HtL\\%H5j11I80X H HID4m;H]NID$HnHID$tn1)nL%;[%H5kI<$c1 nH=[%H $H1H5~H?01mLZ%D1H5ajI8/1mAu=E9|$ HEH4$HnHZ%H5j1H;/1{mLZ%H5niI;6c1^mImuL^1HmHZZ%H5iH:c1+mH=Z%H5hH;b1mH Z%H5mH9b1lH>H/u]I$AnLY%H59I:bHmtE1nHE1Q]nHmnHmuHE1)]ntLH4HmIuH]MtIuI} uImHuL\HmlH{HWEt?L d\%H1HI9atHm0HE1\mLY%1H5lI8-HmHY\mH}HmH}HmH:2mHHA7mH=/X%H5PH?0a1mHHD$[HD$m1mI,$ID$(tE14nLE1[$n]Lf nL[FoH=W%H5FE1H?`I/t1韉LHD$l[HD$鈉LHD$U[HD$q{Hmt1jHD$ ,[D$ UHH [>H~HH~HHt$H|$H$kHt$H$F |LcZ%H5܁I8_H|$H/t)A׊HH$hHt$H$&{ZA驊HH$OHD$HHtH$H1HcH9}LHO@LHÃI,$tE1ҋLE1Z‹t H~H;-[%I$闋H\%H5?E1H;^yI|$`H]IHtIct$\H9|gLH HHhLH[]A\A]A^\I|$`HH>I|$8H-hV%H5E1H}U^H=9\%H5`E1H?7^ԊIH5V%H9t IAt[HuHLe(Ht$>L T%H5I9]H;Ht HH/tE1XE1Lt$1HLB0u@Ht$ H|$QLHeHHtHJLb HL$鴋L%[%`H=WU%LL1H5E1H?)镋~7H=V%HH5C9H HEH51AH?d)pH=]H_HHuLY[A\qI<$E1GLHE1H5H=cl"L'V%H5I:\Am HV%H51H:(AL A  HU%H5H8>\A# A  LU%H5I;\A A LU%H5I8[A HU%LDLH\$LL$IHl$\KI D$1 1Ã@à z+HA<$Z1[]A\A]A^A_H=ID$H A$LJ. LJ  LHIHu$LnHHl LE1( p H2H HX%H=RE1H )"_H*H֌HR%H5QH8Z黌HֹH=kE1LHTH5H=j1ɍLbtLc阍ImhLLHEHHmHTyH5\R%<3HHR%LH5[H=CHRi1HHHD$HD$AF(1ݍQHYp韎HӉ=tHAHAԸvHӉ=t&HAHAHAԸBHHt$HH=@*HHH}H L%P%I$ LS= LGH5UHD|$ JD|$ &H5KHD|$  H5HaD|$  H5H@D|$ ÏLH Q%$1HH5H9m$HD<$ɍHI1҅uH߉$D<$餍L5Q%$H5H1I>$$H< 鰎A-郎HLN%HP1H5|I:#LDqH=-|pU+Ixl H|$@^IxHt$ Lc HE19HH\$@ HSPjAH|$9CZYH|$uRHCH <#u(ACI < u ACI A$LT LL$$LA$SA<$u4|$,H|$@芘MxHT$ LDc H|$@dH|$ MxDLby A$LQ A$ HAPA$' H5HG HAPA$AD$$ E1r "?HHuHA$A LT$HH|$@L9T$Ps.H|$PIHIL|$@EI_H|$Py IJ D $O ILLL$H1ZD $HHD$@uA$P Ix@" A$HIJ Ht$  E< A$H|$@E1זHoJV LE1% L5R%$H=yIXH=lL$HL#LMT$fMnfM:"ML[ DK HH'HC( v MtL)4$fo4$HH3HHxfHnfH:"{! H;DHH5C( C( bE1}IHuH >B%LH5,o1H9*PH=mxH:IULbLc L5E%H= oIK  IEHc MhLcHT$xIM~A/*r 1韈HD%鏈HT$Ht$H|$H|$Ht$HT$ 19 LMA{ LFHHLHD$hHt$hIH. HA 1E1=16 L  I/uLRAI,$ LE1Hr L-3=%EsDI}A]w H5;n1Y Hl$@M H5;n1d9 Hw iL%b>%HI<$I.c LE1@V LM@| E1 6 , "     A  LQHLT$Lt$E46 EuVE|$HQHLAHD\ACJI9uLW LnHLbLgE| E|$HQHLXHD\ACI9uLW| HFH AEMMDA<]= { |$Lt-HD\DASI9uLW I9HD\qFD؃{fuHw+ |$LHD\,ASI9uLW I9t(HD\rD؃{fuHw Hw LW EtzMMDfA HpHLLgD,E)M9aHW AtOEtnLnH@tLn0HBE|HG_ |$ELT$ELDT$E4 Et%L~H@tL~0LrELW0A@t:E L/ HH DAHI|HIH K,S(Is{>IGH HL Mk0L[ HHT$K|3{HH_ HK HIB|1HA KHT$ H1IH L|$ KqHcHk0LHs ) HH HL?P IcHIH E1E1L|$ E9uH~McIk0IuPf>2tAArLDT$( H LcL$MKDA1b{H[ f; E1@ KHH5"H1H~9:{H0%H5H88Z[]&E1 []A\D-HH9S{u{PH= l6HZH[]PH=~ I61ZLBA y H0%H58cH:7 HB X LcLMk0M] I{|yHHg 4 L.%Dx1H5eI;D1- L=.%H5W1I?1  E1| L5.%HH5d1I>1 E1  HcLL1跑1 HdLL1蜑1 D$v" L%<.%H55d1I<$B1y H4bHL1W1^ HLL1<1C L=-%HSH5c1I?1  L--%H5|d1I}1 HHL1ސ1 L-%IQ8H5I1I;1 HaLL1蠐1 L-J-%H1H5I}M1 L%'-%AMH5Tc1I<$)1` LH0b1A1H HaHL1&1- HaHL1 1 $ Hd! CHH H!aHL1ԏ1 L=~,%H5b1I?1 G4yH|$H|$Sx1FyLgH_x{(DK,Ht$ A^Ev|$(LDL$0X4HL$ ALQt$8DVDL$8H+A[[I+ E1& HdHL1 E1& HWLH+%H5E1H81X& 0HHLH14 E1/& H-d+%1E1H5H}d & .z4 L-6+%A1E1H5QI}5% H4$H]bL1E1H% L-*%H5b1E1I}% H3 L%*%H5-1I<$E1q% E1i% I( H( HbLL1ÍE17% I,$W) LE1-% H=)%H/H9hX.) Hx`#) HT$XHt$PH|$HH|$X^H|$HH/t2HL$PL1LHa:H|$PH/$ v-$ l-1Hh-%1A7 H=_bHl$@}0zH1/%H5Hl$@H:=2zH=$bHl$@B0~zH|$HHa1Hl$@蒌^zHl$@TzIzH=aHl$@/0zH=aHl$@/zAH|$HH $迿H $iwH)Hl$@yH\,yHl$@yHWxHl$@y11HD$&,D$7 HHT$H$ ,H $HT$8 L)%H5"I818 H{8 HSH58 8 LW8 HSL+Hz7 w8 LHT$H $ z8 H $HT$7 L5^ALHjH5L)@G8 L+IMG7 HEKzH}Ht-HU H9u.HEHEHH1]A\A]HE HEHEH=(t=H5(H}Ht$Ht$x7HA8 I,$uL*1J8 H={HP(HuHH8 ΋t$LHD$8'=HD$PHvH|$t.|$ t'D$(H|$HH|$PHt |$(3E1(: M]HA ImuL)H<$t|$8t H<$H|$t|$ tI}HH MUHLT$@: I}HyI H=o/D$H}8 E1E1? D$LG HLH)HHHxH詢HxL E1LG D$(D$ D$8? M? |$ tH|$H$+H$Dl$8LHD$D;H$HDH;HT$HHD$D$(D$ H|$L\$L\$H HLH)HHHxDHD\$S@H8D$(MD$ D$8> t$HL\$ ;L\$ HHD$jLILSLL$HT$|$(L\$0 ^_HHD$XHD$ D D$ bC E17 D$(HD$8aC t$@HHT$IHt,DT$8D$(D$ L\$DT$4D$8FC D$(D$ I}HuI}HH4/b|= NF MpHC MpHC HD\$HF HuHHt$A L5(%H5I>,MMHLL$PC LsI$M6 11H(IHH = HD$ &D$ sG HH 1H HxM AG AAAD9G 1H MwH/I HmHL L-#%HP1H5[I;xrH HUK G HHD$%Hl$HL H!%H5[H8*1`M H=[w+L "%HS11H5[I9N HHN }N H=r"%L@11IL$HSH5\H?N H6!%H5\H87*1N H|$H/t E1uH|$H/u$E1u$E1tuL9!%H51E1I::QuH|$H/u$1N H !%HP1H5[H9HmuHs$l$;O H|$H/uW$HM$N H|$H/u8$둃?wH/wH5L uRH5̒L u?H5L u,H$H5L uHsHHuO LHHL1RN H%H<$H5ZH:(H$,wHm#1wwHg%H5H:h(1O HJ%H5ZH8K(H>x1xE18I,$tE1)"{LE1"L-(yH%H4$H5rZH:'H$ O E1E1魁E1E1颁E1隁E1FHD$E1E1~L %H<$H=ZI1^ 送E1WE1HT%H5=ZH8U'1ifDod$@1LAEEeH"fo<$1LAEA}߃fDoD$1LAEEE麃L!EfDoL$ 1LAEEM鈃fDoT$01LAEEUcLU!鞂fDo\$P1LAEE]1L%2L5EZLfInAEfI:"AUH1E1 1顅LEH=YH/2AMHLMMxH<$H H<$cLUH=YH1AMZL]M:H<$Hn H<$%H] ӄH=QYH1AH7 &H=+YH1AلL 鏃H=YH^1A鳄HHUH=XH41AHBHEH}H<$HH<$hH=XH0AOH=XH0A6HnHaH=UXH0E1E1A E1&M HE1%M LA%1LH]XI:$u-HuHt?H}(jHmIL HL HmM HE1L H=m!%H<$H=%H5XH?#H$JN H%H5XH8#1-N Ht%H5XH:u#1N 1鑄H=p$LW0sN LWHjN Ht$H<$t%H<$Ht$G ``M N 1HLLH Y1}1锆|$(u]HLLHMcAKD(Ht$HLH1=}1KLLHX1"}10|$,tH%XLL1}1HBXLL1|1|$,t8HWLL1|1хf>P~A҄HWLL1|1际H|$ t61E1E1f>Pu~AAH0D9u逄1[H1E11f9PHu yuAH09uKLI EA0fASt"fA9tfA5t̓Lv AF0f=SuNH L1{11L^ Ek0fASt@fA;GfA5<8fA>1f5@@@HVVL1d{1r1ZH%H<$H5GWH: H$L I魇E1L HiL Hm%H<$H5"WH:j H$҉|$IzHL\$ HL$aHyDD$Iw HL$L\$ APUMueHx8HL$,DT$(HT$ L\$LD$aIH(LD$L\$HT$ DT$(L$,fHVL1Oz1|HVLH14z1aHT$HՅ?L HT$L LHW1z1E1<EM鉌IyLT$H`HT$HBHT$HA9UM] HcLT$ HyLMIE`HCHtcEMUHLHOV1hy1RLLHV1My17L=%H5fV1I?11EM鶋EM魋I(uLNI,$uL?HT$H HL$HH H|$ HL1D$,LD$LD$D$,H.H霐钐H.uHI,$oLbE11XH|$H|$ 3H+L#1nH|$0H/XH=l%H5jH?]L0YI~M6"H8%H5UH8)I/t@E1LI/uLI.ALLE1tHmt01駐H|$H|$ AH9L12Ht1oLe+HXJ1鷁HP%H<$H5qH:MH$I 1頑HCH 2%H5CTHPH91}-:H%H<$H58H:H$鰒H-%H}]t'It$HS1IMH}LFHRH5TI,$tE1LE1xВL$M^ H|$IDL$HT$!]L$HT$H|$DL$I1ѓHSL1u1鹓E1E1鄕E1W1鬕1饕H%H<$H5SH:H$H%H5SH81鱖HUD$ HR0D$ ΖH %H<$H5SH9H$vHu%H5SH8v1YE1鑗H P%H<$H5SH9MH$鴘H-%H5SH8.1闘HH-i&HAąt0H%H8{ϘHkHHuA鶘H雘H%AH:鑘H%H5OSH:1H%H5ZSH81ߘ1HD1s1 H H%H5ISH9I1ʚH+%H5tSH8,1魚H%H57SH:1鐚Z[A\H%H4$H5VSH:H$4HWH=%H5.1H?!1TH%HWH5H8111"HsL%Z%I$bYLL1A\A]D$L$HM1鼛D$D$HMtI1F Mt!I1F 1F 1F HF 1E L % uE MtI1E L %ZE 1E <0tL %CE MtJI1E DIHyAAXu4qL x%HA<1E MI81WE 1PE L H%HD <0L 1%D HE th=E tx/E L %D <0t L %D AHyF Il$LE1U0UF H=!K uQH}LS LgXM9E ;F LF XF HrHH1[H=Z]A\A]4F HH=_[]A\A]LH[蓽HHuE11HKSUD$ D$ (d I,$\d LE1d LD$ D$ d 1D t#H $HH5ј1H9Lc@\HxH餬HxH雬Lo1HcMua E1b {HO+a DKHAIa H5@tHL$L1I;rD}1}^ SHJ3^ ItH] t6Aif DKHAI ^ KHI^ E1i DSHAJ] {HO] DSHAJ] 1Na {HO] sHN] DSHAJ] E1a DkHAM] DKHAI] {HO}] 1a D[HAKi] KHI^] D{HAOQ] SHJF] sHN;] kHM0] DSHAJ#] H5w=tGL=$L1I?wEAEWl ImLE1Yk LE1Ik M^Hk M]HA_\l M]H@tM]0@tMUH@tMU0fA_2l MUHHN$H57E1H;\j I$Mj ΃@t@AAEk ~k HV0El It$J@tIt$2f>_j I\$InI|$.@/L<fB_yi ~_oi I\$Ho|_H<i LFMEHtj %j I|$FMEHWj M\$DfH(uHlH=]51զHHD$LHD$龦PHJ$H5yH8K1Z1PH=NZHD$輲LT$o 1Mj HMIIIl k HQ1H&HHucl LT$(L\$8LD$0HL$ MHT$Ht$ H|$L|$(Hl$0HT$8H|LL|$LT$Ul HHLLi HmRl H%El IDHsIk Ik Pn l 1gAl$H\Al$HQAl$HFoHE1鑧NH(fHl(aH5H31fHnLfH:"A$AD$vH>]mH门mH鎨mH酨Lf1HcMt2I $H9}-ItH:t!ٸNmHE17mH3H|$hH/r r Hv 1s D$1r v H|$pH@HIHt,Ht$hHLIqHIuL9LL٘H|$hϘD$zr HmtD$1dr D$Wr H1D$@r LH5n2L $1I9=LL^#H=$H5 21H?LL9m D$1q D$1q D$1q WTq HJht Hmt+D$1q D$q LH5X1EH1 D$dq HKm D$Jq Hr D$0q H+m Hmt6D$1 q D$1p HD$(1D$p H1tD$p I.p LUp HH=n >;p HD$1HD$(D$p D$1qp E1E1L論L裖L蛖Np E1Hq Ln H?r D$1p HmtD$1o D$o H1~D$o H=H.(Ho iq HHk HmtD$1o D$o H1D$qo D$do Hn HEm D$1;o Hk Hmt)D$1o Hl D$n H1D$n Hwn D$n H]%l H+n HFn D$n D$1HD$HD$0HD$(HD$in I.t D$Vn LD$An HI!r Lr E1.1þ}H5$]r H=5Z]A\1[LH]A\Har 1HHI Es 1Es 1>s H=2tH;H/$H5-H: H1[þ H='1~1)S as Rv LE1Tt H=u$u L$H5jAI8)t Hl$(I}H5-1HUHRAt LA s S+v HFMv L$AErt H%I|$HwI;t$Et t L$H|$( s H5$ժ H=d-1H1nH+1]1VLL<H12H1#H1H1ImE1I,$uL.ImuLE1隫H1齭è1鱭LlH71镭H(1醭H1wLE15H$H5t,H:7H} Hu u E1dv (HGv H$H5n~H8y,v LI/uLALT$ML$IMHD$v I/uL HD$v Hyv I/t6H.uHH|$LL$ILuHD$Tv LH4$H4$LHD$,v KH=Pv E1v H(t(IUH=q$1E1H5M+HRH?蹲v H,HH=*P苴2v IEH &$H5+HPH91qav 触1_1脮XUL C1AE1鮮餮隮鐮醮|rI}u)I} MJI}׭֮2(1 H5j|L{yFw A#  A l L 0$DH5*1I941 w L1v ^ LH5*LHP1訜Lm v Lt$LHH $L)LD\$LD$膰trt$H $E1LD$D\$y L v$H57)1I9}1z Lq| 1HcM31H9ς ItLt 1v }t[H5*L1xu MMMQI0 LINH5)LHP1薛tLm H5I*Lwu 1y H-$H57)H}F1|u Hju A sw Lc$H5d11I8j1w I8躩IHHuI H5:(L?w u I11y H5'Lwt LH5(LHP1螚Lm HI H $H5)H9]1t H5yLvt .H#$H5d)H:$Hmt/HD$H|$(H/uH|$ H/1, HHD$L-{HLk H|$(H/uHD$HD$ބ H|$(H/t6H|$ H/tev RLE1膅L>達 LE1nL&i L馗 LE1 L L LE1,L' Lg韗 E1鐬 L(ITMsM@ I>6 1H5$LJ }L/ LiH @t6tPLIH@tLI0A9*A HuLk  +t LYH@tLY0fA;*A LIHLYHH(LH5#[]A\A]A^A_oI.La 1鱞 H(LH5"[]A\A]A^A_nH(LH5q[]A\A]A^A_nL I.uLH(LH5[]A\A]A^A_pnE1$ DE8e 1# Ax LE1eL` L| LZ L%$H5?I<$E1 LM\$2  L\$1L H|$ H|$H/tHm H I.tz鲹 H|$H/uI}HtIEH/u~ I}HtIEH/uZ IcH= *HHH L}0 Hmt1HD$ [D$ 1齦HmuH1 H9y H$H5H81` PH$H:1Z~H[HHHt$H<$HxHt$H<$H鍵I@pLHtHxuH=H$H=Y\$H]芶1 L@0 L@H Ht$H<$sH<$Ht$u1a Hx0/V HxHHh H$H5AH: HH|$H|$HHD$ HWD$  1IH<$I|$PHI|$pILU8IIzH<$HpHAVAHL($AWH1DD$H5-I;MH=?gHG H; H錵1鋶I.t1ELD$D$0H$H銹LD$ [D$ 鮹1nLw1wH81[]A\A]A^A_1ڻI.uLEM8DL$$?H5$KI+uLHR1鞾H+t5ICL߉D$D$H*uHIHI1LLI*wHHL$H<$4iH<$HL$51rHD`HmuH+1JL謾I$W ID$I,$uLX[A\鮍  1:IHm H Lڈn H<HIHtHEMLl$ :> 11LD$=LD$HHx(~ HIr Hu0 IPH HmH IxH* 轆o . L$H5dI8E1 HuH HuH MPHf IP0~ M`0 LM0 LMH M`H Ht I PE1L.&11HHD$PjjH HH H={$HV1H56H?Ɨ1 H Hh H A$H5H921 HHD$HT$* PH=$H5H?1ZHLμMuIM L IMuLI,$tE1 E1O LE1zg HLjMUuQIMU LL LHzHI>uL I,$tcE1 IMUuLHLHD$(Ht$(uH.8 H+ H.'HLE1 LLL$8LL$8 I(MuL~I,$toE1a HLdL]u@IL]Z HFM ImMuL/I,$E1 IL]uH LE1 LHT$0LL$(LL$(HT$0 I(uLI,$tsE1 HL诺MlIMuLI,$tME1v Ht$ H|$L)MLIHu I|$HH|$2 LE1D1 LE14! LE1$ IPHHLLG Ht$ H|$H)H& HoMD$E1I Ls @LkHtLk0H$A L9LNI|$IHxE1H\$1LH9,$I9E\]fAH5$B<HLk @LsHtLs0L $A M9MNI|$^IH1H\$1HH9,$QI9A<H'$<:fHLkHLsHI9~.ICL}fzL$A<xIM9uIl$ tL{M9~4GD}fAwzH $B<u5IA螣HuM9uHD$H$H9Pt~LH)HI|dHHtGH $MT$IHLbA8tHL׷t>H+uHI,$LE1 M|$HHIH+uH1 Ht$ H|$ HH1 LT/ LsH LkHuLkHL$A M9MNIx`IHE1H\$1LH9,$$L9OATH'$<2HHǿ H+:H谿-I9~+IC<L$A<;IM9uIl$q tL{M9kC<L $A<9lI舡[vM9O?LK|L)QIH0H I|$HHLL9}%IC|5@xWL$A<;tVIM9uIl$ tLsM9C|5@%L$A<;I@趠uM9tLK|5L)IHH $It$HHvHLMMumIMM"LHuM9uLD$H y$I9HLIH+uH^I,$/LE1HC Mt$IHMH+sHf_2_MqM9qLK L袵u H=$H50E1H?褺q HLHD$(oHt$(uH. HT H.H=IMI L#< HI L LE1 AH5L[H6HE1rL˴ Mt$ I,$uL誴ez L蕴1 IU1LI Lp1 AɃ_HIT$LHH L1 HHD$HD$ 1鿺1鈶E1鿸1hH$ٶH8LH5[]A\A]A^A_WMHIT$LHH L1 HHD$蕳HD$ H<HL$Ht$HT$HT$Ht$HHL$IthHH0HugL ML$LUIB8At HDHuaH?1LHUHT$ I9 LHD$*tHD$ x1 I|$HLEI@8AuH\$ H=y萸IL胛 u1H5$L[ tHLX 2HHv=H5=H=m11 PLE1L\&11LHD$PjjvH IHA 11 H=$H5)H?1 HH<H5e=H=~l1 H-Э$H5)H}жZL <QLt.IM9}OHuJt>tۃuTHvLSG u1鼻tHFHtL0E1빽<E1LfLEd >L|$H5I8%1bHHL$HT$Ht$pHt$HT$HL$x>} ( HHt$HL$HT$SpV HT$HL$Ht$ = 1 H-`$H5'H}`H=G$H5&H?H1P HH):H5:H=Xg1, H=َ, 11.%Hm(H HI HjL%m(Mt I$ 11$Hm(HtHIq IL$H=$1E1H5HQH?H Ls$H5KE1I8a* 1 L- Hq$H$H$Hq$Hq$H=$HQ1H5$H?dI.LE1ϭϹuIHIuLΪ$1HVI8H5陹L $HPH5b1E1I9~}HyLu PH ĩ$1H5H9~1ZþH=t1 AD$- A 1A0CT3IuI Hm> tc H\$H{H@tH{0Ld$N$M1A LH;\$_A 1A0CTIuI$Hʨ "LD$IHH@tIH0Lt$MMLIE1A FtL;\$%A D1A0AfCTiIuIIHt$H~H;Hm H Md$Hj q tcH\$ L#E|$ A A@MD$HtMD$0Lt$ LL$HD$MN O$HmHsp LL$ MEZ A t0A@IJHtIJ0Ll$ Ht$HD$Iu HHIJHMD$HrH|$1A HHILkLD1HEA0AfA w|$@ fA- IH LT$MZH H說 H-$H5H}諯 H Hm{HD$_D$[ L|$IOHLT$E1۾ MMIMkM1I0AU w|$@ AE- ``tEHu@L9 1^ Hh(H11 Hh(H&- Hu비tQ@uELIHtLEE1HHM9MN110LFIHtL]@Hx(Hu(M9MNJѹH;L3H/- 1 {xrIM9N,H}(L0HHE(BD(1Le@0 HHHmH蕨1 HH+LmHH](ILu8HAHIHI9M|$MM9tMtLhHE8HE0LL}HtLHEHI9tPM9tUDM LeAAAtHAtIBI9H}(m@ HE(Le@HE8Le0B fB`H$ B | D$H$L$AtnA~B0D$L$PIARAY H$I~ HvHmI* H B80H$L${H F LǦ H|$pH/ 讦1) t E$ E$K L}H L]0 HmHi I. Lb LUv H$k tED $U E9EC ED$< H$ D $fE G A t[D$H$L$At|AB0$D\$PMAt~tqFH$IHl$XHD$X1HHHIHD$X ILD$X D $fD w B 0H$L$|fBK0fF\KF\ L]Hv L=8$I?yt(LMI?Mq AtB4 B 2 H$ B4C tCL- t$P.t$L-$H5BH$I}跩 H$ LU  Hu0 HuHz H$s F H$ HcH$Hm8 H+ ̖ HD$H, V> BL8fBx0fBLxH<$dc H<$G H$  H_H :H=wʦ1 A\$H$A?D`ECLFLk$DH51H$I;tb H=cjD$T HH$HYD$H$H$AHT$PH$ B  A] H$u# NL$P%4  <%A E1҃AtN<%HHrnHD$(EEHL$ Ato`HHrDHD$8EEHL$0fH$I}'* I؃L$TLD$X Au.AH$H:蟥 H$ D$` tEL_HH H$S eL H5ʢ$ kE$HHoLD$ `D$  L-R$H5sI}Rg L dQ PH,$H5 H:1ZAFHD $HHk0IN HyD $HHT1sHL1`1[H$H<$H5?H:诣H$mL~zLD$MLL$IMt+E1镮LT$ML\$IMuL=rL0eL#HmuHE1 AHmuHE1*L% $HL$I<${rL\$kICI<$H5E1HP11oE1ޭL%]$LHmuH艝Ll$ImHl$HIm LE1b闭IL|$錮HmuH:H\$L3Lt$IL3uHbIIM^0顰T$M^H鏰ImtpE1ޯu005HfBc鏯u005HfBcKyHH|$L/LCKI.uLE1肜vLuiHqHް1[HwHtvH( IHt\LHLH˰I.AGL:IFH &$H5AHPH91mmE1аAH=$H$f4ZT H$fZA H$fBB"- H+T$XIU HH$|3 H$fC\9$rHH$f4S H^xLL:  H$fG LLL$ HT$LD$LD$HT$HHQ(LL$  L $H5 I8ݟ H$4? 11HY(H HH Hx H 9 H$ H$fZ H e H$A' H$fZ nAH\H$H58H8A=Iu(_H-$鳯IU锰H=xݜIw L$H5I;螞IX H  I,$ LE1Ql HD_ HH=H86H1[]A\HmH5$H}H9t4 u+Hƃ^D$ mt$ HHH$H5H:՝LHLD LZML9 HpHL LPHLT$HH9 H HxLLHHLH9uv H|$H/tC1鎰HFt$t7L <$LH5>7IEI9/1R1F]1:H $H5H91 H PE1L_&11HD$PjjHt$(H HtH\$ D$S1 H$ H|$H;|$9 Ld$L+d$KtH51黻H5׉1騻L訄駺H$H5]{H8證1~E1g# H$H5H8舉1# HmIrHGeH=$LL1H5IH?U>H$$H5HD$H: HD$w# HHD$HD$`# 1Y# H$H5H81# FLE1HH5H=AvݼE1 ѼL%q$I$黼H=越I駼Ld$H5E1I8b鉼LHtE1H5_H=dH{?DHC7# /# LqfHD$@D$XHD$`ID$ M~)D$0T$HT$hPLAL&5%HT$R1jjH IHLl$01 II|$Ht$ :1EH5"H="xcHt$PDIRA镼H 7$H5x1H9&锼VHnAt< & % f' @I0t&f {& MWHL<i& <' LIH1GI,$t(E1# AAt&AE% LE17# % ML$HI% @t(M|$DA@tM|$,C< A" ML$.S% M|$HIIt$Hf# It$H\# F^EfA fGyIIHAtFA # GIJ# E1AtNBI wB| M9" fAA # IT$HH! I|$H" H# FNIfA wB|NHI+! ML$H% ML$H% IwH$ fAy $ H{$H5PH;#" ! 1LrAtAtqDA vL! DA wA tA t M9! M9! u! At)At2B< t!LrDWfA wB<7 ۃfB-% HD$E1$ LEHHuHLE1)L 飺NH1gLv$H5p1I8~JHt$魼HT$飼6BNHul8u6rH= u$Ht$xH?]NHImH \v$H5o1H9K~龻Ll$@FH=cIzL%z$I$Lt$H5fE1I8}ԼLH E1H5H=T蔍鯼HXw$H5H8}% LqټILifHDŽ$DŽ$HDŽ$IHD$@D$XHD$`D$ D$)$$$)D$0\$H\$hPHA1LD$APL*%jj#wH HHL$Ld$0E1˽H}HtHt$ /tIt H}Ht$/|I{m1wH s$HU8Hs8H9Y[]A\A]A^A_鳁HM Hs DD0HAH} H=&s$LH5T1H?H1 A$I6$ @!$ LH9v:;y5HA$I $ Lr$H$H5I1I;'H?& H$HLL)蠄HHtaH$LHD$0H|$IH/tGMtSIIIQ LLHl$0LL$ HT$L IH*t%Mt1p# % HD$vLL$% HvL i% H|$;H|$Ҩ1& HH/k& ua& H+H{HHl$tHRM& Hmt 1& & Hu1& 17HztHB(Hx$Hc1HAHk0Hs ʾI{LIGHu A鬾EN镾Hq$H<$H5H:zH$d1yH p$H<$H5H9yH$Hp$H5H8y1'mH#mHIMIHdAuHAuHAmHH.uHatL .H(1[]A\A]A^A_ËH5 t!H5 t H5L=IEL%r$I<$)yIMI}QTqPR/L-AmHAmHHsIIHAmHbAmHX1HHD$sHD$1HD$ sD$ sL3E1TL[]A\A]A^yLH=Cu$H5rE1H?Qx!AE111H5:YL[]A\A]A^A_t H5X1L-o$IEHu0H{0wAƅH{8 IHH}8 IHHLOwI/AuL^rImuLOrE~zHu@H{@wAƅ~aHuHH{HvAƅ~HHuPH{PvAƅ~/HuXH{XvAƅ~AL-q$EE1I/uLqyE1E1LN LF 1 'EH5L LE1E1XE1y@A{IL"Z u1H5(s$LH tHLY AAMO8MAKH2LY LLp <I~8I<I~8HD$<MHHD$@@u(H|$t |$ K\tHsLm  1.MF81Ҿ|LI@Ps# tIv8HT$1LLNpMaLfpznt3LX tH5r$L' tHLX yWLX dH3L QLSMuo\$ SLcM;}}*LD$(HL$ ALLM;}t}Q1(2L;X ME1L\$0L9|$0{LKHT$1LKtiL zHIHt$ L wl$ LHc! XIN8H|$qHQpHzLHypLsm&Mf8Ht$LMD$pIpIt$p6WW AA(Ht$ L: D$ LHcK! VHt$ L Ht$(L Dl$ LAIc YHt$ L DVLV /LwV HmtE1HE1pmpHS8Hz(H}HK8IHy0H}Hs8IH>HH}LK8IMIzH}L[8II{}HHHz}HMIHPH^AV1AUAT9HHrHE1:1E1uULHHPP"\bHfl!mH `h$H5H9aq1BHT$(Ht$ HD$.HD$Hu1H lH(uHk1HT$(Ht$ H|$ZHg$H5dH:p1HD$kD$K1H=g$H5+H?pH1[]H5sk$ZHLtg$H5I8upH \g$H5H9]pHD$ /kD$ ]H,\kHǃH/jjjHJLM1LH5H= 3{cH5L/IH Lk!Ht$ buD\$8AA@mL&LH/IHtTH+ImIuLjMt5LFHLHL$fLA1E`kE1H5 LjH|$D$jD$ L~u\1LL5? D8]bHDILEMH=l$EH ILH5%1H?uLL"L|t:H=f$L|$ ǃPLSvltS11H=8 AyxZL ~h$1HL$H5BI9dAA1H=pH|$ D$ ,D$ dH|$ D$ D$ IH|$ D$ D$ .H5X xIH*H&IHHH5fB1H=. ixLH5 2AHHtKHL$1LHD$CAiH|$hL_L ;D$ zZD8IhH=1QRE>1LLb$I8qL|$ LLAE>D$ !LztN-IwRL-@j$LH5H1I}hsHtI}H<H5L1Fsu'PH5qf$H>*'uHHHH=>fHHt H(u[fgH|$ D$ D$ 8H=1QH|$ D$ D$ H|$ H/ue1LD$ DL$ DL$eHHHh$H LH5H81rLfH!HH*HHHtHL-Kg$L9ugHmtHImL4e1bHt(3LID$dHdH=GA pH(uHdH{HHVLt$ HsH=1OH|$[H Ob$ǃPLLxHǃPH|$H b$j1H=tTL%c$1HL$H5I<$,`@DDD$"D$x*HoHa11HDŽ@$@/ts/LK\H/H%+HtSL$HL/L*LHHxDž@LLL7HuHc$H5qH8hLbLbH5e$+H=HlI,$uLbH|$ D$ /Dd$ H=e$HH=kH|$ D$ Dd$ UHbe$9H=HkI,$uLaImuLaI.uLaH|$ D$ Dd$ H d$)H=AH !kI,$uLaImuLaH|$ D$ 1Dd$ H|$ D$ Dd$ wLCajL6a9ATAUHH='SH0HtBHDHIؾHHdHHu rHAu`D[]A\H='fH| IT$MMLCHtHBHDH=]$H VH5Z1H?11 H}H}ZH[]%Y[]C^H[]JH5(b$AM9xI I AM9AAH H`$H5Y`H8d H-`$H5`H}dHC I, 1ҹHH=V[OH5ma$H`$HXAWAVAUATAUHHPILt$Ll$LLLH'H|$WLLLHGH<$uH`$HH$H4$H|$^Ht$HEtQH=^>%@yHHt$H=!>%@yHH4$H==%@yHH==%L $LD$HL$IHHuHP`$1H5#H=ny+H^$H:2t _]1H=9M%H $~D$LHt$0fH:"D$HL$@1)D$0 IH/L|$Lt$ HLl$(LLL)&LLLHFH|$(uH5_$HHt$(H|$ uH=j_$HH|$ La$I8q1H=7=HHT$Ht$ H|$(1H=/HH|$H$Ht$H|$(Hu ]H|$ Hu\H|$L!H=1GH$Ht$H|$H|${H|$qH<$hHP]A\A]A^A_HH|$ <t |$ gH1H|$H==%H]L9tHtH|$H1#L-p_$H|$IuI}TpH=1FH|$SxII}'X@PHH HtHDCmH\8H[H][1]98]1ZHJHL$HT$LHt$#_H=@s^H|$HT$Ht$LW]8LHT$CL;%^$L;%rY$@@T$  HW$H] HHD$ZHD$F LHD$ZHD$$ tSI9uSHZ$H HLT$BL;%3^$T$@L;%X$@p h jI9uHY$H LA6HZHZ[A[1 D$ p[D$ HD$ YD$ E1HU$H5E1H8^E1HU${H:tH5SE1^H5|E1^HTY1HmtE1H1YHE1!YHH=QIL!ZMt$LXHXkH5LQIH7Hmt(ImZLE1XBLXTHvX1 11H)HHL$H).HHT$HsXH)SHHS`y#XUZ[]A\A]X XXVHWFHT$H5ݻL=FT$1I?E1Q)]ZYHT$H5~H[$Ht$H29V,IHt[E1'D,HuHS$HT$H51H;(HmuHcWL LLE1{HT$Ht$H=r1$IHtLHHTI.uLWLVLVsH Z$H9|+uMI/uLVLE1E1E1iBHpLHU6IHE1E1E1X1H5LHtH5IHt$L-uS$H5E1E1I}E1\[E1gL'VZHV3WH lR$HT$H5X1H9n'wH=JR$HT$H51H?L'ULU)EAHoH|$BH|$SHNHt$H<$tH<$Ht$G @  @1HHHHNE1E1HKHkE1H5H=ki LHLIeI LR$H5KE1I8Y H HE1H5`H=jie HH$TL$( L=V$H5&I?E1Y2 H9 H H L$L1HLM_!L" HXNfo$L5'D'1MfH:fI~A9~M9IAt IcHkA-12-rH=11-;$Ht1,H\$(L1;QS1,!1HH5n8%L]H1,1,LOr1,S1u,ZHt$0HFH=1L1@,14,L1U:1H=Hl$H}Ht H=1+H=!1:MUALH=I1LNImtE1ImuLE1NLE1NHu0HH=51XHN1 H 1 L%1ҹLo> Hs H M  f H5DK$H>" O) H}@[]A\*HHH5"H=b1IHHt$<[t1Ht$HFH J$HP1H5PH9111D[]A\?HC0H/ hMv IEH& HtOHmuH7MLHIE IEH|H=4#?P 1 HC(H/ L HC H/ L HCH/l Lb 1p HC8H/ ~L HC@H/ bL HCHH/ FL HDH/ )L [HHH=[]A\A]A^A_HmtLHLX1#HKH G$H<$H5ŰH9PH$HG$H5ΰH8P11/ HEHP0  1 Lz  H iG$H<$H5H9fPH$HFG$H5H8GP1H=H$H5L RLDH5E1QH?H11 KY^t1'hH(3]IHt6H HHt&Hp H=e15LQ[H]A\EH(17'@tAttLVH@tLV0A:_ LNL@tLN4A9_ n 1& tGLFH@tLF0fA8_ L^J@tL^2fA;_0  LNHA9_ IL^HfA;_ IMXH LLZHHtMH=14LD$HK$ MXHq @t5tQMHH@tMH0A9_ V JLD$HNK$ t"MPH@tMP0fA:_  MHHMPH1% HYHHtDL13Ht$HJ$- ~H_ HFI  HFH8_ H PJHt$HJ$ H%HHUIHT$Ht$H|$q71LHaL8/uHT$Ht$H|$0-UHJ$H8tH$RjH='#H='#H='#H='Ht H'H=';H='XyHLD$\LD$IL D$ILLH5֭1II9LC$H5oII:L[H=8'IJHLD$LD$tPHC$H5H8+LZGH/H'FH'HDž H/FHE8H/FHDž H/nsFdG&[H]A\SSFIFHCPH/-FHCHH/FHǃH/^ETHKpH9KH5I$;H=!H$H5H8G1LHu2H5C$1HXH5LgH=L ~ E1H v?$H59E1H9dG1ҹHH=i92EL(>$H5VI8)GPLC$H5MI; GHZH=pG @H=GH=~GHHLHE HH$MLHmt\E1HmuHZAHmuHFAHmuH2AE1E1LA$HE1 A{L>$H5I;FIH=2 DI}I,$tHE1!H<HL$H$WPH$HL$HII*JE1LE1r@H=>AFLpLNI91L(H=cFH=/FZ[A\HH$ξI,$]L?H$H1?VAL5&1LHD$Pjj?H HHa1Hbu H{ I,$tAE1HAHH9AENLE1B?HH nHEm E'[H1]A\A]A^ |$ HmT$ 2HCH߉T$ mT$ $Hs11H[þ_H="IA1H;$H5AD$ H:CD$ rLd$Hl$ H\$(E1LHHH|$BH|$tHL$ Hqu1_UI,$tE1 LE1> RL;$H5iH1I:d1YH=V L%HL1P1HH=-1H{?$I/t.E1QI/uLE1_=;HE1O=+LE1?=1 HIT$LHH LhO H=1@ HHD$ Hw" H x7$HUH551H9 I,$tE1\LE1':LH ;7$HH511H9  1 IvH{HSLNLGHtLRAAIDL-6$H 11H5II}(  H6$H5]0H8>1]4Hu]&/HmuHg9Hp5$H5 H:q>H L@9 H -9A E1E1H|$1H|$ H|$(LLL HHD$8Hl$ 8u 1 xH5 =$H.HEH=:$H7H{HII$H;={:$L1Lk8H^8Ht$L\$L\$Ht$HHdH0HT$H|$RHHT$H|$HH4$HD$H L .$H5I961 1 H-$H<$H5H:6H$1e1^1W1P1I1B1;141-1&1111 11111111111111111111~1w1p1i1b1[1T1M1F1?18111*1#1111111111 HYHPLA1L$LHD$(Pjj/H IHL HtI! E1HD$HuXfAnfInHDŽ$Hcf:"LT$HILT$Xf֜$LH\$PI$Ld$`H\$@$f  HE1  /I HE1 LE1l LE10  LL. ]HuH H+$H5Y%E1H:3T < 7 L+$H5,%E1I8y3' H--$E1G I3 1/E12H9E) a& HK8H? HSHA Ed$IfInOlfI:"kW I LL$LkE1L;l$A}D\$WA9D$D\$IILL$LfInfI:"s H{E1H;|$sDw L/$AE1A9D$t+HIfLnfM:"DS IQ     I D\$E1D\$ HHD\$LL$LL$D\$LcEx^HHLuItKJLS$ LL$LkE1L;l$s4AuA|$D\$脲 D\$% t LSK$  HHD\$LL$HLL$D\$LcEx#LI< K\ {< I  HD\$D\$LcExHN,"& I   E1<3 HHD\$LL$LL$D\$LcEHIT* J K* HjIu HHD\$ LT$L|$RLT$LL$LcD\$ Ex*HLLuItN&IRX%   HSE% 13 E1s3 HHD\$ LL$HT$HT$LL$LcD\$ ExLI]6 K\ S6  I 1S4 HHD\$L|$wLL$D\$LcEx$HLuN,#% E1D4 E1<4 C 1HzPH9,1ZH='$H5H?/1ML'$H53I;.10Hmt1"iHuL%1HHD$)HD$E1L%$L1E1H5I8HCHVH5K'$VH{8H{PH{XH{`E]Hj%$LH5xH81n9LHIHtHHH/%$LH5Ŗ1H;3HmuH(LE1I?IHtE1H=$$LH591H?H $$LH51H9H@(L$$L1E1H5UI:eL y$$L1E1H5zI9zBHֹH=eHKHE1H5bH=<H HE1H52H=i<LLu!L%$$ALt$Lt$*L-%LHL~lxotLt$LHH\$L= L%5$$L9I,$LE1&uL% $$I$L}L%#$L&1`1= HHD$&HD$= HIT$LHH= = 1L`R1HHD$m&HD$LLH 1[]A\A]A^H=&1M> AM9AAL = L &$H5&I9"+3> L&$H5?&I:+HC1= H= .X1ltHH%AH8HЉ@@D LffM EMME A9A3AAA D *D *Y%XY%u=ZfW+H $H5דH;)-X ,HH9tHEHZ[]A\A]L-&$Hǃ׹HH=p[1]A\I,$tE1= LE12$= I,$tE1= I,$uLE1 $= LE1#{= ImuL#I,$uLE1#U= I,$tE1F= I,$uLE1#/= LE1#= HD$#D$< L~#= 1H $H5̒1H9z(HH=}H> }H> |$ Hc|$ H1H[LL]A\A]A^A_TIDHADH >MHIL D8LDHuIO,3E8Et>MtSCL3IIL@uI)IyIIIHD >E8L=uHuxIoMtCL3IIMAtM)1þH=U%1LvIHL-s)HHs)Lpb H-xs)HM$IHtcM$MuL!Ic)HHtEHHH+t^HULBHt'LEM> HHD$i!HD$> LHmt1p> LF!rH9!1T> HHD$%!HD$H=#$H5}H?(&l? H !@ HIULHH<@ LE1L? E1@ H hA LLHH;$@ H(uA H hA MtbL-$@ HD$LLHL-z$L9R@ Im@ LF HD$ @ L0 @ H9uE1HD$@ MtHcE1I HL$Ht~@ @ HHT$ H|$HHD$8HCH/uH|$@H\$@HD$8<5 H|$@D$E H,$HW HD$8IHLELD$ILEu H<$ZH|$HLd$HHD$84 H|$HH.m)LL$XMLHl)H-l)IEL} ILL$I|$HL$HT$PLHA L$$II,$uLI/uLHmuHL$M2Lt$IM2gE11E L$H5E1I;#E 1HL$8LL I/uL>L\$HLl$8HD$8L$@ HH-l)Ld$ L$XHl)H\$8Hl$`I<$L}^ HD$8IH*L5k)I.t(E1tD E1HL$ J L5i)L> H<$A LA H<$H|$@H > > I|$XHt$@M|$HD$8Ht01HL L#LD$8HD$8MD$IM9ZL $L5Hi)Hl$8IQHT$HZfHmuH"I,$uLHl$HH21H3(HH3uHImL|$8KA L>A H+uHH\$PLD$XHHL$1[ H+IMLLLL$KHt$HH.uHeHI/IHLL$$>LLt$8HD$8LE1@ 1HLh LLt$8HD$8 HHD$LL$:HH3uHI/uLH=$H5YE1H?>@ L2H$LLH5H81@ H w$HRH541H9@ L%$T@ HHD$!HD$H-0$IPH51IH}sE IE E1MH AWAVAUATIH=USQH=2HHtHHuE1HIHxLHIHHuHT$LHE1~*uM9tHHLHHt1L1VIHu*HG$H8kIL=$%HLH*IuL3IZL[]A\A]A^A_Ã1H $DH5B1E1H90HH=U { tHH{PtAH{H1HxHH+S@I)H{ I4!H"_1҃{$tH{`u1RE1H5H$H5 E1H:iuH[{H-${H}t2H5pE1,H$H5:E1H;H59E1HYHumE1Imt:E1uH@$H5!H8ALE1"cH $LE13H$E1H|$PE1"!H(uHH=e1JHHD$HD$3I,$uLY[]A\A]E1M I.P LE1oM T 1T 1PHw111111111111Lu!L%O$AHT$nHT$L-V%LHLDWtHT$LHH\$HT$( L%$L9I,$HT$LHT$E1HT$L%$I$LLHT$HT$L%$1AVAUIպATUSH1Hn HtTLt$HILLHHtYHt$L詮 HHu 7L9l$rH1LHHXHHHH[]A\A]A^Vu H=$Y%Z1[]A\ǃxǃPAVAUATE1USHH;CHD%'E' ǃhTxh l ЉPH`E1E1%p;tt(Hc HHLpLxpH`pMt5LAՅt#_'AǃhǃPm4'E1[D]A\A]A^AVIAUAATIUH-)AQHtHHLt LHL"6AEt$LMAXLDHL]A\A]A^VZD]A\A]A^1ҹH=sQ [1]A\UHSAEuHH$t;Ht1H52H¸tH5SH]HuCLk $H5?I:lMMtLeM2LT% H3 $H5H:$E1MuL9H<IHmtE1RH EAWIHAVAAUATUSH8$HL$fHH=}HnIHHHHHHIHu>HHLlH$H5LND$D$H={IH1AHHHIuLHD$ HD$Ht<$ttL j<$GLD$HH|$.LE1UHuE1T$.;T$ALEH5HIHu)H N$H=AH qHHLy1H$H=H *6LA LIUI9t);HH; $H5H8LLLHLIIHt H5$H9pt L܉L $H5SI;&ULH$( H<$LLgH<$HItH|$tDO$LT$AE H L #~H53HqtLHx HHHu H1Q LDžxHH[]A\1ҹHH=K'1JH#}H8tH51'H51HLH5EHH[]A\A]A^A_ LAMIH#I9WL虽IHIOHL$HMcyH\$I9HDžLHLE1 HADMEI/ AAwuFA<0DOA?wjHuH111Y IH+L5yH IVHt$LIH(Av:AvjL-#DA1HH5H(H[]A\A]A^A_'H@HHHHuH|$t~H1Hm&H}Hp HD$ _D$ 6HA|$ (LLH EiL=#H{ 11I7覰HH{H(<2HHǃH/<2Hm0H#H5#H{01L1H6(H4L5i#H5 {I>j1AL LH{\tBLCPMt91H YLHZ|H5$EI,$IMME1{YAE1{XA/H5#HAHIHH=Ĕ[]A\A]A^A_9L-#H5HI}E1{YAǀ{XIL$1AL E1HAL7#H5hI88L HLD$L#H5E1I8LD$E1+LH #H5LD$E1H9LD$LM#H5cLD$E1I:LD$I(t !E1LQH h#H5cH9YI,$ L&~LnHt_HD$ D$ JHH#H5cH8,1O HxR E1Q E1Q ;R C ,AHc1L R L#IcLLC ,1LL$I2HcLt$Q HpIAL>HMP HֹH=!1]HHD$Ht$薿HuHH#H5H81H{HH|$H=ֱI,$tgE1oML%#H5eI<$E1GI,$uLE1X0I,$uLE1AL}H<LE1(11j`H3'HHE1;IHEHT$ILLAL肶HxlHLHD$=Hl$LID$HLI\$ H)Iw2A;w2A>R {P GTfA>w!fA;w'ADA^uD[EC4oZ[]HE1 HD$ D$ ,1:E1L-R_'H.#H5HH81H;5#u HH=#HIH5L1H?"1I|HtHT$HAHT$uHH?~M$1HH|$H|$tG @tHc1HH5)H1ҹHH= ~u[1]A\m[ H=#HU1H5LH?ZI.t@E1&L#HU1ILH5LI;*I.uLE1LE1MNI4MI.uLiHZLPALOf%LHL$Q1jjH HH.RL-?#HU1ILH5t*HZ Z ŸHu [H]A\[1]A\H#H5H:1HPALT$1HD$Pjj H HH1HYHHHD$HL$.HuH]HA1Ҿ\LE1՞HALHD$;Lt$vI,$uL"LE1觍WLD$(D$(HmkHHD$Lt$ H߉D$D$eHHmuHL7I,$LE1LLD$(sD$(EH|$@"E1E1LAL4IGIOH9vE1H9v-Vfzw#H=#DBAf_AE E1H9s(6fzwH#f_AD A9AAI;wf>  IOMoHL$I9D$L9wkE1H;t$Dl$E1E1EMoIWLl$L9E1H9mD$H;t$ 1D;t$lDnLD$(Ht$ DHt$ D$L%LD$(]DHt$ LD$(L$A9t7HD^LL97DAw L ն#GE9uVHnLL935u)HnLL93\5tHI.LE1褳HL$蓳L$HmWHwwL[fHnLsfI:"MsA^HmuHFI,$LE100HE1 H.t.I.tfI*uLI/LE1HL$۲L$I/uLDzI.uL蹲Hm*LL$蝲L$I|$@HI,$uH<$LwH<$`LLLL|$ H3IH9t Zt'I@HI/&H<$L(H<$HT$H|$(LZHI~Z1[]PH=ZMHHMH0IPH}11(Hp'HHIAf 1HLD$(HL$ L\$LT$Ht$!Ht$LT$fvHL\$HL$ LD$(( HL9 M C L9 HL9 M C $fvHuLL $L $uHMMI Hk1LHH+Ht fvL $M~MIMIE HL96 = HUHL9 LaIPHA1L9$HD$Pjj8H HHE1LImuL蹯LE1>sXHmuH蚯H$药$&L}MyIL-M#L9GLl7LIH HI/HHILeH $I|$L9L H $u{LH $H $HHt$HH $蝔HmH $It1IH $\HH $IIHHD$聮LD$H $H#H50E1H:}IULH$=H $ ߂HNHH6#H5פE1H;$L-ج#L{I$Mt$> AD$D$= AVT$= qsIO> D$ND$H? ? L#H5I8蔲g?  H=薰I? AHt$GA XFHIyHGtfA tfF{H#~~HMHII)LH9}sLծ#H5ZI81LcE111IE1MM)C4 tAL9tHH tc t^IM9uArLLAa~(HMHII)LH9^LLAA1AAtIAEPE1L%11HD$0Pjj2H HH{H[k|LeHH #H5^H9记1IIyHW!H2PH|#H5E1H:jHuHIL*HPAL4$1HD$PjjSH HHE1HiHL I,$tHE1XnXL軪L׉$讪$L$蛪$DH߉$航$HHD$sHt$> HuII\$HR> H> Ha#H5E1H8O= oE1< ImtNE1< 1ҹHH=ptH< B= H='#H5CWE1H?< LE1轩< H$HH1}HUHHtH@HUHHtAXH]A\H}UZ1]A\HUHH]@(D$ ӣD$ 1ҹLH=V$&E1iH\LHHu!1H'I,$uLE1˨+E1HeIHt>HL訟xQL謆ImIuL芨MxHL)I9M }HuHmHXImcL@VH5#]ILiIPLA1Lp1$HD$PjjQH IH#E1HE1nkvLHD$̧LD$9m|HuIHȤ#H5iE1H:趬.HHt$脧Ht$IHt$|HgHt$IrH c#H5E1H9Q1ҹHH=p&[1]A\{HuHX[]H|$H/t$H|$H/uզH|$%+輦H[#H8I,$t%1I,$uLHD$脦HD$LHD$mHD$I,$uLHD$OHD$I,$uLHD$1HD$dI,$uLHD$HD$F1HIT$LHH: xH#H: HHD$˥HD$l: Z1[]A\A]H(uH詥LH1]A\A]wHmIm: Lz: : D$ zH; t$ S; H k#H5 H9\1>; I: PE1L %11HD$ Pjj_H HH4; : L#L9Ut/MB L}H7B L9B C|/ B M]B HL賛? I,$tNE1? Ht$诫Ht$!B MEL9IB QB L}H? ImuLXLE1KN? LHT$9HT$A IM91@ ? L}0? LuH: IJHHHL> M= IJHH(uHۣI,$,LE1ţ> Lu @L}HtL}01߲IH1I9> L-Y#HA<MALC< yHI9uHuI9uLڢ#L9]IH)IHIuLLSL}H5MIAu)II9; 9 HLL$订LL$U9 Ht$LD$赩LD$Ht$tMEL9= ; H+tI,$LE1Y\= HLHHt$=Ht$Hq= LD> IHD$0HD$LkI9|$LI9Lk uM9~C< uLkHIuL计I,$LE1蘡< HL舘< IWHH|$(LD\$ ax7D\$ H|$(HHT$H|$IL NH5 #IOHIW LD\$ 諙D\$ HfIH`MuHH#H5H8եZ1[]Hȝ#H5iH:蹥H1]É|$ 8u|$ Hu|$ &uHc|$ HH#H5 H8pZ1[]tHH=cgI,$tH=H#'H5*E11qLH#H5H8 H1]ÉD$ t|$ Hz|$ stHc|$ HnIT$Hs1E1H=#HJHVH5~&H?qHE1'H%eILv#H5I8g> H=K#H5:H?L> L@#IQ1H5I:pI,$? LE1^> {H|$G> H=E1 0@ ssHuH ǚ#H5H9ȣI,$tE1@ LE1莞? LE1>H&:fAD$hL=k#H51I?oI,$)E1EHLL5 LIDL6#H5I:'L#H5oE1I8 L#H5E1I:EHKL ͪID#EHKLrbID EHkKL-QbIDEH?KLTIDHY L%]#H5I<$E1ZH-N#H5E1H};H=/#H5E1H?xqHL#H51I8HnyL ܙ#H5I9͡^HMJ<L-#H5-I}褡Hm/Hq"L5u#H5^I>vEH JH5BHDL-S#H5I}CEHIL-IID{L #H5AE1I9H#H5E1H:EHIH=/HD%EHxIL rIID EHILyIIDEH>ILoIDLu!A|EHIH IHDH#H5%IID$`H;;LE1 H] H ѧL{HB|$HD$HHH#LH|$H/txdLD$(IL #H5I9蝟;HvHLH=?fE1LD$:D$xD$(D$vt B|7HYtINvB|EHH$E1H5*H= ?诮HbYkIn)E1ImHImHD$ 荙D$ D$ {D$ H|$H/&^At B|B|M|$tC = E1LjFLbFH> L街I/= L菗= H=n蹚I,$uLjI/uL\I $M|$HII|$ = LH2H5= kHuLLH5= L #H$H51I9ih"H#H;uk H$H;H5?18h/16H #H5H9譛1H ?#H5H9萛1rH;C HH4`Ht)HIEQ HHD$UWHD$S H[]A\A]A^[H=##H5TH?1% L#H5/I81 HՅ} p A,!H|$KUH|$ 1=!LgH HֹH=C脅!1"L]""ImuL?H#H8蠤H{"H1#H51H:0^"D$xa$LlH|$LHP舃f$0x=$E1#LL)HD$0HHD$0&I`#Hk 0IHH'I_#1(評Aăt/LD$E )Hx#H5H:y1(hHt1(H=Z#H5#H?K1(E1)E1)HD$ HD$()H/t %);uZHՕ#H)HHD$wHt$HHtFHH]HHp葇HHD$THD$)H+#H81w)/Ym)H#HH5E1H81d)H[]A\A]A^A_XL,)H`#LH51H;d)E1)1Q*1H9D*1=*16*H|$H/t5*HD$ 辒D$ *H|$H/u襒*蘒*苒1*H|$H/utp*Mus10IHt!H@5+HB+I,$tE1+LE1#+IE*~H +#H5E1H9f+LY*H(uHّIT$H=#1E1H5)HRH?5c+H訑+.LH5 %L IHtH(uHvLnIL+ID$H z#H5HPH91b&+H#1E1E1H5H8BLE1LH+L+H+La+E11E11[]A\LՅ+deH8 H#H5(H81bu8 HH=d腀tOHM,$LLd$H$HMMx`HH5,H6,uI+,I|$Ht$_uX1<,I|$Ht$^tI|$H^uI̾LHH=#H5H?1+HuXL跏5,]dHt 3L-d#HAUxIH6,I*,H#H5~IH:肔,H(uHOLׁI+,2,H6#H5_H:4c,HHH=$#H5=1HUH?l`;,1g,H=#H5BH?1q.L ̊#H5I9͓1T.L#H5I;谓17.H#H5sH8蓓1.Lu#H5&I:v1-H X#H5H9Y1-H;#H5H:<1-LT$`bLT$`H,1-L%#H5I<$1-MJ0Mt`IyH5#LT$`LL$H9?uL\$LT$`(LLT$`譎LT$`D$NHl$_IJ8Ht"HAyHl$HL$IJ@Ht"HQHl$HL$0IJHHt"HqHl$HL$8 IJPHt#LAAHl$HL$@IJXHt"HyHl$HL$HIJ`Ht#LIAHl$HL$PIJhHt-LYAy Hl$HL$ IJpHt,HAy H|$HL$(IJxHQHL$X*HL$XHrVH5:H=ȡ觠1n+HyH5#LT$hHL$`H9WsL|$`Ht$h@LHt$`螌LT$`AbHl$P*)HgH5):H=C"1*HLT$(螘(LT$(IJp*H;H59H=؟1*)Hm;H5t9H=Ӡ貟1y*)HG;H5e9H=茟1S*)HH5V9H=f1-*HLT$ lLT$ IJhE)IxH5+#LT$hLD$`H9CrLd$`H|$hH|$`L4LT$`AMHl$(R(HyH5Lj#LT$hHL$`H9OqHt$`LT$h8HLT$`ЊLT$`8Hl$('H#H5IH;虎1 )H-#H5,H}{1)HxH5)#LT$hHD$`H9AqLt$`HT$hLHT$`2LT$`AHl$'j'IyH5Ň#LT$hLL$`H9t[pLl$`L\$huHLL\$`։LT$`AthHl$''L5#H5RI>袍1)(L=#H55I?腍1 (LT$`]LT$`HEDLT$`\LT$`Ht+H8H5p6H=1'&H8H5_6H=Ȝ1'&HmRH56H=Ý袜1i'&LT$`\\LT$`H%M%%L#H5?~I8菌1'LT$`\LT$`HNL-d#H5~I}T1&LT$`[LT$`H%LT$`[LT$`HH #H5 H9 'H=ق#HU@H5 1H?4X&HN&&PALm>$1HD$Pjj̅H HH'E1p'[HuHR'1/ ATH=|T$SQHHU#IH(t"H(H55LH_;y1/H(HuH0t"H0H55wLH;y1H0HuxH54LUx`H54LUxHH54LUx0 H54LUx&H54LUyE1LZ[A\E1&w)ٍA. @/ Hl$ 1'He'H]'Mt I}X'H\TH #LHH1w'15(7[A\A^LJL{I$Mt$0 HֹH=3itt HsH;[E1[H/t"Hm1 HHD$&HD$0 HD$HD$II1 LzI$Mt$z1 H2 Aw2 E12 rXIHuHSH π#H5 1HRH9U2 H2 HI 5 1L4 HL$$HT$ DLD$(f(4sI4 1ҹHH=2Fs2 5 HĠf([]A\A]A^pH14 H@7 LyE6 H-#H5n2E1H}<(H|$(LWLd$(x!(LMHx'LMHo'M(HD$(I,$tLd$('AA-M'HH=KbE1Hu7蒅'LL$D 1McDT$LL\$L$L$${L$HcL$HLL$L\$IDT$u^HmtuE1c'H=IʇM\$H='M\$H3'HEHƁL%}#H5I<$E1̆'Lx Hc1H9~A<A| HH聁&1ɾ0LD$HHD)DT$ILDAAHHL $HcH;Lct$LD$1HHH$MI9~ 4;@49HL Ld$(l&1EII1Hmt Ld$(M&HL$ҀL$HHD$迀Hl$H5 H}#H51H8躅1t'L}#H|$H5I:薅HD$O'L }#IPH51I9Q1,'Lb}#H5sI;S1'L5<(IRL7$1LL$AQE1jjPH HHHl$E1p(I|$H{0I,$uLE1O(PE1L77$1HL$Q1jj~H HH]'Hl$I|$H%0`DII.H=[*>IH=^*>I H=HLA\É<tP<ADE)H$LK(MM)LK()@t!@E)A))HHT$g(L%x#H51I<$K)HHt$H $yH $Ht$(L-v#H5I}|~(1p(I}HtIEH/(0y<'(H1HPAąH{@HtHC@H/uxH{HHtHCHH/uxH{`HtHC`H/A)fHC`AC@)HC`H/<)x2)HCHH/)fx )Ht$H<$LkHqHCHLHH{HB)HC@H/(x( xA)Hu#H5H8 }0)w)w)H=>}15 1I**PH5HG0H=Yx#H?|1ZHs#H5H8|1+Hhw+1+u2HHI:-)+H=v#H5WH?O|1v+LH -1d+HH=H gF5 H}HWLMu$Ls#HR1E1H5*I8BH4 L;%t#4 H u#H5&E1H9{,+PA1LD$APL'$jjuH HH+Hl$E1-,H q#Ht$HH9ZI,"@A+HHHHH9}H)A,HH95,H-,I?IA@A?M)O\KLIM9MOM)M9MO1MMLIHHL9uI@+LE1M+MuHLA@I?I1MMI9LOM9MO1M)M)L)OTO\MMHI9uMn+LA?M6]+D$ ~D$ d+HtL7III1sHHuۃ2+^HHD+u:I4 L5kI$Mt$3 10,H=&H5 %yH|$H/uitH|$H/uYtH|$H} :Hn51+I+HV59+9+H~  +Lq#H5{I; y1+Hp#H5L$H8x1k+Hp#H5$H:x1N+U }+HVH,LGa+LWDH+H+H^o#H:Gt!tU,Csh,H6s>,HuH=#N),H=xH=xH1*8HD$H$HHIHiH,1M.0yHz&HHt001,-I-LAn#I;1.E8-H=7s#H51H?C1".H hn#H5#H9iw1.UHHSHHuH~ HHu2PALL$1HD$PjjRqH HHu1H/11H="|y$Ho#H:iFtPsHs#HNZH Hu1ۀH HHt7H HxhzHas#HH[]Hr#LH5C"H81B1-1Ҿ@BAdHwM-LH=W1>H萁HvHq#H5H:v1[:&-Hul#[H84Hel#H5~H8u1C.X[]A\A]Hp.LJM.YL[]A\A]6MH}.1.HHfH5 H=_,!1.PH=Hhs1ZH/1.P H=xHCsZH=uhN01010a3IEH2IEH2@I}H@tI}0DD$A-$E12$#D$H3E1AHl$0C3ML$M+L$ I923A"3L%wzt]EgDH1t\MMH@tMM0E1A-fA9-EE@DD$1I}H A1$CC$HtMMHH=5RtL #1LD$HT$0LD$8DHL$4fIn&^LcL$0HLMH / 3E1t0 0LH/ fH=?qHE1zA0 H=qE1(0 H=q~3뽸0LL0 Hm#Hs2D|$@@ H.t$@H|$Ll$8H|$0Au< < ILML. MtL! HtH H|$(c< H|$(K HD$(K< HD$(=< LE1 LM D$ AA$D$PD<$D|$E15 LIIN HHt ,$HB Lh M91H{B HD$(H'l$ Dt$ E1Atj4 AC E15 D-7mLD$(1D5osD=mD^D\,fI*ȃ0A@\fD/w8fA(\fD/w7D9}9EYAY$D$PLD$D|$@: LD$> fD\$ E#5 |$@? 5 L1O E6 6 <$uDYlfD/\$ C Dd$PHl$(AHl$Dd$@: Hk#H5FH8.pZ1]A\PALy5$1HD$Pjj8jH HH)01m0|?HK0Hg#H5{aH:o1@0PALV5$1HD$PjjiH HHV010?Hx0Hwg#H5aH:ho1g0A G PAL(5$1HD$PjjgiH HHh010>H0H g#H5`H:n1v0HH=S=Yt!HM4$~3I|$Ht$}80161LD$ iD$ 00L*11JH{IO~LEl1H=^&H5Jn1o1AAAD1HT$DD$$ID2jLL$LDT$$H$H5VEAAj2Ht$IDLH1H$5Q2HD$H;j#L(tH{LGH$DL1Hv5 2A1H=GIskLZ]A\^HHtHv2HmIuHhIHHH5!H=#|12HHt$=u2Ht$1PH=GjHZLf#H54II8l2'd2I2E12H=mc#H5&IH?jl2'H=!GIpjm2HpH2L%i#AI<$;3I<$H5nlp3H==F jHkE 1D$fD$NE H$'6=H=(qi16HD$ LT$Mj.5L|$1E,IcH;t$HT$(LcJTHT$hMHL~1H#HULD$hEMH U*HwH1c#H5‹H817H$g6Lc|$LHuH$Ht|DŽ$D4HD$ E1`4HUu_H )HTH-b#H5 q1H}6H$f58H=oh1}5+1q5H HvFHDL;E$HLNHt,H F)L+b#t$H5p1SI;u6_AXoHQHD$xH\$Lt$hH1Ht$xLH&3Ht$hLNAH|$( ju2HML(HL%a#HT$hH5Hq1I<$5H$Xel4H HHt$ L#rH8HtH$ e4LD$xM9D$+4K|ILD$xH|$h 4L`#H5|I:hH$d3H  HvL% |$HUL-DMDL H|$MEH5'HtHL5o`#ASH1AUDD$$H5mI>4H$5dAYAZE3HHL$p'2LHoLT$@EHMAHIJMBIc]bLc2HSE9E9L%> L-CENLbL5SH5&AMcMDD;S(MMHH=_#t$H1AUH5 nH?3XZH|$H-HH16H1H$1cE2H|$XHHH]#HH{8qH{@u=LHH{8A3D[]A\H=9HC(HD [RH=8^#KH5oH{t H=aH=]#H5AXt H=aH=\#H565t H=aH=g[#H5t H=aXUHSHQ-AHtH\#H(E1HXHJ@HHHB@ZD[]H=EaMQK9<7H=+a1[]A\1.8HHD$0[HD$8kH(t LEo8H [LE^8LX#H5 E1I8`8fHEIl$ID$ AL$(@t?HHHt LЅt!H Z#I9Mt Lk8I}uH8Hu@8LHMtHAՅh8H=Z#H9}uH}P8H 8I,$ID$8tE1*8LE1 Z8H[#H57H:_?8H(H<$uH(t$t$t$t$kBL8uHLU#H8 i8B E1B Hmt:LUL{f1E E H@H=[ []A\A]A^H9Y뼾DH=8f\H9E tHHfE1f/vfW_AH|$ f/Y%!`f/DL$ XAAD$ ZufAf.AEEEt\AA~Y)ZXyYH,tuD$ =~eHPZ#H5H;a]7t 7t7ff.ztLqT#H5`I8]71ɉAA D# H1,+ k~7Ay}15X]A\mLE1W7H Z#11H1JIH7HP7H=S#HR1H5H?(I,$7LE1;We7H5?S#LtH5LE14\>7H5PzLE1\'7E17HmtE1!8HV7HV8LHD$VHD$7YuI,$tHmuHE1V7T7L|V17AtHINA2Mʉ҉@DA AtDAC f *YWEu=X7fW\v7L Q#H5I9Z^S7X]A{E1BC qp6 Ht#H4&HB LE1] C LE1M C H=[HYD$XfHD$`H|$@HD$ )D$0T$HT$hPLA1L$Hl$UjjWTH IH;7Ll$018)Hs7?A7AH-toG8_uEurL0L?P#Ht$hI8 9H7I|$HtHt$ tHt'I|$FADž6TL0^76L|0uUL 0W#L11L.H 3I9H51|%+7LQ#H5J1I:X7HH O#L11H5H95%61Al$C )D ~VA D LifHDŽ$DŽ$HDŽ$IHD$@D$XHD$`D$ D$)$$$)D$0\$H\$hPHA1LD$APL$jj6RH HHx7L$Ld$0E17H}HtHt$  tIt H}Ht$ o7I{`7H(H|$HT$Ht$WAH=3$Ht,H1H5Z3$1C`HHt Hu 1RSH=3$~HHt)1H53$1`HHt Hu Q}SHT$Ht$H|$6H(AjC V=197z1-7HQ818LQ8HN#H5H:V8Hmt18HHD$\QHD$8H=[M#H5 H?\V9HHjH5H=ue9H}^9I,$9HH==@8e9HHH5aH=eC9LD$XHt$LL +H|$IHa1?HLT$ x/LT$ <LD$XH|$LHL IH!>>IH<IH<f1H=;f9H:>Mt$H 981;;1;x;H|$(HtH/uOH|$ H|$uL|$ Hl$(HT$LHHT$>HK#H|$(H2B>Lb:HT$LH=HT$Ht$ H|$(0>HT$Ht$ 4>E1 H E1I IMLD8I0IH DxHD@HHI AG AG MIIM!M!M EEHHfAnMAI I0fA:"EfAnfA:"fl@sG 11H 'HE HHE AD AD AD E1H AH AH AH N>HH=>5>>HL[>I,$5>HHH5VH=mb>H=I#H5`H?R>HHH5$H=0Pb]>HHH5H=.bH 1[]A\ùHH=:=N>HH(H5H=aHiZtI,$6>H=H#H5H?Q?LLD$HHt$HL >LIHvDLLD$HD$/ LD$x5fo-THD$ALD$HLHHL IH&iDLaDIxHAIxHA W>1>71>Ml$Ha>LDHgYt&I,$DHHH5uH=`H 1[]A\ùHH=;DH=G#H5VH?PHHH5H=fI`E1_F EM HD$0I{M IxM 11HQ 'H@M HI4M L%=HLzD1DI,$t&E1EH5LAuAF\ELE1JEH5$LAu AA.EH5LAEHF#H5E1H:O,EHֹH=b:HE1[Mt I}Hu)It$H}HWY[]A\A],}HJhM AXH[L]A\A]m HֹH=9D EHK#HDHֹH=9DDHK#HDHH|$2H|$Hu HoN1Hþ H=SL1EDID$PH/L .IL Md$@M9+M I<$HtI$H/tIHHD$ HD$ DH1[]A\A]A^IDH%yEHHwEHH_EHG#H84t JEHC#H:pEhHFIFHC H/FBHEHH|$?9H|$HWH@HLzD#HI8'MGHH)?I1H|$H)LIH|$\H|$HI GGGHHHHGHHU1HJHMHHHHD$sGHD$jHHc1HHH0PgHI/t.I*#O L7GO LLT$%GLT$$N LLT$GLT$LFP LT$ FLT$ KS HLT$ FLT$ %S H)5S HLT$FLT$S H=gG#H5`1LT$H?LT$I/tI.ttI*ZN LnFMN LLT$\FLT$LLT$HFLT$QM I/uL0FI. N LFM LFR LLT$ELT$uH-C#H5wLT$H}JI/LT$t$I*M LEM MN L LELT$LT$ELT$M LE1<J L/ImtE1qJ LE1UEaJ LHE&K H LA#1H5H9ImuLE1E%J L-B#HV1H5HI8xImuLE1DI H=A#HQ1H5H?EI/SLDI I/uLLT$DLT$Imt!I,$t_I*LE1sDI LLT$aDLT$LRDK LEDK LL\$3DL\$K LLT$DLT$LL\$DL\$yK I9L J LLD$E1H|$H IKIV1LT$H-@#H5H}+LT$LCK H&L J H|$8H/ oC{H H@#H5$:E1H:qH]H HDC(H H7CCH HsA#L-ĵ$LHH>'G HG E1H ImLE1BG HBAN LHD$BHD$ N I/t1H*HMuVAMeBIAH<#H5aE1H:CBE1A|I*AL ;#H5^E1I9CAHD$<H|$HCH|$tH;#H8u1B?HD$HBHtDH{CHuH5:#H5VH:6CHRCLՅACHCIMH=;#H51HQH?[HCHmuH=L?1H% HHtE1R HE1WR (CHD$ ~=D$ CH;#L'CH^=ACA8C1E1LHM1MZMM,DLH$=H$DHmHHBCHuIXH=?HqLfHkI8CLH$uE1AL2Af4AB1wBM`(JCLf(CHI9CH=/#HPH5B 1E1H?CI,$uLq2HEIBH $HBCLHD$E2HD$CHHD$.2HD$CI|$CCMd$I<$FCL%3#:CH-3#Hh0#CH-3#CHHD$1HD$C CH=7Hc}iG XH[]1LoH`H H=a7t$ t$ `DE1EL-#H5I8m6E1DHS0EHSHEH[]A\HH&EHHiDH[H`DH[H EH c-#H56H9 6E1DE1FL9FLFFIFMtBAL2Ir6I):HIFTHr"HVGIFIFM)HHD$2GHnH1IPH/#H5tH8b51ZH 2#yJL%C-#ELL%7-#9LI.t2HmHt$Ld$HL1KE1LLHt$/Ht$뺉D$/D$LSKLD$/HmD$!KHD$/D$ KAM9AEN4AKHHt$Y/Ht$FH.#LH4/#Kt H#/#KH.#KH#1LLH113HHt!HtZG uuHmtz1G I.tE1G L.{G HֹH=F HmuH.1LHL12HG H=>4H1T.G HT$HT$HeK1LHT$LIVLIHtLt$HT$KHuL*#H5I83L`1KHHD$-HT$QKLCML$11L*#H5IHIQI:9LJ1-LH=W3Hh-#H.MH,#HM.Hc*#H MML-#H5I;KxM1LI9LLI9LLI9LLm.L9H)#HLI9xLLI9jLLL뎸AMH0E1E1J<~IIE91IøH<$LLL$ILt4H$I H<$L?L|$IL?u(,H$I ,H$I H<$LLD$ILu+H$[I H<$L7Lt$IL7z+H$0I E1MANH+ANH5N.#OH=B.#OL8OShRL/#11LeED, MHAAE,LVD,7 HM+ADD7L9}HHIHuF4LVH9tLF4'LfSIHOQH '#H5hE1H9/lQMHQH[]A\A]A^A_eIHO1ҹHH=u[1]A\SHn*#I H-"-#JU1HH=@WA1E`UTHULHD$6L6Hl$WL=*#M9~pXI)uL)ILV1LLLD$LD$tL1m6VLT$0Ld$@VH%#H51H;.L96V1V8I Hl+#H5pE1H8z.I LIw I E1sI IYLE1XIYHT$HE1{XLHT$HL$HD$(HL$LD$HT$[YHT$HL$wHuHL$HT$IWH%#H5iE1H:- XIWLHT$HD$p(HL$HT$^XH z%#H5E1H9h-WL='#HXHT$H0XE1YIYH r##L)L7v#MZ1ZMnL'ZIuH=$#1HVH?H5a<1_ZAHmYQHuIYH$#H5MH:,1 ZL-g)#LYIXH-S)#AIYH->)#AYH|$Z1i\C4\H|$LWHZH$HHLH+T$hH$x F A@HN HV0H|$Ht$@HLT$(7Ht$@LT$(HHt}H\$hH.[HLT$(i<$(t[HHH|$HHP LT$@HD$(Ht$(LT$@HHLT$HHD$@Ht$@LT$H6[[ƒuHN t?HVH@7.Ht$LL$0ILHt$8HT$H|$(\Ht$[HVH[H;HtHH/\H[%\HC@H/]h%]fHC`C@R]HC`H/\4%\HCHH/\%\I,$tA\L$HjLPE1L ^#1LHD$Pjj%$H HHG H H=f##H5yH?)G H #H5IH8)H 1ҹHH=~tHDH H}Ht$).H E1H Mt!L LHMH LH 1PH E1i\HtI7\E1T\HWHGH~Hu H9puH8tH HOH| GHwHH)H|1 1HHKHCH L9HIB\y'L501H L'"#H5pxI;(HCHK*I Hb#H5H;c(L/HH 1[H= %#H5H?1([AA\"7\H=#H5HD$H?'HD$\[y1y\HSi\I,$tA\jL"1H$#H=H!#1H5HCPH*]l]HC`H ]HCXH/\F"\HCPH/\*"\fCJwHjLVE1LC;#1LHD$Pjj?!H HH \hHC`H/5\!+\L#ISH51I:"\LwL%##M9M\IVtrL1HH\ urxu\H=K#LH5'1H?!\LwL% ##M9u1E1H[11\L#HRH51I8b[ up@[@ ux[qHH/{\[ W]L"#H5]I8%\Hj"#H5sH;{%HH]HL\$= HD$w]H`uHSk]HS`HHt+H)#IHHH0OI,$HuLH\H]H3-\HmuHH\LCH)1HIHcpH #H5:H91cH #H5~E1H9jcHufo8"C(cH/DHC0?Hk cHT$H5*$H|$H111贪 H|$HH/Ht{HMtQHHmAZcHMcHHuAL#DH5°1AI82cH=#H5IH?yHmt2A cHb#H5CAH:Ob%NHAbH #H5-H91cI1MbH#H5IH:1b1ҹHH=u[1]A\bLc:HdocH #H56E1H9-dPE1L|%11HD$ PjjH HHgdbHbI~cI/tI,$AdLE1cLH|$H|$6d1HH H=M\$HdLwHcddIVeL#H5@E1I;8ehFdAhFd-6hFdhFd-hHֹH=!Ai1/jHD$H|$HjHKH>H51H=+iHiH#H5 1H:i1]jHh#BjH #H5=H914jH #H5@ H91jLRE1L{%LHT$R1jjH HH0j1jPE1L{%11LHD$Pjj_H HHtLiHiH댉D$ L$ H jH:kH5#BkH]H5m#EkfAkHֹH=|4k1[HֹH=Bzi/k1[HֹH=D*k1[HD$D$= I,$G= LE1< EH[]A\A]%LE1< 11E1\ku1Pk? L!LH|$0<H|$(21? ? HĈH=[]A\A]A^A_LFHmHD$(? H1( ? > pLt$4@ L-E$LHL3Yxbk@ Lt$LHH\$L* L%#L9? I,$? LE1? L%#@ L? 1? H#H5LE1H:pG E1hG L-݋$LHLXxVwkLt$LHH\$L) L%>#L9jI,$jLE1jLk1jL%#/kLt$yjL-э$LHLWxVkLt$LHH\$La) L%#L9\kI,$2kLE1{%kLnk1-kLt$`kL%i#kE1kH Hmt*E1H H$H HH E1H HE1H HmH[]A\A]A^A_JH=ULL$LTHt1L$LIHllH$1HHrL$LL$H=WLL$L$H $Ht$HIHt$HHH $I,$L$H|$HHH|$LHL$rH+L$LL$II/MkH!kkHH[]A\A]A^A_I/kLtkHHIc]MceL IjI/BkLv5kLiH|$L$,I/kLIkH<LL$L$2LLL$L$LL$L$HD$kHD$kH5#lH #HHE lHEkHH='l3Ht&Hu8lHHH5H=J$[1]A\H=#H5H?x3l1]H=#H5H?QLl1]L%#H5I<$E1m'l\HDZ`mmHt$H<$dH<$Ht$!n;1HLGH0nHmroHeoL{XoLn)oHaoYDHH]A\IH|$H/tjE11poH|$H/upH|$H/uL11 oLE1 o E1oH#H L5#H5EI>E1E L W#H HK#K H?#gI H HE1H5H=[#:"}E HH$I L$G LY #H5E1I8GJE L-#I L-#NL HKH@E1H5H="! E LLLMH/L LH;IHrL%#toHsH5#HoL| oPE1Lp%11HD$(PjjHt$( H HHsH\$nH(uH, I,$tE1rLE1 rILuH I,$tLE1 qHmuH I,$uLE1 1rfH&sH5 #\qHL\$ L\$oL$Hg #I9SpID$IILpI(ZLN MH=b#H5E1H?PpH# oL `pL qIm'L H L #H5#H#ЀIF 1F H-#HR11H5uH}ZF E1#L9LFIcJ I)MK IRJ HHIH8J H)I-J E1E1I9}DF8LuIM9u J J I1H鈁H P#H5E1H9>PE1Lk%11HD$ PjjKH HHM.L%#H5E1I<$阂L=x#Ll#ʁHIHX#ŁH=L#雂H=@#H=4#pH=(#H=#XH=#̄H=#@H=#鴅H=#XI~u AN HH5"H9陇H HHH "H5H9wH5v#̇H=j#чH=^#I~u AN 麈H51"H9 Hf~ H HqH c"H5H9TImuL I,$;LE1 .L[H "H5E1H9PE1Loi%11HD$Pjj H HH҉L=`#H鍉>H麈L%9#1̊1HH=wlA1EL%#1鍊H-#E1鈋1HH=0&A1EtԊH-#E1闋ATSHQHw120 IHt1HSHtHs(H5#I|$tI|$(H=n#YLZ[A\H5Z#ЋH=N#ՋH=B#HHD$pHD$鋌Hu&H~Hl"H5 H8]11麌L#[]A\A]A^1ҹHH=H1[]A\ÉD$ t$ HH"H5H81~8HsHT$H=Ӵ1JՍH#HHD$鐍1鹍H=H鹍Ht$ H|$1L 1NI\$H陎IHcMd$HYIH鿏Md$H鵏Md$HrA<7{L%"H5E1I<$H(t@HX11[]A\A]A^A_- E1*L "H5ɤE1I9֐HxH-/"H5tE1H}|魐H|$}ԐHI9!IkPLD$ LD$HHD$aI/tE1鑐H="黐LzLE1HuH5 H=u|逑LHtE1H5H=P|[I"HtG1 L "H51I9Lw"{I:t$H5-1pH-<"HEϑH5{1L͑H_j1鶑HkHHjH(XN I|$H{@Y[]A\A]A^A_E1E1HYfHD$0D$HHD$PHD$ )D$ T$8T$XPAL0#HT$R1jjH IHl$ Ht0H8H# t!HI|$Ht$ 膳 1錒H1鶒H|$ $ $G H-"H5eH}Imu%LI,$uLsHD$HL$ H4L LLd$Ld$C L-{"H5eI}LLD$LD$C Mt$MIMHMK K H|$Ll$(HH$HHNDȿ$L5"H5eI> H1餒HD$1H="H5H?1[H-"H5H}鴓IH"H|$H0)t AIT$H;"3H;"&HT$(H5$L1H|$(H9EHL$E11HT$Ht$%H|$(EH/!I,$(HHuLnHI}IUHVHH/FhH|$(ILd$(11HLI,$:LH$oH$%a韒ELЬEI,$AuL:EMH5""1ɺH+ՑELD$DLHL$HT$E I,$uL1阑I,$LݐH$H$LH$H$HuH5}"1ɺH0H=z"H5)oH?{1aHYHRLE1L`%HT$(R1jj~H IHɑ1$1HT$ˬHT$HHHH5xH=5 1HPLE1L'`%11HD$(PjjHt$(H IHtH\$MH-"H5QnH}1鈑HHH5H=> 16H"H5H:_=H={"H5H?D"1ҹHH= L͒H"H5H8גH "sHő1H=k" H "H5`H91LRE1L_%LHT$R1jjH HH`1齓PE1L^%11LHD$PjjH HHtL)H="tD$ L$ HMHiHeHiHAPE1Lب$LHT$R1jjH HH1Ó1&HHtLp HSHHs8CLd x-HuDLLHmHwHYjHmuH1CTH=G"H5h1H?F7VE1L$11LHD$PjjPH HHHH yIE1w=Ht$@T$HHH"H;kI~MNHMAUAuGLfFLdIfLH)HIH|$4tL$I0Ht$HI0H|$L袲I.H$uL H<$tqHD$`D$4HD$LT$(LT$(H/tH"DH"I~LiD$4PH"H58H81ZPD‰E11HD$PQ ZY鬉1鲉HֹH=7S1镊HHHWH "BH="H5{H?!1[H鶉蘸HuH魉L"H5I811eALH飊L^"pE1锊[]A\H3HuH{t11 HonH5nH=*1飋HHHCnH5nH=Ν1w1HT$˘HT$HSH-"H5ZH}H="H5ZH?1(HH#I,$LHHmH5-sH=9dьH="H57ZH?鶌HHYH5rH='锌1I,$tjE1鹍HLLn LI<ID$H)HEIl$ P ID$(覶HzI,$uLE1cL="LE1GH"H5]E1H8)I,$tE1降H=F"xLE1v}I,$t+E1SI,$uLE1P<L5"鶍LE14 H8"H5\E1H86H"H5ܗH81ގL-"{L"1[$1^1[HmPH "H53H91Z[1]A\H5G"H9I~ِIV( ?He HϐHH b"H5H9S髐Y[]A\A]A^A_VPE1LD%11HD$ PjjPH HH&郑H"H5H;1yH錑McH "H5mH91ΒH阒H57"H9aWI~LIV( ϓHU魓HBH頓H R"H5H9CH5"H9釕I~|IV( Hݔ苳HrHДH "H5H9N1ҹHH=u[1]A\ATSHQHw1 IHtHSHs Hx LZ[A\Ht;1JHHD$7HD$HF"H5H871H•1gHHD$HD$P蔲Ht1钖H]鯕Ht$5H|$1駖HHhH5vH=s1HHt$H|$G A<$@遗I4y$IHLc4$I9C<^LISIMt^HtYHLLtFI/I.uL$C4Lg0钖LgH鉖5E1郘LU[LM[Imt!E1d_C<4\C. HILD$ tI(Lgx IpA@ Ht$ IxH@tIx0E1H\$0LALt$8MIALHEH9\$ A?A[|LLLD$HHL$@HL$@LD$HI0HAH5<HT$LbH, H\$0L|$(L|$I9AG ƒ IwH@tIw0LL$pH5(1LLL$8εLT$8LILDEAHLHL$80HL$8HH\$(I9LHL?豔tPHL|$(HHD$ LD$ tMGH@tMG0A MGHLd$(tIH@tI0_IHIwHLIHL[HH{HBE1H?~膟HaH"H5E1H8MHHD$HD$`H5"{H>tH5RWE1H5E1HL"HH"H5AH8Y1HHH7"H5VH|$H:3HD$HLGXHWHMuEHt7Ht)H=j1鴗HWHHH=a1陗H5"H"HtHtH= 1oH"H5"1ڙHH==见鿙[1H= ]A\Ȥ镚I$M1鶜L5vHI"H5dH::鎜LH=ـ Ü蚝IHH|$Ht$ 2L"H5@I8E1OE1H H@E1H52YH=fi"L "H5>E1I9HH?H5XH=&)E1鍜LLC"H5?I8DE1LH=H1黝H H&@E1H5xXH=ƝHH>H5aXE1H=顝oc)d$0$H螯&Ht$ H|$w#HD$/HD$%1c Ht$H|$$B#$ HD$< HWH=B"H5kc1H?葘I/eLE1ޠI/'LH"HMHcH81/I,$!LE1LE1H"H5t~H81HA鋤L "H5dI9pV! LmMD! 1C! HE3! I,$tE1麥E1镥LE1颥H"H5cE1H:鄥Hmt1THHD$HD$=I,$uLE1ɦL%s&MdI$ڧH=s&̧I$L%s&黧H=?[1]A\Ã钨I,$t1 H(t#HHLHD$#HD$HӃ H;";W}LL$LD$T$4$茦IHE4$UHLL$LD$ыT$LXHEHh(ImIH0L[]A\A]A^ÉӉLkJ~IHtJjćHHuCH=6ku#HH=k臢]HH)H5CH=j-ۮ1靮H=J"H5)H?K鹮H莿t&I,$HH=H5BH=jH1[]A\ùHH=}jߡt钮H=ϭ"H5~)H?жHH(H5EBH=?jqHt&I,$$HH<H5BH=j趁t蝮L%"I$LE1H|$lH|$1駶H []A\rK1鎶LgH61鏸H([]A\A]PrH|$&lH|$1aLgH˷I,$LE1RSHH=BeDҀIHu"H|$Ht$ 韻趀H5L "H51I:馻E1H|$Ht$ LD$SLȧ"H5w#I8ɰ1rHH"H59<H=deE1qIMH#H5<1H=id;&j 1d H([]A\A]A^A_pLeH Lm xD A(IpA@+r ) 11A!H j&H7 HH+ , 1"HHD$輪HD$ ]Hu?H{tFH="DH5XJ1H?|H "LH5c1H9{Z1[]A\A]A^A_Ld"H57I;eH\"H5H;MHHS H)I9IGLL"H5_I: |HH=ܙgVE1L诩=U~Hu2I4H"H5QH:衮߼A ̼HH=b]`Md$H5"I|$H9tv8umL<ƒAD$ }T$ H+H="H5 H?H(1[]A\A]HH H5m9H=Fb虽H-Х"H5qH}1黼LtM,$OLH3H5 9H=aD|11醼LH=aME1m|IHuH|$Ht$ L*"H5˞E1I83|HL"H5E1I:E1H|$Ht$ LD$鳾H"H5fH;踬E1оHHH5'8E1H= aP髾E1ɽI $HE1H57H=`"}LF"H5I8GE1 E1K H HNE1H57H=`׻p LH=` E1G HHH5`7E1H=U`艻" E1 G{IHuH|$Ht$  L"H5:E1I:臫 Lk"H5I8lE1鲾E1`H HsE1H56H=_酾LH=_E1\HH!H56E1H=_论7E1߽lzIHuH|$Ht$ ؽL"H5_E1I:謪LVHTL膍H "H1I9t Lgt-Ht$HFt+1韾LVHfCJ?%LUQ1{HHwuH,$H+l$H肨HHt@  t+LFH@tLF01H9} t2t4AHLFH1H$H=\1A8fAxL舌ܾH "H1I9t LitHt$Hw1ؾLhP1ɾHֹH=]!sE1E1eH?L'LףE16L£鲿E1!H譣騿H="H5`H?貨11HT$?YHT$HHHz.H5.H=[51nHHV.H5.H=[1JHH-+"H5H}+]1A\A]IH|$(H/uH|$ H/Ӣɢ11 HH襢KH蘢L苢H~HquHdHm]HLP1HmuH1H|$111 H|$HH/uHHLZHmuHvHmHȡHD$跡D$EHmH蛡AvHH"H5BH:蒦|He vIHtE1ZE1E1OH I"H5AH9J4]A\A]I,$uL fuHt[I,$uLHT$Ht$AH|$ŏLLHHT$Ht$H|$Cc-L覠 H=:"LH?|LaZH[]A\A]A^A_0f Hmt16HHD$NHD$L<ImuL(I,$urLhH$)D$H$foD$H$)D$H$foD$~tHuL%b"LI<${Imt5H{0Hu6H{HHCH/肟E1CLrHC0H/u]H"H5M@E1H8bHC 1HH=rZ1]A\HmHHD$HD$[HH HHCHmtnH{H HGH UsHtH "H91s H{H H{Hu Ha HT ^[]HMHL"HAS0/H*HHs"HLC0Z[]AHGHP(Hr H:vLHHu1H>HL1e1uH "H<$H5>H9财H$H"H5?H8蕢1ATUQu  H=1#IH H؀Ht%H5*HHS~ H5WLsmb H5WLWmF H5WL;m* H4Q&H5NHS HQ&H55*HR HP&H5*HR HP&H5 *HR HP&H5)HR HvP&H5)HRv HPP&H5HiRX H*P&H5)HKR: HP&H5)H-R HO&H5)HR HO&H5r)HQ HO&H5[)HQ HlO&H5G)HQ HFO&H5&)HQ H O&H5)HyQh HN&H5)H[QJ HN&H5(H=Q, HN&H5(HQ HN&H52HQ HbN&H5(HP HHJ&H5m&H1N HJ&H5W&HNHJ&H5B&HMHJ&H51&HMH`J&H5&HMH:J&H5&HMHJ&H5%H}MlHI&H5%H_MNHI&H5%HAM0HI&H5%H#MH|I&H5%HMHVI&H5%HLH0I&H5r%HLH I&H5^%HLHH&H5*HL|HH&H5*%HoL^HH&H5%HQL@HrH&H5$H3L"HLH&H5$HLH&H&H5$HKHH&H5$HKHG&H5$HKHG&H5|$HKHG&H5g$HKnHhG&H5HaKPHBG&H54$HCK2HG&H5$H%KHF&H5#HKHF&H5#HJHH&H5#HJHH&H5#HJHnF&H5QHJ~HI&H5#HqJ`HH&H5#HSJBHH&H5<#H5J$HH&H5#HJHhH&H54#HIHBH&H5"HIHH&H5"HIHG&H5"HIHG&H5"HIpHG&H5"HcIRHG&H5m"HEI4H^G&H5V"H'IH8G&H5?"H IHD&H5*"HHH|G&H5"HHHVG&H5&"HHH0G&H5!HHH G&H5!HsHbH$D&H5!HUHDH6G&H5!H7H&HG&H5w!HHHF&H5_!HGHF&H5D!HGHF&H5*!HGHxF&H5!HGHRF&H5 HGrH,F&H5 HeGTHF&H5 HGG6HE&H5 H)GHB&H5SH GHB&H5n HFHB&H5^ HFH`B&H5HFH:B&H5'HFHB&H5 HuFxhHjE&H5 H[FxNHA&H5HAFx4HA&H5H'FxHE&H5H FyE1LZ]A\1膏|rE1LD$ ^D$ [E1HHE;H8H=C&FIH1E1H=LE1=H=OC&FIHtH{H5?HHtHH5#L|tHmuH謎H{HHtHH5#L|jHmpHmcH=B&FIH5H{HH%HH5#LI| HmH E1H=IB&EIHH{H5]HHHH5#L{HmH融L%"I$H{H5HHVHH52#Lz{;HmAH>4I,$tE1ZLE1JHDHHH= A&DIHcH{H50HH3HH5#LzHmfH葌YH=@&@DIHHkHHEHH58#LpzHmuH8H{HHHH5#L1z|HmuHH{H5nHHQHH5#Ly6HmuH賋H{ H5賿HH HH5#LyHmuHmH{(HHHH5^#LfyHmuH.Hk0HPHEHH5"#L*ytyHmǿH麿H=>&BIH]H{H5ݚվHHt1HH5#LxtHmhH蓊[1H49LE1)9)H-e"H=>&BIHH{HHtHH5#LMxtHmHݾH=9>&AIHHkHOHEHH5#Lw?HmuH載H{L-L蹽HHHH5#LwHmuHsH{H5sHHHH5#LewHmuH-H{ H5-HHHH5#LwjHmuHH{(LHHCHH5#Lv(HmvH衈iH-"H= <&D@IHE1E1E13L%W"I$ H=;& @IH H= <&?IHtH{H5'HHHH5#LvdHmuHH{H5VHH9HH5#LuHmuH蛇HkH HEHH5#LuHm0H[#H=/;& ?IHH{H5>HHHH5#L0u{HmuHH{H5mHHPHH5#Lt5HmuH貆HkHnHEHH5#LtHmGHr:1H^cHQHDOH7}H*鲼HHغH=9&=IH{H{JHHRHH5D#Ls7HmuH贅H{ HHHH5#LsHmuHuH{L-LrHHHH5#LdsHmuH,H{ L0HHHH5#L"smHmuHHk(HHEHH5#Lr1HmH誄rH=8&YHH50#Lj#HmuH|H{HHHH5#LjHm2H]|%H=/& 4IHH{H5H@HHHH5#L2j}Hm˰H{龰H-}"ʱH=/&3IHUHkHHEHH5a#LiHmuH{H{H5}葯HHHH5;#LiHmuHK{Hc{vHHHH5#LDiHmݯH{ЯH-|"7H-|"]HzYHz醰H-|"L%|"I$HzHzĴHz|Hz*Hxz߳Hkz闳H^zL1H(LE1(駴H7zsH*z,HzHz鞵HzWHy1H(LE1(Hy魴H-{"vE1H=W,&j1IHJH{H5螭HH3HH5#LgHmuHXy{SHHHH5 #LRgHm_HyRH yEHxHxкHx[HxHxHx-HxHxHx~H-z"ֶH{x+HnxH=+&0IHH{L-LNHHHH5#L@fHmuHxH{L HHHH5v#LeHm HwH=*&q/IHQH{H5襫HH:HH5#LeHmH[w间H=o*& /IHH{蕳HHHH5#L7eHmuHvH{VHHHH50#LdHmuHvH{H5HHtYHH5#LdtBHmdzH~v麳Hqv魳H=)& .IH 1E1H$LE1$鶲H-(x"H=L)&-IHtH{nHHtHH5,#LdtHmuHuH{H5>HHuHH5#LcZHm߲HuҲHuŲH|u}H=p(&+-IH H{趱HHHH5#LXcHmeHuXH= (&,IHH{VHHHH50#LbHmHtH=p'&k,IHKH{HH;HH5#Lb HmuH`t{NHHHH5#LZbHmgHtZH=*'&+IHH{XHHHH5#LaHmuHsH{H5 §HHWHH5#La鴯LL[M!IMLud逯HhdϬH.HQdH,$L} @LuHtLu0A L9LNI}XsHHIwLd$E1Ht$IL9zM GffA L g"C< IH,$Lm j@LuHtLu0A L9LNIxrHH,IuLd$E1Ht$IL9MCC<{Lf"A<;vIL4$MvHE1M H9HNH~IL\$ 1rIHHHH\$ E1L98HT$IHLAHt$ o/Ht$ HILL)K<HWI  IL$JILH<$"lL!kHE^"H5E1H;CgLd$E $DL$ JqIHʪLm1MMxHrD\$ G:/:IsHuH $H5\a"H9qIIl$LCjgLMuPL$Ha"I9@LHH7IT$H,HI\$LiLƒHHI ~LHXH}HH}uH`AHt$;CHt$QRHt$CHt$]iL$MsHuMsH H9HNH}oHH7IuLd$E1Ht$IL9t:MC &?Hc"<>IL4$MvHMLd$MMx&G>E'L Yc"C<&IsLmHh4ILd$H_鬫H+IoH_bL_逪I*GL_:H,$LuH鞩MT$IMHLHD$ _VL\$ uI+LD_I+LuH._I,$E1cAM|$IG>EL /b"C<IMLd$LMx$A<Ha"<:HsLmH6gxeIfC<@u&IIuL9d$uH<$L]"L9WLK|L).IHLd$HmH^Ld$iV@VHLHߞHHtI (HEJI.@M|$IHHTH uHH uH]HH ZH]ML `"A<9I -HMJIMHuHILd$H>HH%TuI,$uL]LLd$H*H\A8?LLHaHH I  HUJ'HHSL3SIL3uH\ILE1z\ALLd$IHx&C ~fH_"<IsLmHdxjIC~f`>u&IIuL9d$uH4$H=["H9~LK|~L)&IHLd$HmhH[鉤=XLLHްHHtI LUKI,L9d$uL$H5Z"I9stLLK|>L)ӌIHt-I GHUJIMAh=4Ld$OLEIILd$MHHQuI,$uLZLLd$H+uHZHm[HZ|M)K|/L IHtxH EIT$HIHMtHH^QLuVILHBZHL2QuI.uL ZI.uLZI,$t"E1͢IL/HY"LE1Y飢LIr[IHtH (MD$IHID$HHLHPI?uHI?uLrYHI?SL[YFLd$ IL3H7YzAy;]M|$HH}LE\"A<I -LUKIMHMHILd$H1{HHOuI,$uLXLLd$H+HXI $HE1H5H=:m&L^T"H5 I:_]E1HmH5E1H=lHH=c HSޫHt$%IHHL$I4$E1HAH!NI,$eLE1W%;HD$ WD$ &1>L qY"H5I9\1!HKH; HY"EHqHHt$\$HHt&.H;D$H S"H5H9\1齭LH=F1镭fA\nIDfA\rI5fA\tI&HH5<H=Bhk1G XID$LH=~Hp12$ޭHHD$PVHD$ǭHHNH5kH= k1H+R"H5H:,[11AD` H5IH2I߯HAHHAebHHA?HA΀A?@pÀD`LD$(JE1+IuHkMMeHH}HJ1I.uLHuHD4L|$ 1H!%ALDPtL$HuH@tHu0Aڳ H=(`H%H/19LEH@ LE0L4BLE1 @BEDA`D@BAM閶LUH鍶tCL@tLB {dA鶶 A馶A閶H}Ht)L@tLB -?BH ׵HuHEt2@LtLB4~E@MtMC4 `HUHH鋵H邵L;HEH2HhH_H VMD$H釴HmtE1鷴LH$I+H_K雴HRK鎴MD$HELEH]uL5>H"ηD$O_骶H;l$0tLE1H۷HE1WLոH͸黷D$N_IvPLD$O_IHtsHuH}(HHx(0%ILLL&LD$MMMUL鬶L\$M MM $L鞶/1ɷQLLSAWRLt$(t$@LL$@LD$PHL$0H0閷DUfD9AAɷm@8/@@鵷HJ"H5H8N闷1.EE}1f.MEbDED8AAMDUD8AA8HLD$HT$HItwHHHHt]HLNI,$tUHmHD$ID$ԶHuH97¶HMH9@@鮶I,$t韶LD$HD$LH}UHH?JH}AH} H] HD"H5H8M1ZHnD"H5kH:oMH/H'L5H H1LH$HH$HH$HD$GH$HL$黷H$HuH$HqHD"H5>H:L1髶HELH$GH$H D"H5E>H9L1jL5GF"۶Hȶ1HmHD$uH>GHD$Է1VHI"HFE1Ǹ1H HH5,H=!vWx1 HC"H5EH:K1鈹HD$HL$1HHgHC"H54HL$H:KHD$GU1HSHHH5HILD$u1H$Ht$HӅxH%H"HH[]ATIUHSHH u11HsLՅxHG"H[]A\E1'L%B"I$LE镹L%E"l ̺AUATUSAPHutIHwHH^hHt7H{(t0IMyHHt HxCIHC(LYL[H]A\A]HFpHtHxtH=v H=%ܞZ[]A\A]1ҹHH=( 51H @"LH51H9Q1ֺH@"H5>H:I1鹺H=@"H5gH?I1霺I<$Ht$I3HH=_9E1EI,$LE19DmH,DJIHtE1ۼLD"H5]I:IH={H%HoHF"H8jtQEH5 #LH$HH-TIHLUHHHLHD$ H|$IH/MLL$HT$H5m#LDLD$H|$H1H5#1LLD$2GH|$Ht$IH/H.uHBMtHI/uLBH<$qBH=uC"H5&E1H?GgI(uLBH<$E14HHD$uBLL$ḨLLLD$"HT$IH*uH>BLLIu!HIPCBHt$HIiLA\HmH$HAH$}1]HHD$AHD$LǻHAI9t~D$,HHLH,H+HuHdAI.uLVAHUIm1馽I,$uL,AImE1麽HH.|$lfI.H*XD$D$L@霽I.uL@ImuL1@ImfL@L@H?L)H9,Hmt"1ƼIm:LE1P@H1A@霼L4@L'@0HYHPAL-#1HD$(PjjL?H HHغHoL&IHHӺH}HuoH5P="H9'HE頺Hx?ͺHPLc?ɻLV?LI?鯻H-]<"H5H}MDImL1?~H=,<"H5H?DImL1>NH ;"H5H9CImL1>[1]A\g  H :"H9t|HHPHH1HtzLIHtRL@L;<"I9t{MMt L;+<"L^;"IP1H5I;I,$t{E1釼HW B%voH= ;"HPH51E1H?hPLH AA%vH:"H5.H8BI,$uLE1=LE1=?HD$ =D$ *HֹH=Tq-w1[HֹH=L-1[HֹH=1'-1[I,$LE1<ʼH :"HHH3gC1=16HֹH=&,61[HֹH=,11[HֹH=v,,1[Ld$遽Lu@L5U9"ALd$頽L5>9"IL驽L5+9"L <鴽L-}#LHL+xDtLd$LHH\$LR L58"L9PI.'LE1;1/HֹH=+M1[I,$>LE1e;&HX;HmH@;1H|$H/tE1Hm{H;1H;H|$H/u:1ƾ:1麾H:: 1LHD$ :D$ 7ZH(1!1=H߮ LH5#LҶIH|$LH HHH3l HD$ 2:D$ b LD$ :D$ X L :H H 7"HP1H5XH9h  H-   H=E1<$ܿAHH9@DN 鏿I,$L]9 I,$tE1ÿLE1>9鳿HA!ʭ Ht$H H$ H! Ht$ H|$t HD$黭 HD$fHnfIn$L$YHD$A$"H:"H5QH;=1f/f(f(?f(YDd$DL$\$fLnD^D$fL~ D\$Dd$AYDXXH 4"H<$H5H9 =H$H3"H5H8<1H 3"H<$H5H9HEDDDDDDI9IALkMMXI77Ll$EpL)LHH1HHIDAH,Ml-IDI?LAU Hf Ll7"H5I8}:H=麬 Ѭ HL+Ht$0H|$%HD$jHHt$ H|$ HD$91D$ L$HH$E1E1HD$8HD$0H\$H$E1E1HT$L$E1Ll$H$Hl$t{MOH@tMO0A9-AIHrIHitbt{It$H@tIt$0>-AEAALD$AA-DT$@tGM_H@tM_0fA;-A MOHrt&ML$H@tML$0fA9-AIt$HM_HML$HL%u/"H5E1I<$E1o8L$HD$8HD$0LL$L=1/"H5bE1I?E1,8H$HD$8HD$0HL$jH."H5E1E1L$H87Lt$HD$8HD$0'ۺD$$AgD$XDHAgLML+M I9M\$HM\$HaSH|$(BD)L\$(fCC(Ht$(fVjH|$$HU lLD$(fAP)HOHAt*DHOHAt<.1DAf ~H(L[]A\A]A^A_3HH5M^MI+1L%#H9AHtHLLIFLHtHHH5CNIVHQH*1L-L%H9H INHtHLt?HLL'I~HtL=H1HH5IvLIvL褽HH5GH(L[]A\A]A^A_>A~HH5(sIvLYHH5L=IvLX#HH5wLIvL"AHHH5(L|AAHH5OZIvLHH5 L$oIvLUIvL1;1HH5IvL6IvLݻHH5>4IF11HtHbHH5KL`E1L% I9}CuHLL0{IvLJt\I11L-H9uHH5YL"IVLdI4$HL$HH5ZLIt$LH1nHH5&UIvLHH5HLLu]HH5xL- H-[,L=%"H5I?-W1L%A9~HH5L%Iv@L? HLL@IvL 1L%v1L%|c1 L%dP1 L%L= L%Q'1 L%1 L%1 L%1 L%1 L%1 L%1 L%H([]A\A]A^A_鞳HvH;5)"H([]A\A]A^A_pHH5MIvL@@xAMFMHMMMMqILH5HHEHLI^H+H;LeLd$HKHQH1H{0HsL'Ht$1Ht$I)H;l$H;l$LLItMHH9l$3I1HH5\ME1H5'MLNM:I)H.EZ1L%<H9mHtHLLMVLItHHI~H5# H5UHvH(1[]A\A]A^A_uEtHH5dIvLJHH5L.IvLIE(1~H-H @HE@ރA9mMfMI<$H|$DCE1DD$L;t$MtHHLEKtT$LvIHH5 WI^HtwH+E1L%gI9LMtHLL IvLJt1ILCL $"LM9HID1눺LA1L=Y"H5*I?(H5HL' rJtLWIH5VH5HH56H5(H5(H5HH5  HH5oBHH521HD$HH5Ia 1HHH52L/ fuE1HH5 zOH56LH5'HD$]H{uHH5-L HH5CL HsHtL-LC1MM LK MI)HD$L)L9d$uHH5L gLSL\$LKt赱HHxJHC HTHHT$t7HH5L Ht$L.HD$H1VHH5L HsHH+|$HtLMyH|$H HH5L$ oLK0LKtuOHH5L .LCMtI8jE1`1iH{(tQuHH5L HH5,Ly Hs(LHH5LH IvHV1H:H H9OHl}GHHvHtH|$nH|$L%HH|$LH|$HsHtH|$"H|$H{HLH|$xH|$Hsܿ@@LFMtpM 1L-L9}RHtHLH|$H|$t*LSH|$It}H|$t H1It1E11h^HH5AAND$0xMH#D$0L!"H5bI:"1x1fH@AH="HH1H5@HUAH? |HmuHI,$u&LE1zDH "H5/H9!E1&HOH|$H/u:ImuL)H0"H5%E1H:.!LE1LH+H1pHC ( LE1sgHt$H|$ D$W I,$tImI L< LuIm) 1d L[H I,$A L9 E1 E1 Lt$ٙ ImA  L$  I̛ H|$ H|$Lt$LL%"L-#LHL_xILt$LHH\$LE1 L%"L9I,$LE1_1HL"H;H;H5rMH"H8uE1;H"H:n)I$HHKL$ X!f(fT EH"H5H81vX\ 1|$Hj"H5H8{1HiHRE1L"HT$ R1jjH HHE1FH|$ H/u I,$tgE1'D$ D$ D$ D$ HPE1L"11HD$ PjjH HHtHH $LE1 8u<t$1710H "H8'1II)H7"H5pH:HLHֹH=pM1[HֹH=H1[LAL-#LHL\x_Lt$LHH\$LR. L%"L9jI,$@LE1l3L%x"Lt$p12HֹH=NA1[H|$H|$~H=*"H5H?11ZH|$P~1Hs0~ H=1L@Hlt0L[H@tL[0E$tLKH@tLK0E$)kL[HLKHLc"H5I8dA@A#H_"H5H;(AALS0LSHLAԅ.]A\A]HHH O#1HLD$IH$HF\A1EtH4$H|$H1JH "H5*H91-1ҹHH=>U1I4$H;"tAHHT$HHD$HT$H\(H]1{AAAJ\HtaH[H]A\H@3E1H[HH@]A\[]A\6P H=HZ~ HxL,P!H='z1ZÃ1E1M &@@HMHHM0HuH@/Hu0&w%HHHEHHHuNE HMHH}HE8HE0E t HMH@tHM0M I@ t LMH@tLM0H}(MMI)IIIM9s7AB AZIIHH AZHH AZHH ICLL_1H)HHM9LLBHMM9HBHL9sDHIfEY@t @HUHtHU0DE Hu@AfrAHuDE HE8HE0HE(HE@IRL-#LLLWWILHL$$L( HH"H9H+HE1Ht*H1H9P(uHH5L#)$P H[]A\A]A^ H"HH~HH"1aHmuHM1L+LI,$ttE1oH"H5H8nH{ H{(H{0qH1HHE1E1LE1H|$H/uH<$H/MCHGHH|$8H<$/HrLHHUHHH;H$HH FHHHHH@HHm9HHI,$tE1]LE1pML1H;1WIHt,H{1DIEHH1H2 "H5H811TH}L@H]AHCH/xnHD$SH|$HuMHHHH)H9r:HR L9I HC1L)HH H H="[IHfH@ L|"@H}(I0Hx(HIHHu HImIuL Mt]H}LII.HuL I\$Ht6H} ID$ Ht#H="LML$IHL[]A\A]A^I,$uLi E1H I.t/L; PAL"1HD$Pjjd H HH1HuH "H51H9Q1H "H5H:1H "HOHH5TwH81 1@Ht"H0UHHSH5HӺHHD"LD$IH$1A1EtH$H|$HH[]H "HH|$H|$F1B<H_HNH@Lp1 fA*X, A铑 L5"H5I>1馐 AB II)Ig MI)青 HuSH> "1|H=1H5 "0Ht$(H|$ Y HD$ AD$(wL%*HLG1H"H5H81H"H5H:1HHH5H=Q1HHt$HT$1HHT$HT$1H="L5x1L?L "L5(1M9HHt#1L51L51L% "I<$L51DL "11H5EL5(I8rHHH=1IE1 H-"L5L}15HT$Ht$ H|$(Hl$ Ht HHH|$(L5ÇH|$ 蹇H|$诇1L5O1L "I0ML51ML51ML51L}H@I7H= Ht}H{@HC@H{`IA;LLoLH|>LH{`LHEIHt#H=IHI,$]CH=H'HH=Hl'HtHk`L}H?At CH¾LI,$IuLHI.uL:MDIHH~OAW ։Ѓ @@@MGDtMG,A<,HbL ID1H=LI/IuLMH{@Lk@ZLtc@IOGtIO/<9,AEHH-HE{t&@MWFtMW.fAH|$(61L 8"H5I9L"HP1H5CI:1L;wJDI8HT$H5Z#xH|$0L\$HD$HL$HHHD$L\$HL$&H|$0HT$H Z#LL$LD$HtHD$0H/HT$HLLLD$cH|$0LT$Ht$HHt$LHt$8LT$H|$0HD$L\$HtHD$0H/Ht$8|$$LL\$HD$HQH|$(H\$Ht$L\$L !H5I;HD$L=!H5"HL$I?HD$IL-Z"H5I}H5ε%H6t$HT$(H5-O#H%j1HuH[!JT@HNH8H5;11\H-3!H5H}#nHT$(H5N#HxHL$(HHyLqLL8HH1Ll$8H|$(I9 LLLI<Ht$(L;v-LD$8LDHHT$(H5!N#HH|$(HHt$8L6H|$(HtHD$(H/dH|$8L H-VH=!HH5կ1H?K6HyttLyLL*IH1LL$8H|$(I9AHwLLL$HLHqHEbL !H5BI9J H\$E1HhH!H5H:H|$xA蔪=H=!H$H%uH|$xHHD$xH/=L!H5'AI:AH5b%H H5:%H H5%H6H5%H1H5®%H4H5%HjAƃkE.H5o%HGAăH:0H5D%H$Aƃ%P/H5%HAă2H5%H H5ƭ%HH5%HAƃH5s%H{H5K%H[_H5#%H;?.H5%HLH5G#HH|$xHtoH$H&AąH|$xHtHD$xH/4DD$XL$\IًT$`t$dH$M"L\$IHL%!H5I<$AAH5%H;?L$XT$\I؋t$`|$df LT$IHHLH5A#HLl$xMM}AMuHLsHHE1L$H|$xM9HGHLJ<HL$xL9qH$JtIH5%HBFtpL$XT$\I؋t$`|$d轀 LL$IHSL `!H5AI9KL?!IWH5ľ1I8H5~%HL$XT$\I؋t$`|$d]{ Hl$HEHHtHD$xH/T$`DD$XIHL$\t$d}HT$HHxLH52?#H*LT$xMjMZAyMrHL裫HH#E1L$H|$xM9HGHLJ<HL$xL9qyH$JtILH5g>#H,H|$xH\H;=!H$H\H|$xHtHD$xH/+LH5>#HL\$xMISM{HLL|$芪IH Ll$IHH\$E1H$H|$xI9}LGHHt$K<7LL$xHt$I9Y$L$OTIH!H5úH:AEL^!LW!HD$xMLL$IM uL=HDŽ$'H;!HRH5H81 H!HH5@1H;fLH5<#H Ht$xH!HN1LvHLHHE1L$H|$xM9iLGHLKH|$HI8tD$XLLH5?#H,H|$xH)H$H}H|$xHtHD$xH/LH56#H6H|$xHH$H AąAH|$xHtHD$xH/bLH54#HoLL$xMDMQASMYHLL\$JIHLl$IHH\$E1H$H|$xI9HOHHt$J<LD$xHt$I9X-H$K|ILH5'>#HD H|$xHA H$HH|$xHtHD$xH/3LH5Z5#HH|$xHH$HAąH|$xHtHD$xH/LH5Z3#HRHt$xHL^AL~HLL|$ƚIHFLl$IHH\$E1H$H|$xI9HGHHt$J<\Ht$xH9^Ht$9H$K|IHLLl$HtHD$xH/uLH5.#HgAL!H5ƖAI:LH59<#H!0H|$xH-H$H Aą,H|$xHtHD$xH/YLH5-#HLT$xM;IrLMzHL;HD$HE1L$H|$xM9}LHwHLD$JL$OLIH !H5AH9˾L!IWH51I;ѮXH!H5H;V=HLLl$HtHD$xH/u LH53'#HV AFL!H5bAI;%L-!H5AI}H-!ISH51H}HLLl$HtHD$xH/LH5*#H#H|$xHiLGAxHGHHHD$ 舑IH1Hl$H$Hl$ Ll$ EIHH|$xH9 HOLHt$(H<Ht$xH9nHt$('H$I|HL=A!H5I?yh L!H5ՐI:mTDd$~eTLh!H5AI8S錷HG!IQH5H81蒧LDd$HtHD$xH/thSt$`LIVL$lQ|$xLWD$Ht$0H$C Lt$(H IHL5]!H5.I>L ;!H5DI9sHtHD$xH/tNAQLLS\$hSDT$tARD$D$Ht$@H|$0d Lt$(H IHhL%!H5(I<$L!H5AI:L !H51AI9L5}!H=v!HDŽ$ML\$(ILu\HDŽ$H HL$xHLyALAHLLD$؆IHX1Hl$H$Hl$Ll$EIHH|$xH9%HGLHt$ H< Ht$xH9nHt$ ]H$ITHL!H5BAI;L!IWH5]1I:LHl$ELl$HtHD$xH/RLH5t#H,aH|$xHH;=7!H$H9-H|$xHtHD$xH/LH5 #HH|$xHfH;=!)H$H&H|$xHtHD$xH/mPLLSDD$hAPD$tP$W$UL$L$H$H$1R Lt$8H0IHCL5!H5aI>A(L!H5 I;LHl$ELl$HtHD$xH/7LH5#H&H|$xHH;=!hH$H蚰H|$xHtHD$xH/ LH5k#H#H|$xHH;=.!IH$H$H|$xHtHD$xH/PLSL$hQDD$tLAP$W$UL$L$H$H$ULt$8H0IHL G!H5I9Hd!L]!HD$xL LL$IM uLCHDŽ$.H5#!H!HD$xHHD$HHuHHDŽ$L !L!HD$xMLT$IMuLHDŽ$H5!H !HD$xLL\$ILuHvHDŽ$``VLH5#HH|$xHH$H)AąH|$xHtHD$xH/ LH5#H=HL$xH HA LAHLLD$$IHLl$IHH\$E1H$H|$xI9LGHHt$K<躨^LL$xHt$I9YL$OTI&yL :!HV1H5I9腜 LH5#HLt$xMMNAMVHLLT$2IHLl$IHH\$E1H$H|$xI9HGHHt$J< lHt$xH9^Ht$L$ODILH5#HL\$xMI{M{HLqIH1Ll$L$IHHH|$xL9HwHL\$H讕5$1LH5#H8H|$xH5H$HH|$xHtHD$xH/LH5#HH|$xHH$H蚥AąH|$xHtHD$xH/*LH5(#H {HL$xH HyLyHLL|$xIHLl$IHH\$E1H$H|$xI9HOHHt$J<+H|$xHt$H9_H$KDIHt$xHL^ALvHLwHHmE1L$H|$xM9HHLJ־H !H5}AH9Lɻ!HP1H5}I;H!H5uAH:̟H!ISH5uH81ҏYA L5!H5{I>L3LHl$ELl$HtHD$xH/LH5#H轾H|$xHH;=ȿ!H$H!H|$xHtHD$xH/ SL$`LQ|$lLWD$xPD$L$H$H$> Lt$(H IHLHt$xHL^AL~HLL|$rIH 1Hl$H$Hl$Ll$EIHH|$xH9LOLHt$ I<LT$xHt$ I9jL$M\HH!H5}AH:ɝH !ISH5}1H9ύVL5!H5$}I>T;HtHD$xH/t2DD$XL$\IHT$`t$dH\$HHLL%!H5LsI<$ҿL|$xMMGAMHLqIH1H$H|$xL9LWHHHL$I<軘_L\$xHL$M9{FH$I|H'H;!H5xAH:&_H!IPH5xH81eۺHtHD$xH/S\$`LLSDL$lDD$pL$tH$LL$IAXAYH鉾LL$xMMyAMyHLoIHN1H$H|$xL9sLWHHHL$I諾钽Hw!Lp!HD$xHHD$HIuLVHDŽ$gL^!H5tAI:I邚L !L!HD$xMLT$IMuLHDŽ$NHLLl$HtHD$xH/LH5#H~NHL$xHLyAHAHHHD$ mHD$HpLl$IHH\$ E1H$H|$xI9L_HHt$ K<膕*H|$xHt$ H9_H$HL$JTILHl$ELl$HtHD$xH/LH5#H舸vH|$xHH;=!H$HH|$xHtHD$xH/SDD$`LLAPDL$lDD$pL$tH$DLt$IA^A_H)IH !H!HD$xHHT$HHuHHDŽ$rH=!H5LxH?ܻúHtHD$xH/S\$`LLSDL$lDD$pL$tH$1 Ht$H^_H×lL%Q!L-J!HD$xI,$Hl$HImuL.HDŽ$L ֶ!H5pI9':$L !H5uAI9qLܲ!IWH5u1I8'鮹蝵HLLl$HtHD$xH/LH5{#H3H|$xHH;=>!H$H藺4H|$xHtHD$xH/SSDT$`LARDL$lDD$pL$tH$Ht$ ` Ld$I$ZYHzӸ´HH5!L !HD$xLLD$IMuL荴HDŽ$qH5!H5tH8膹mL z!H5oAI9e鞕LY!HP1H5oI8褅+L%ش!H5AsI<$(L%!H5qI<$سsL5!H5oI>ݸķ賳詳蟳L|$xMMGAMOHLLL$hIHfE1Hl$H$Hl$Ll$EILH|$xH9LGLHt$ ILL$0MgMQAvMyHLdHHE1HL$HH|$0M9L_HHHL$K< H|$0HL$L9HD$HJDIApH߫!H5xAH:ʳOL%!H5owI<$A訳-~L!H5kxAI8}H5b%L t*AL%O!LH5%w1I<$H|$0A\鯕{H !H5wAH:zL!IRH5w1I84譭CL!H5vAI:謲1LH5"HEsA HtHD$0H/t7PDHSDL$0DD$4L$8T$<- Lt$IZYHƔHɭ!H5vH;Ht$E1H鋔LH5'"H蟭bH|$0H_Ht$HH輎H|$0HtHD$0H/LH5m"HEH|$0HHt$@H20H|$0HtHD$0H/8LH5"HH|$0HHt$8+AąH|$0HtHD$0H/aSt$(VDL$4DD$8L$H|$0H$Ht$HH聆AąLH|$0HtHD$0H/AQDSDL$0DD$4L$8T$!H5gI<$莛OdL%!H5fI<$k,H_!H5 lAH:J~ 4~LH5"HٖH|$0HHt$@HwAąH|$0HtHD$0H/LH5$"H|Lt$0M*IVM~HLJIHPE1Ht$HH|$0M9}HtHD$0H/LH5"H Hl$0HLmAHmHHsJIHE1LT$HH|$0I9|THtHD$0H/S\$(LLSDL$4DD$8L$L\$0MICMsHLAIH1LD$HH|$0L9HWLLD$HPAąuOH|$HtHD$Hu nH|$(L HHu-H k!LH5BKH81X?H|$~AH8D[]A\A]A^A_USHVt DHHu H{Hu%ZuZH{Hu90HHH5/1"ZthHK1HtH1H9|PjZl!E1E1HAMIT$HH;,yAu8HT$,IcHT$LϺLLA yfA_ A9AAE1!h1H9uH}L}L9E1H9vXDNADL$ uFHt$HT$<,Hct$ LDLE4pLafA_Ht$A HT$AE1L9sHD>Au> 5E1yD~HT$ AHt$DvHt$HT$ LLpDHt$ HT$cHT$Ht$ LsL>DHT$DD$HT$L޷LDGbHT$LLDbHT$LLeD[A_HT$LE@DžLdAD @ωL$LuMI)IL9YL}HMI9C1L9v*Fz"H=R!DBAƃ_AE AE1H9s(6z!H R!DB_AD DD9AA1H9uLuL]Lt$M9E1L9w'D$H;t$1D;t$D~HT$ AHt$DHt$HT$ L,LuDHt$ HT$`HT$Ht$ LLɶoD`HT$Ht$ LֵLGDYHt$ HT$AA_AE LELf D>HT$D=D$HT$LiL4D_HT$LFLD`HT$L#LD,YLٵLA_AD HT$|$pL}H}I9E1L9v)Nz!LP!AAƃ_AE EE1H96zH=MP!DB_ DkH;u~ r> rE1HH9~HHDL4I9AHA~MI9L[E1L;\$~A6A93t~IIL[LsE1L;t$T~zA6HT$m <~LT$ILfMnIfM:"LBDC}~HHS}LSE1L;T$}Ic2w LM!A40HzLT$E1HT$X}HT$H|$LLʳDJHfLnO4fM:"D{}LKE1L;L$i}Ic1w L=M!A47E19rI}IHfMnfL:"Dk|LLS8MP IzI HLCLD_HQLEIHS I)L9$ IIG HLS8K@HHHHUMBL H@I H@L@,L[E1L;\$|A3HzHT$L\$f|HD$HL$LL{xHfLnI4fL:"Dc{DJE1ML9|LK|O4I9H{MI9H|$(LSE1HT$ L;T${A:LT$A>D$9D${HT$H|$(ILLްHHSHT$ 덿 57HC8HHKLHLHH@H{HHMM)HPHH}IGHLHHHUL Lc[@H@E<$X@K4Hpj~LsE1L;t$zBA9zIHfInfH:"[6zm E1zHHL\$ L\$LcExHISJ JmzBE1HH98zHLLL4M9@M@@zMM9LL$(LSE1HT$ L;T$yA:LT$A>D$;D$yHT$LL$(ILدLHHSHT$ DZML9BML[yHN|J4L9AMAu HRM4LsxLsE1L;t$(yzA6HT$yLD$IL-fMnIfM:"LBDS|xLsE1L;t$xzA6HT$VxL|$ILLˮfMnIfM:"D[!xrE1HH9nxLMLIL9M@@HxHtjL9sjLsE1L;t$,xIc6w L=G!A47Hcw LG!A E19wIHLswHHSvwwHHSdwHHC8HLXL0HLKHE{IVHLMH)HS L9}LHIHGHHS8{@HHHLZHUL H@I x@LXzAsIH9| AL;HHoHf:k(H~YL4I9LHLcEHItJ"HHHLiTLLL+IBHL{8LIwJ4LLHC8MxHUM)LMHPIG8HLHHL Lc8[@H@IL$X@H HHyLC8J|IxHHHM L{(M~1JHH)HsSL{(N L)~s0LS8HCHfI:"L[ IMHELC8LI@L)MHHGv4HLHHHUL Lc[@H@L`X@xHHLL$'LL$LcExHItJ tL[E1L;\$tIcw H yD!E19BtIHfMnfL:"Ds'tH HStHt$HHHt$LcExHIJ ^tH[LcExHIJ'*tHFtHHxHItJ HULcsIsoMzf:c(LIGv4HHHHHUL Lc[@H@L`X@vHt$HH{Ht$LcExHItJ Ls(sHHSrHt$HH2Ht$LcExHI J rHs(HuL M)LrHHxHIxJ'xLcrIrHHHI>wJ 5w{@Hstubt H9uwHuArHrHLxHx8HLHSDJI9qHC HHCDwH9uLwIqE1H9K rvqL{(HuoK(f:htM~LJI)J47L:OLcqHT$LsE1L;t$PqA>LT$A9B9qIILfInfI:"LD{pHT$LsE1L;t$pA>HL$9ApIHL+fMnLfL:"DCRpLcpHHxsHIsJ sLpE1L9UipZpLsL[ ~[0fH:"[(AFIHkL[ I9q)pLc@pIHrp5L]L*oIpHCDRIL+]IM9HLIL)I)HEIIG HHHHHUL LcH@ I@@L`sLKJE1LLH+}HH9FoLHMI)M)LMIGvVHH[LHHHUL HH@ HX@@rMvHsD>N LKanHHL\$ L\$LcExHItJ |nHt$HH Ht$LcExHIJ ynLsE1L;t$HnILsmHsE1H;t$)n>  nHHsmH{8LgLH;mHK8J|HyHMpLC HS8HsILHumML{8LK~k0fH:"k(M_LLS ACLMtI9} M;OE1hmMZpHC L[8HKHIHMCmM5pLC HS8H{ILH}mItLs8HSLHUmoL9|$oD_E9opMeoLc(MoN4L)HlHML)Hv}Ls8LIVJHLHs8LHUM)LMHVIGv^HLHHL Lc8[@H@MT$X@I LPoH3 LcEx:HJ'^HH xHHUJ Lckk1Ht$H<$jHrH<$Ht$tL9/rHL)HurnLL9\r;>9tHFLL9A9t6HD^LL9qLcAw L n:!GE9u>HxqnLL9iq;K9uHHqJqEq@q1qHHD$e7HD$qH3&H,&HC7rL67}rH)79rH7r\E1s1ҹHH={'-sE1sL6sI.tI/uLE16sL6H 3!HPH51E1H9sXHD$Hr$ HrzLo2!H5I8p;WsI<$rHIv EIL9L% Ht$x, Ht$HHtBH@H  HtNHuUH/ HD$5HD$ H H=8H D GH HU&HN&ImtE1)sLE1S5s1H=b2!H5\H?S:5tL71!H5X[I88:tH 8!H5%H9:sJ4Hu>tHtHHD$_4HD$\vEHHt@H%HmIuH.4It L+1u HHxM1uHiuIL5!I:H-/!H}mau#f.;zt=A<$ftR1>uLGAH1 1@;uD$HtD$Z1tA$L 9/!LH5/1I9tL6!LH5T1I;rtDHHSHq.HmIuH2I/L+1Ot6HHH+14tE$$HAikttAbt?Ahtf1tHHD$P2HD$tHH1sHHvH=f1sH91sr3H}L1H5Mis`CHHH|+HmIuH1IL+1*s1HrIL .!LH5>1I9rHU-!LH5K1H;rBHHt3HHmIuH1ItL+1rHLsHJrIH6r(mH#rIH=-!HL1H5E1H? 3sHD$+HL$HLsE1s-Li,!H5 I8j5tLH|E1H5gH=ЯEsAVIAUATUHSHPHc~$H?Hu ARIHLIL4$LHD$8AuCP;HD$@LHLAHPD[]A\A]A^ATIUSH~AEt|LH(u+C$HS0HHHHu B1HSHcs$UH{0LK@At$@LC8At$8H A4$H 1Ht H)1[]A\AWIAVMAUIATIUSLHHH$H4$HH$H$H|$L$t<1IOMIMHDHIpILDE1Ht$ILHL$MMLL$ILLL$LLL$IH$HH[]A\A]A^A_) LMumHHuvL\$0M_I}HHD$8H$t$t$HpASRLD$8LLL$HLT$@L\$PHD$XH LL$(LT$ M#I/I9]%I>HxI $HH0HxHuHvHH[]A\A]A^A_1[H|$HD$I,$t1rLW-HD$rE1rE1rxHuH=1HvH]A\A]E1rI,$sLE1,wsLHD$,HD$sxHUH=`1HrY]A\E1tHmtA1?uH=)!H5:H?11"uL)!H5I811uHHD$i,HD$t1uHHD$K,Ht$puL9,,uL ,!H5I9>1E1vH0IH~H8H wH+vH8vE1dvx%LeH=[1It$H8[]A\A]A^A_E1OvHֹH= w1[HֹH=;wwAxExH H-!H5-IH9U0xHD$ $+D$ oxL$'!H5%II8!0xAIwIxH=,!H5IH?/dxPZÃ1E1uymyHHy/H{1HAh/xHֹH=xzby|yHֹH=ZTy1[HֹH==/yyYH[]/SHHu HsH;[HֹH=u1[SHHu HsH;[h HֹH=u1[SHHu HsH;[HֹH=wu1[SHHu HsH;[HֹH=i?u1[SHHu HsH;[HֹH=9u1[SHHu HsH;[(HֹH=u1[SHHu HsH;[HֹH=u1[SHHuHsH;H_*![HֹH=Xu1[SHHu HsH;[HֹH=k u1[SHHu HsH;[%HֹH=;u1[SHHu HsH;[HֹH=u1[SHHu HsH;[HֹH=xu1[SHHu HsH;[HֹH=@u1[HtHucUHGHHHhHtHQ@Ht]HAHt]HC t1HB t%1ɺHy H;#!u/HuH&HuH=#!1HVH?H51]HHֹH=~A1EwwHֹH=}Rw1[AXLH]H A\z H{H9}xI,$uL%EuLI$LxL%"!Ht,H9u#Lu8L%"!ALt$9xLt$LH5b"HH\$U< 8xL-I"LHLjxEtLt$LHH\$L< L%n"!L9wI,$wLE17%w1wHֹH=n"w1[H x1[1xxI.{yL$nyI.tE1yLE1$xcHy$yPE1Lt"11HD$ Pjj#H HHvz1zI2zHHD$U$HD$zLHD$>$HD$zI{L%&!;{]A\A]LD$ $D$ $}H3}H!!LH:}E1|HLI$x#HI$}L#}E1}HI$tE1}LE1#}Lu#KE1CE1;H1V#~E1E1!E1E1HH1H[鎍 鉍 鄍 Hs0ЁH8L !LI91Á1鼁HHs8E1E1 H~H9AEJ4aH5&!H H!Hrt H!!]QH9~LLf2H9LLQH9}H9|Hw!!A隄H"XHD$ !D$ τH-#!饄PH!H5|H8&1ZH!H5bHD$H:&HD$HHD$!HD$˄1ĄH !H5H:&I,$tE1LE15!Z1A\A]L1!H5HD$I8-&HD$闆H=!H5H? &1zPH!H5OH8%ZupH"!HHۆAVAUATIUHSHH H"!H0S4ttID$H;$!H;!!H[LsuH;K#!L-uL-wL{MMHH5K!H1HH6H []A\A]A^{H!HH23HT$HL$HHt$ZHT$HHJHzIt$H;5 !L-L@H;5#!LrAD H;5q"!MVAD @LL%!MDAu"I4$MHHHb1#lI4$MMHHhH1~H|$ĝH|$躝H|$谝HL$Ht$HLH []A\A]A^H!HمƅH!H& 1驅1颅PAL!1HD$PjjH HH1GB8u1)H!H:-HօH !H5H9#11VH!H5H8"19H !H5nH9"1HHD$HD$҅H1!AH8,,HyVPE1L(!11HD$ PjjH HY1邆|$ Hc|$ HfA=AH,HIHteH50!HHHtaHHIHt}HmuHI,$tvAI9@@.<!L+ !I8#u!1H5L-11HutL;Hy2PE1L!11HD$PjjfH H1 AHH騅AޅHG HtHHG0t*< uEH|$H|$HG Ht9HH1H|$لH|$tuH|$衅H|$114H!HuH:Ld$LLt GՅHl$ E1H !Ht$XH9II4I,Z1[]A\A]HLj1Zÿ11I^LщL骉HmuHI,$t1駉I,$uL1h鑉L1Y邉E1=E113E1*E1*E1LL1陌LHD$ HD$邌LHD$HD$aI,$uLLE1HmuHHmuHH= !INL1H5"H? HmtHTPHHThHHD$aHD$RA1LD$APLC!jjH HH;Hl$E1ގH !Ht$HH9IŽHt$`A?I,$tE1飏LE1铏E1ΏL9ŏLF鼏IÐI麐LIrHBI韐L1I鎐MtBL?IrI)!M)L餑HڑLH)HHH99*tHL)HH鞑UHH!SHHt$ tL |$ HHHu;tHd!H8$'_HuHH[]H1[]H=!H5AH?H8D[]A\A]A^A_IHHUH5L=q!1I?AE1ImuL/H $H1Ht$HH1uHI|$H_HxoML$HD$H5mILB L; tDL9tJttHXHXHtHu/L9E uL;C uL; uIL;uI맺LD$H<$AH<$HL$HwLE1H9x0ARLH1I鞑1ALXI.uLlAؑAUIATUH}HuE1jH5b$LIuI$HtH<[!H9Eu"LLKHtHIHuLLH1]A\A]oL]A\A]ATUSHHuH &!H5E1H9oHsHHHuWAHuHH脭IHt8HCH!H(H;(t&HS HsHЅyHsHE1L`L[]A\LH5t#Ly&E1:H.uHHD$1Ht$HؐH=!HP1H5H?H1'H !H5+HT$H9HD$1aHHD$HD$JH5!f5 H= Z]A\1ҹLH=Kg1騑H 5!HH5Q1H91醑H=!H5fH?1iL !H5HT$I8HD$DH;Ht${y:HmtGE1HmuHE1H= I鑑H=ItHE1S鷑x!]H=QA\A]HE1@E1{ HHSHs_H=q1[1[I,$tE1龓E1ēH道LE1陓HH*uHE1vL{ z HYHPHA1LQ!HD$PjjH HH1ÔL}MmIH5!H9<Ht$0Ht$%LHt$!Ht$HIHHt$I/Ht$IIHH]H{H9thu_HD!HHtHdHmHt)H+H HӓHHHD$THL$Hf !H5H:W1験H鋓LHt$9Ht$HHt$I"H  !H5H91IH5 !HHH)H(~H(t=HP3HzH9vHfD9"uHH)H.HH)HWALC!HHT$R1jj H HqHAVAUATUSLg MtI$^HHHE1LsPZHHtCL;kH}2IvI>I|5HuHMu"HE1 JDIHEIHk [L]A\A]A^HiHPAL!1HD$Pjj H HH*1靔HHD$i HL$l HuH_1XH^ !H5H:O1OHtE1鼔H !HgLgHC<+H|$H|$16111H!H鞖HC(鑖1銖HmuH I,$ėL| 1:ALL-!I@``pL1?HHtHH !H85HmtE1I,$uLE1 HE1 E1H}H5!Lc0Lm0 鸛H 6H- !HHD$ HD$逜E1՜H8H=HH !H5H:qڜ1?Hha HHt%ǀHg1SH=6H=X[]H蟛 Y[]WH=1鴝1%L!H5I87UHH~H5` !H9t tH!H5,H:|OHr Ńt'HHu$HE!H5H8FHt H5%] 1]1Hl$HH%1FHHD$ HD$/L H(HH51HT$ A1EtD|$ Ht$tH!H81H*D$Y H*L$XH(1H!H811鐡H !H逡E1I,$uLL1裷HLlL離LʢLHt$H1SH1H5$HHT$A1Et9H|$Ht$z Åt_H!H81 Hc|$H[1eH5!H>陣HEHt$HHHS8u,ffH*D$Y=H*L$XC7H i!H9).P{ZHPZHPZHH1H|$ t H=? HD$HH1H|$ A1Ex H|$HH1H|$\A1Ex H|$XHUH1H5H HT$t$Hl$|$HtHp!H801H|$HoxH|$H ]IeO ``9Lg@4I>& H=GI $HI面LL$ L$ 1ŢHuHtH *!H5H9 1镢LH=߻tݡtLOH@tLO0A9٢LOHHHǢHt$H<$<H<$Ht$z1髢L!HP1H5XI;1鈢Lz!H5{I:k 1kLG0鄢LGH{HHFH[]A\A]A^A_& It$H%L!H5E1I: ^LH=uH 1[]A\A]A^阣LL$ QL$ H龣@HuH鵣H !H5<H9 L(FL</L.< ,L)@LH5LDH5!HAHXHXH5R!1H6 LפB;I\$0H\$IT$HHT$Ѥ/Ĥ1齤HHu H= AUATUSHQH`ZIHu 1E1H{@?HHtH{HHSPHKXH;W}NHBH9uEHH==v=H=H 1HCHKPMH1IHMH1H=EIL腁H}ZL[]A\A]USQHGu -~ HHyHy AAuYH9kH !H5H9w8C tHSH@t HS0HSHu*ujZ[]H^H`H9v H9*uH)HHSHJH)HI镣HCH+C L9ǣףAt4HI|H9wIHأHE1IODL9vfG\fGQIMIH骣鸣,~IWHTH1[]A\A]A^A_H W HPH5V1E1H9GE1/ HE11HE11镥E1鍥HbH HP1H5H9*1H)$7fo$11鸦E11E1E1騦|$ Hc|$ HOH1[]A\HH|$ۿH|$tG @uH5HL1HþH6 HuH֨H= H5H?H1[]A\A]A^H隨LH=t*L7H$2HH|$H|$tH5HK1HH|$ݾH|$1H HA|ЪLoH}H|$蛾H|$!1颫H H钫A|nLoHA}9H|$OH|$1<A|ݫLoH鼫!H|$H|$M1QLHdM A1~Ճ5A0A0&L½1H+ H5H;1L@HͭL@HĭHKHuHBHLDEZfAfEf0闭L HLHI1 H H5 H91HZH^ H5WH:_1HH= H5މHD$H:9HD$HLAԅ]A\A]LAԅLAԅLAԅЭLAԅHT$Ht$H|$7îH鶮LvL^I,$tHT$Ht$H|$L[HT$Ht$H|$H=ȣ^Ht&HzE1E11ϮE1Ǯ1bHs&HXH {H9t H51DH H51$H111 H|$HH/uHXZHC5EHT$HAHT$hH]A\HT$HAHT$cHT$HAHT$@HT$HAHT$HHhHtH@hHu P1Z1AVHH 6 !HAUH ATUSHHD$D$ HD$D$P1Ld$ATLL$LD$0H^_tFHt$ H|$Nx.H|${HHL%\ H5mI<$\1HS㥛 H9~H- H5xH}/1 HHtLS AąxHع@B<HLl$,HH1HI1HHIHtPHL1VdZYHdL1L`IHu 3HI LD$MtIH= |$L|$wDL$ LUD\$H=,|$D%{$D {$L{$D{$H{$L-{$L5{$ 1H=~ HuZH={$H={$HtHHu{$uLֹH_ H5H}{$H;1 Hr HHĐ[]A\A]A^UHĀHH1HHH5{$H=:{$1CuH=({$NHc{$H5{$=z$hH5z$=z$1=z$t Hu =z$uH=z$wH]HHCH/'HATUHSHf=~%E1D9cIcHAHk0Hs ftfu sw&hw&y=[w&t(E1D9%Sw&~H AM1w&f;HSu)Ht HH7H w&[HH5I]1A\I[]A\AWAVAUIATE1USQHc_L kAHcHk0AxIHIC[L1HS SH(AEx C(1[H SH(AEx C01[PLT IIp IAǂ IAǂ H AǂHZH HXHBHHuH HHHÅt%j~H fHnHc G HSH0HLJ|t H?HtnWHC 1C(C[Ht PHC1Z1ATIUHS1L9}H|H[H]A\HA Hf&f&H8Ht PZH01LO$19~-HW8LW@L L MMtMMxMMHLHcAFuE1D9~J J IHcHxH H HHGHP`1Ht 1HHGHH; H@@!1H= @@@שHc= ˩H Hcx黩HtHG(HX HGxAHDW(AHH H@HIE1H~+9DD9~1)yt>DYHHAEAH9tD QHEȀ|QtDFDfD$fL$(d$fT$f\$fXd$)d$L$D$fL$fT$f\$(L$fD$D$T$fYT$f:fYf)T$L$D$HG0HtHHGHwP1HwX1HW1HtHzHt 1zpH H= 11H8HtHIRAEuIx<H(߫HGH H XHGHXSH HXHt'HOHGHHP0`HX`[QHtHLGHwL(1ZP 1ZPH1ZPHHC HZHt PH1Z1AUAATUHSI1QJD9}LIPXH[]A\A]&UHOHHWHAHH H HAHGHgHHtHEHuH]4UHOHHWHAHH H HAHGHgHHtHEHu[H}HtHEHu@Hc59W&O~LT&I,]=W&H]饧UHOHHWHAHH H HAHGHgHHtHEHuHc5eY&O~LV&I,]=KY&H]1UHOHHWHAHH H HAHGHgHHtHEHuXH}HtHEHu=H]ĦP 1ZSHHHtHCHu H{HtHCHuWHC 1C([HHHtH@Hu P1Z1HHHtH@Hu P1Z1HH(HtH@(Hu Pr1Z1HH(HtH@(Hu PL1Z1SHGHHtHCHuHHtHǃHu1[SHHHtHCHuH{HtHCHuH{ HtHC Hu1[Ã= u H HPm Hx HZHGH|0Hu Pg1Z1H~Hu PQ1Z1USHQHt?Hu 1H5>tH5H+uoH5HuTH5oHu9H5G[HuH5;HuZ[]AVH0xH5iAUfHnfHnL-)ATfInL%vL UL?H-UfI:"H= fHnHw(H LHfInHLfInH$L%ц"fH:"HDŽ$fH:"HLHDŽ$fH:"fI:") $fI:")T$$$$$L5s"(HLu%(HH="{HYL$(LLRu%(LH=τ":HH=CH5I(,$(fHnL LLfH:"fInL)"l$X$(t$H"fI:"LT$PH$I0H$LT$ $t$hl$(t$8A1EHt$P(H=@"kA1EHt$ (H=܃"GA1E(HH=B"%1uL-^"(HLuH(I}0HLtFL$(LL1u&L(H=-"HHEH]A\A]A^P1ZH KH5L ;fHnLfHnH՞ H>LfInL[sfInfH:"fH:"fI:"fI:"'QH EHcH111 o 11o 11o 11Ҿ1n 1Ҿn 1Ҿn 1H+"H@"H" ""("1"ځ""u[PHق"H"H" Ă"͂" ց"߁" ""u P11Z(?"HH"HGHG)""H+"HC&HTHDPHQ HZø陕H1ҋ  HuH1ɋ<HDCHc HWÃ1W>H=#CHcH_Árvi-W>H5BHcHh^-|Áiw{_vj-aW=LuBMcMAhOÍ wj-W!=LBMc MApf5DA wi-g W<HAHc HkRÁw e -f ;L\AIcLRL+!?WÁo w{e vj-g W^;H=@LcIALrX'Í wi- W:H5@HcHQ0&DÁx e vs-f 9H5/@HcHc HU{a0Í wj- W7H=>LcIAbA7UD0A wj-Wr7L,>McMA`l;"!6O!-P!9L=IcLWO5xG&am<kzA05|h-j5L P=McMA1n5Rvl;!ÁIwz?vi-AW4H5<Hc9Hc*Y^$*7X *wRQV)w-S)X)z^)^)?ƽ _q)_])f _I)bs,)wdLc)wb)a`g(o(8~v((Á5/vJ-1k(L7IcLCÁ)vi-!W(H6Hc HbX'v +!'w9'0'x'k'LW'w^FA'RIx$'-'WDYA wo-&L5McMAP/ο%CںÁϩvs-Щ)$H[5Hc HͿKqW&W-Ш9weH55Hc3HcHi ÍWwT- %L2Mc MA B!pƵDA wi-1 WH2Hc Hܮ`GÁ&vo-5 H=I2LcIA#ʰ @GeʯSw1QRk̭kTNwÁ;/v{-1W  L1IcLq^T#r زÁ-$cH=1LcIA.k2OͰsi8WÁwzvi-WH0Hc H pWDA wj-7W'Lm0McMAvl;!ױÁsvj-WL 0McMAiÁwzvi-W&H5/HcHvl;!װDA wi-QWHY/Hc H qXÁYw{Ovj-QW%H=.LcIAtj9կÍ@ wi-WH5.HcH qXÁlO-QWH5;.HcwE (9  #87mbϣ;S¢V}|B~}|{2qpodcba`_^}|{zyxwvlbaHWVUTSRQPONMLKJIHGF<;:987654;:9876ՙ,+! Ҙ 4<w~[J)8/- 6՛̛Wߖd8ϝ\˖8/&ulWM;)`؜?neSJA/~ݖl Qޙՙ$ÙA蘝PHBA@t H 1Ht H0HH” G$GH Hy H:1YH HXHm HXHX HXHHB HXHHGH;H H;^ uH;ؕ tHXFHWH HXHrH@H=tHHH@HHH韨门Ë/ u3QH=[QH1HtH5~_[ ZHS Sdt Hc[VfHt1[SH\t Hc[UfHt1[AWMAVIAUIATIUHSHDH(HL$HT$Ht$#ZLMALHL財Ht$uHL$HT$HAn HA H|$H|$ H(D[]A\A]A^A_HGH1Ht7H Ht/U1HPHHu 蘒1 H|HP]H HXHLL; ɒ tMuL@MtLLLPLLXLHHtHH6HtHMtIATfHnUfH:"PH HXLIiMIQMaAL LZH]A\HG HSH HAWAVAUATIUS1H8HHI<,tHE1HH& E1E1LK<(IMtIIL|$1LLuHH9vA[HsH==$HdHtHÍ H3H95=$t INHHHMJ<(H- LHw=$E1HEL1nH8D[]A\A]A^A_H(IWHL$Ht$)D$H(I1LI1ALIpI1HALIPI1ALAp1|$1|$1|$AUIATIHHUHt1L!LHuHULHL5 L]A\A]H<$H<$HPI8 (1( :Aǂ(HIBIǂIB AǂAAAZAWHP'H lAVAUATUHSHHK5"H9uE1H9 $6"A E1H9AEj@ H1H5wE1E1赙1HE1H$H$L%AHH$HH$%D9IHtoIE`tH$HHMpI9vADEt0y$D1HHDHD)HHAI0tH aHH= wn跕E1E1Ll$HD$MHH5UHD$D|$$EMLܸSMt|LܸHܸP1APILD$HMH|$8L$@?LL$HIk0HHT$Z1Y|$0HHH|$(IIIH56UIHL$HH!gHH H\$Ld$0ED|$$Lt$@Ll$(m`H%H5TH薙H%H5UHH)}H%H5THgHH5UHUAH1HULWHLHH$H _HT$0H5THHT$(H5THIDᾀLAIHT1{WDLHH 踘HT$H5THI衘HT$H5THI芘H$H5HuHItH5THIT`HD[]A\A]A^A_UHHSfHnHHfH:" )$[S K ( $ t@HsHt Hs0HsHH{HpHxHE1HH]MH[]AVIIɾAU1ATIUH͉SHTHL$IL=VLLﾀHT1$VHcLLHaH[]A\A]A^Ë&0H5SK-%H5S4f%pH5S7%(H5S@%0H5S%8H5SؓAVL5SAUATAUH-%SHHĀIDLL1=UBTLHHK HH(IHH IHHoIuH[]A\A]A^UHӊHKZHÍHgH#H{@H]鲒SHڊ H;t H3 \H;OHj H[PI HAA@I@I@ZATIUHRt-u/ HNEEHUHE M v XLH]A\S ATIUHSHH|$y Ht$HHoHL$Hƒ9u;"tHH9wA$1H[]A\ƍHH18 P蒈ZHciJH @Hw @ AVIAUATAUHH8Ll$1AL/lMuHu*eH=3$hLσH3$HuA=H=3$hH觃H3$HuH=3$AhH3$L1zH8D]A\A]A^H AHcPHH|PE1PDP1  1Z G 1G HY H@ HHI Hhg HHHHHHHHHHHSHHHT$Ht$NcHcT$~D$fH:"H[H1H|$ cAEuD$ y|w H{1BPBZfH~ Hht Hpؒ1ATUSH@HuH5Q E1HXLOIApuHK\II~ K\H9sABHl$H艆uHHzqHATEuHӄ HXHJHYpH@D[]A\QUHtZHtUH2 H]IfËAUATAUSQHq Pt@LpLzt-HXE1HtHhHtL袑E1H9AZD[]A\A]UHSHQ蟁H EDtAH YR1H(aSzx"L AH 3R1H>-zMu"L AH R1H?zLO8@tSM9t"L AH Q1H?yL_L9_0tQL AH Q1H`yM9u*L nAH Q1Hj>yLG(uSM9t"L 6AH QQ1H?KyLOL9O@tIL AH %Q1H|`yM9u"L AH P1H>xH8u)H0t"L A H P1H>xH(u)H@t"L A H P1H>x tHwH@t Hw0HwHLGE11I9~(uDuDNDE9EBHӃ@uWAw"L AH P1H+>xAL AH O1H >wAL A"H O1H=wuZAw"L dA%H O1H=ywAL 5A&H PO1H=JwAw"L A)H %O1H=wAv5L ߹A*H N1H}=vB<t5fB]A\A]HH1HNATUSHoHH}upHPtiHXHE1HHoHHHSHsPH{XHBHJ HHEHHM HHu(HtLSo ILE0HH}8HEHKHsHHt1NI1 NIHMuH mL[]A\ATE1USH1@oHt+HKHsHH¿1MHMIuHlL[]A\U1SHH="]QHm HX14AExHtHHH1Z[]Qy1ZIXU1SHH=\QHnm HX1ЧAExHtHHH1Z[]Qy1ZHXAT1IH=:UH1SV|y[1H=:]A\0GHl HXH{HHtHE1H{@HC8HCHS0CLc8HkHMu 1H{@K0[]A\úpHf IHIHH5H811HHf IHAPIHH59H81g1HPH"n AQIHH59APIHH8191HHHT$0HL$8LD$@LL$Ht7)D$P)L$`)T$p)$)$)$)$)$HT$ H$1D$HT$HT$D$ 0HD$+HAWAVAUIATIUSHHHhm T$H+H !=$HAH=8$fsMt$HLRHH=I=sMt HLQHH=8sH >H}HH=u8rL=j IWHtH5p8H1uA Ht H=b8rrAtH=>8rSAtH=08`r4A?tH=!8BrH=*rH =H|MXE1MtM}=jHII9 ˆT$Hl$(HT$8Ht$0HHT$Ht$1WH|$(H=J!$IHH;j HT$Ht$HUH|$8uH i HHL$8H|$0Ht$8gH|$(HteHl$8Ht$0H|HH|$(bH|$0XH|$8NL11H5I!uHHui HurgH;-ci u#H3 9Hg LGHMt9H%Hd1H6H3HH=6olH[PH=6XlPH= 6KlR>u H=W5lXATIUHPYLH1]A\sATIUHSHIHH[]A\sPH=5kAWAVAUIATI1USHH( Ht$1L|$Ƅ$ (HeuHھ Lk5HHu1H$=| Hu}#t1L+HHtLt$HH5L`HHttHt$nuf1LH5`HHtMH5nu=H5]L1`HHt$IULw HCDG HG H( []A\A]A^A_ATHIc LA\AUIATI1UHSLH8H|$kH|$t(L$(T$ MULLHL,$H\$, Hy%H5bH;EfHnfH:"EH8H[]A\A]ATL3I%M LA\ATII1H H|$H$HLD$LD$ H LA\ATWIH H$HHL$D$ H LA\AT1Iw LA\ATIH H$HD$HD$HL$ H LA\σw0HbHcHHxHeHeHfPH==*hHCH4USRHu H=ShH d H1HPL]H9t H=ShXHHH[]鹍Hc UHXHu H=SihHHHH]19 x+USHPC{H"H>ZHc[]P&Ha HUCHvHo>Hd H]Ht^ATUHSH0?tELd$1LHH^ H;DHU1LHVH;u H=>SgH0[]A\HtaATUHSH0?tHLd$1LGHL^ H{ kDHCU1LHC VH{ u H=S2gH0[]A\Ht\ATUH1SH0Ld$LIGH] H{( DHT1LHC(3VH{(u H=RfH0[]A\ATUHpRLhMt HgoIHlTHTJt H=fMtLHHt H=!-dfX]A\PYIH@pZATUSHH0?Hl$1HCHHpF;.Lc(HC..ID$($.1HHC8VUH{u H=(ReHC(Hx(u H=AReH{8u H=^ReH0[]A\PH=/eHIHT$0HL$8LD$@LL$Ht7)D$P)L$`)T$p)$)$)$)$)$HT$ LD$L1HT$A1H$D$D$ 0HD$lEHATIIIHHL$8LD$@LL$Ht7)D$P)L$`)T$p)$)$)$)$)$HT$ LD$LE1HT$H$LL1D$D$ 0HD$DHA\HWIH5NHuH5HHH=X.1-,HOHHuH=\.1,HAH=PHP1+DG(HEuAHJhHrpHtHAtH=P1+DH=P1+HHHpHtHVHDL@H1IH{+H5PH5PH5-H5-SHHQHSHHzuHRH="1[)+H="1[+Hw8H1H=-+Hw8H1H=P*wH1H=P*SHHQHSH=r-[H1*Hw1H= *HO HW1HwH=H-*HW HGHt"HRH5HtHpH=mP1^*H5HtHpH=-1@*HOHH9H T^ HAH=-HP1*Hw1H= -*HG HH5/H=,HDHPH=,1)LG HGIH5HOH=,MHPHDH=O1)HIIHL$8LD$@LL$Ht7)D$P)L$`)T$p)$)$)$)$)$H5AY HT$ LD$LHT$H$LH6D$D$ 0HD$藰HUHHH=LOHE ]HPhL@p1(UHSHQElHtH;\ tH1H}PH]P Z1[]AWAVAUAATUHSHt H5 O\H[ HL=+L%aL5R`D$dH5i+HH'HV H9SkHk LD[HHMhHHqLDc[HuhD7LDG[shHl^H5p%DD$ $[DD$ EIcDH5oDZHHupHLNAt{DH5hDZH[HtkL$H5I*HD[]A\A]A^A_ZLDrZ&LD]ZMLDHZxH[]A\A]A^A_úAWAVAUATIUSQHu+pZHMu*Hu!L-MIHuHHuLcLL=)AdYL5)IHI9uLY LYIH5N)kYL1҉2LgUIHt7H5HrHtHtP Z1H9UH5!HHHT$Su H&eHD$HD$H]AWIAVIAUATUHSHfHbIE1LL$ L9~4KAAVACBAUATAxV4UHo SDoA]HcH,HAx&H}H rAUL1H1IIHI[I$|]A\A]A^AUATUSHL-#AEL,$QHuH,$L-#}HXHl$HtMceH#HMk MID$ WHS fnf8=fA~D$HHJhHt|HqHL$tjy ydH=r#H%XHt L@LD$6H|$E11HHH=9#1yH|$HuQO LL$ML$ EULbK AEUE;SH[HWH=#HHEWIHt LhL,$qL$$H= #AD$HcHk HH#HD$HtEH4$HHE1H=#HT$0Ht$yH=##H4$L,$HL[]A\A]HG(Hx HtHJP HHG(HxHtH-P HH=S7H=H=H=vAVAUATUSHHuE1tHIE1Lt$A9}31LLƄ$iGHt$t< uALNxH|$IHu111H4HL[]A\A]A^H=MQH=2>MHtHHuZ5MXPZHPcZHAT1UHQHUJ H0Ht6HpHIH@H@`$yI $uLLE1LZ]A\Q`!HuH I H5CH8Q1ZAUATUSHHXHHuHu AeHOHHuLmI H5BAI8ZQ9LeMtIHLAAąuH|$H4$HuH;LKHXD[]A\A]AUATUSHHXHHuHu A5IH1LIAąuH $Ht$LHMH3KAHXD[]A\A]H]@fSH5BH4 A1EtHC[SH5.BH4 A1EtHC([SH5NBH4 A1EtHC [USQHuHG H5`BH8P#HH5yBHq4 AEtHk1Z[]UHH5BSHQG4 AEtHk1Z[]UHH5BSHQ4 AEtHk(1Z[]UHH5BSHQ3 AEtHk 1Z[]ATLgMuHH8 J1ZHA HH~u Ht"HztPHA H5>H8I1ZHF HUHH1SHQA1EtHHpF HZ[]UHH1SHAP]t!HӉŃt YHc[]RHtZ1[]HGHHuPH ZF H5>H9+I1ZHHuHE HAUL-G ATIUHGHL9t H;QB u&I|$EUuE1vMd$I<$L%E HUH;B tL9uH}UtHmH}H-pE I$HLHE.I $IuLTCHMuHFCL]A\A]AUL-F ATIUHGHL9t H;A u&I|$TuE1vMd$I<$L%D HUH;hA tL9uH}XTtHmH}H-D I$HLHEo5I $IuLBHMuHBL]A\A]AUL-FF ATIUHGHL9t H;@ u&I|$SuE1vMd$I<$L%5D HUH;@ tL9uH}StHmH}H-D I$HLHE I $IuLAHMuHAL]A\A]AUL-E ATIUHGHL9t H;/@ u&I|$#SuE1vMd$I<$L%C HUH;? tL9uH}RtHmH}H-NC I$HLHEFI $IuL2AHMuH$AL]A\A]AUL-D ATIUHGHL9t H;y? u&I|$mRuE1vMd$I<$L%B HUH;F? tL9uH}6RtHmH}H-B I$HLHE I $IuL|@HMuHn@L]A\A]AUL-$D ATIUHGHL9t H;> u&I|$QuE1vMd$I<$L%B HUH;> tL9uH}QtHmH}H-A I$HLHEI $IuL?HMuH?L]A\A]AVL5&> AUIATIUHSHGL9t H;OC u'I}PuE1MmI}L-VA IT$HC H9tL9u!I|$PtMd$I<$L%A Ht-HML9tH9uH}PtHmH}H-@ IEI$HtHEHLLIMIuL>I $uL>H_[L]A\A]A^ATUHQHGH;YB t H;= u"H}E1Ot/HmH}H-\@ HEHX HMIuHG>LZ]A\ATUHQHGH;A t H;< u"H}E1Ot/HmH}H-? HEHHMIuH=LZ]A\AUL-A ATIUHGHL9t H;9< u&I|$-OuE1vMd$I<$L%? HUH;< tL9uH}NtHmH}H-X? I$HLHEI $IuL<=HMuH.=L]A\A]AUL-@ ATIUHGHL9t H;; u&I|$wNuE1vMd$I<$L%> HUH;P; tL9uH}@NtHmH}H-> I$HLHEW$I $IuL HUH;: tL9uH}MtHmH}H-= I$HLHEI $IuL;HMuH;L]A\A]AUL-x? ATIUHGHL9t H;: u&I|$ MuE1vMd$I<$L%g= HUH;9 tL9uH}LtHmH}H-6= I$HLHEk)I $IuL;HMuH ;L]A\A]AUL-> ATIUHGHL9t H;a9 u&I|$ULuE1vMd$I<$L%< HUH;.9 tL9uH}LtHmH}H-< I$HLHEU7I $IuLd:HMuHV:L]A\A]AUL- > ATIUHGHL9t H;8 u&I|$KuE1vMd$I<$L%; HUH;x8 tL9uH}hKtHmH}H-; I$HLHEO I $IuL9HMuH9L]A\A]AUL-V= ATIUHGHL9t H;7 u&I|$JuE1vMd$I<$L%E; HUH;7 tL9uH}JtHmH}H-; I$HLHE 7I $IuL8HMuH8L]A\A]AUL-< ATIUHGHL9t H;?7 u&I|$3JuE1vMd$I<$L%: HUH; 7 tL9uH}ItHmH}H-^: I$HLHEcI $IuLB8HMuH48L]A\A]AUL-; ATIUHGHL9t H;6 u&I|$}IuE1vMd$I<$L%9 HUH;V6 tL9uH}FItHmH}H-9 I$HLHE} I $IuL7HMuH~7L]A\A]AUL-4; ATIUHGHL9t H;5 u&I|$HuE1vMd$I<$L%#9 HUH;5 tL9uH}HtHmH}H-8 I$HLHEI $IuL6HMuH6L]A\A]AVL565 AUIATIUHSHGL9t H;_: u'I} HuE1MmI}L-f8 IT$H*: H9tL9u!I|$GtMd$I<$L%/8 Ht-HML9tH9uH}GtHmH}H-7 IEI$HtHEHLL(IMIuL5I $uL5Ho[L]A\A]A^AUL-r9 ATIUHGHL9t H;4 u&I|$GuE1vMd$I<$L%a7 HUH;3 tL9uH}FtHmH}H-07 I$HLHEI $IuL5HMuH5L]A\A]AUL-8 ATIUHGHL9t H;[3 u&I|$OFuE1vMd$I<$L%6 HUH;(3 tL9uH}FtHmH}H-z6 I$HLHE?I $IuL^4HMuHP4L]A\A]AUL-8 ATIUHGHL9t H;2 u&I|$EuE1vMd$I<$L%5 HUH;r2 tL9uH}bEtHmH}H-5 I$HLHEiI $IuL3HMuH3L]A\A]AUL-P7 ATIUHGHL9t H;1 u&I|$DuE1vMd$I<$L%?5 HUH;1 tL9uH}DtHmH}H-5 I$HLHEcI $IuL2HMuH2L]A\A]AUL-6 ATIUHGHL9t H;91 u&I|$-DuE1vMd$I<$L%4 HUH;1 tL9uH}CtHmH}H-X4 I$HLHE}I $IuL<2HMuH.2L]A\A]ATUHQHGH;5 t H;0 u"H}E1|Ct/HmH}H-3 HEHzCHMIuH1LZ]A\AUL-5 ATIUHGHL9t H;0 u&I|$CuE1vMd$I<$L%o3 HUH;/ tL9uH}BtHmH}H->3 I$HLHEI $IuL"1HMuH1L]A\A]AUL-4 ATIUHGHL9t H;i/ u&I|$]BuE1vMd$I<$L%2 HUH;6/ tL9uH}&BtHmH}H-2 I$HLHE=0I $IuLl0HMuH^0L]A\A]ATUQHH?HH-52 AAtHEHHMAuH0DZ]A\ATUHQHGH;3 t H;p. u"H}E1bAt:HmH}H-1 HE11HH5:!=HMIuH/LZ]A\ATSQH- H9GtL , H5)I94(Iu L0 HH5)1I8bHm0 HXH9tH=/ H5)H?740HOHHu.H1ID$AD$(Z[A\QH5- H9GtH+ H5(H:3XG(HtLc/ H5d)1I81H / HXHHB(HrHHZPH/ H5C)H8c31ZH(D$HBHD$HWuH ~* H5#H9'31HWHLD$HwE1H(AWAVE1AUATIUSHHHHHt$L|$(DD$0IM9}dHt$0H|$8LT$Ht$HHT$(Ht$0H|$8HD$RHL$HtMtKL H uHO-ILH@8(t$H) H5#H:HH[]A\A]A^A_62@tHHHH[]A\A]A^A_HO(HWHwHtH=x1=HO1H=>+HWHwHtHO1H= H=1HOHW1HwLG H=bL]H `1H`H5aH=cHW Hw1HJH+O0H=Ha- H=91qH:- H=1JG <H Hc4HH=GH=;H=|/HH51H=3>HTH51H=Ź>H8H5b1H==H HF1H5IH=D=H- H1 ATE1SQH(u5HHC(HuH+ H5&AH8/HCDZ[A\HuPH~+ H5H8/HZHGUSHQHoH5( H9t?HH;-G. H;-( „tuH' H5H8t/HsH>@H;54, AD @Z[]HWH9rPHd) H5VH:-/1ZHu HO(H`HBH9u HO0H MLG(III 0Iʃ?II9~HMIr#HJtH HL)HxH?HDHHW01HtiHG HO(H9H8t#PH5pHG0H=!* H?y.1ZLGHwHJDIHW0LGMyH~LHG?LOHÃPH% H5OLH8.1ZHGHHQHH$ H5&LH:-1*ItH$ H5@H8-1 H( HZQHH$ H5KH:-1*ItH$ H5H8-1 H' HZATA_pIUHSHA_pHH H9v6L(* H5/I89-HHIIN Hiʚ;1Ii\$IMI)HI9}L) H5/LI;,H][]A\AUATUHSHHu2HMHAuCHH5H=J<1HֹH=ZuOHt$HdIH6HH;D$uWHMHQu!HH5H=M;16HH HHHXH;$tL" H5zI:+1H5LH%D-%t>H52LHߘ%D-ۘ%tL l" H5!I9m+1H55HWtEH5*HDt6H5+H1t#H " H5!H9+1=1t$D9tH=! LH5!1H?A1 H' 3HH[]A\A]ATLgMuH! H5EH8* L%$ I$LA\AUATUSAPHH~" H5!E1H8l*I1Mu+H } H5VH9#1H9w܉[WH3 t1YRHt1ZSHg3 t1[@Ht1[SH23 t1[@Ht1[SH2 t1`[@JHt1[SH2 t1 [@zHt1[UHHSQHHt H}Hu3Ht1/8HxHH| HHH9HNHUH HZ[]UHHSQHHtH}t 1HHHH]yI1Mt H HZ[]UHHSQqHHt HEHu-9I1Mt&HH|HPHH9HOHUHR HZ[]AWIAVAUIATIULSHAQH L5% L9tHGuIHEL9uH?HsH!I$!HWtH HHHI$IL9uH}ILIMM"LGAtfH<HHHIEI9]bI9$XH}Z[]A\A]A^A_HQ H9GtPuH=ZHWBH% H9GtPkH=U1ZHW1B uHGUH5G HHH9t t H1]ק+ H={(1]ATE1UHQH/,t/HmH}H- HEH]HMIuH|LZ]A\H ATH8tAH H:AąuDA\ATUSHHHu2Ht(H AH;t2H;H5!H4H+E1HCHCHC D[]A\AUL- ATIUHGHL9t H;' u&I|$+uE1vMd$I<$L%w HUH; tL9uH}*tHmH}H-F I$HLHE I $IuL*HMuHL]A\A]AUL- ATIUHGHL9t H;q u&I|$e*uE1vMd$I<$L% HUH;> tL9uH}.*tHmH}H- I$HLHEI $IuLtHMuHfL]A\A]AUIATUHtHHu A-AHHtHL!HMAuHD]A\A]USHQHu.H`uH. H5H:HHu HuLLIHN 6M 8L]LKD3ID:M9uHHu 1,H;1H}I9tHkPHHjH[]A\A]A^A_ATIUHHP AXLH]A\H. H=#StXH#Hu H=0=#~'H={#1H1c#H H1E#[ATUSH+HH{8HS@Hu 蔕HS@H9*uLb HRHuE1HMuHH{8XL[]A\AUIATQIHu%6HuHLH5hH81LZA\A]PZHAUATIUSHQH-fHXH}Lh"IUHtIL9u:LHtHHH}L號HHHRH}w1Z[]A\A]AUATIUSHRLnHImH9uHkHHtHSHPHKHtHWI|$I]HtHLe H8LX[]A\A]ËxZAULHATUHHf LXLLt1H`Hu H=LH]A\A]SHAExH{(HCH{(W1[AUIATSHyAIHtPE1fHH{oLc Mt LHyE1 I9tM$$H{MuHLH5PH81L[A\A]ATUSH?HuHtiH{UHt[L%1I$XH;BtHpI$P+0HHC HtH;H{aHt[HI$P]A\/[]A\AUATIUHSQ LHH1IT$ HHEHuHMuxHACnLHHMAuH(EuLHsIt$HyL vH5.I9I|$u"LVH5I8LAZD[]A\A]HH= PS{ HHZUU茻Hu]QHžHHH=2Hu"H腸HH5H8o1'H>HHNHH]ATASH(H8{HG@tHH|$H=n#{ H=n#t&HT$ D$HT$HT$AIHT$-IMuA2HtH nn#HqID4E1H=cn#H(D[A\ATUHSH(HHH} HHHu []A\HXIHH8 L[]A\HHH9WtGO!HATUHQHGH;t H;Ru"H}E1D t/HmH}H-HEH貹HMIuHLZ]A\H8逬ATUHQHGH;6t H;u"H}E1 t/HmH}H-9HEHeHMIuH$LZ]A\P_ZHc]ATIHUSH HHHy&HH5=H8HMu]HSHL$HT$HLLD$R HMuHt%HL$HT$H=1Ht$H []A\H 1[]A\ËW0G4HcHH|?S]t Hc[~پHt1[HISht Hc[T课Ht1[P`ZHc7PZHc(P|% HD$ D$ZD$ L$D$-Hc|$HHHcxHc(P@HcZATIUQHHtHH"HMIuH!LZ]A\HPHWHHHHH<eHu5AUATUHGHHHhHt HQHHt]A\A]HAHt]A\A]HtPHIHtcHH5v I $IuLtL;-Mu1IMuLZHuH=o1E1HVH?H5跹L]A\A]HunAUATUHGHHPhHtHBHt]A\A]tKHIHt^HHFI $IuLL;-Mu1IMuLHMH=1E1H5HQH?L]A\A]HGH`HL@ tHWXHtHrMHtL ODHtLW0MZHIIMLH`HtPHFH5H81ZHW HBXHJPHqHpBB HH|-HHGHW HH HHcxZHGH8L@ tLGxLVHH5H:(tHH5<H8 HYr1ZVHHpH5H:q(ItHRH5mH8S HY'1ZSHHHt$t8H\$HH H% Ãt H[鏡芵HtH1[SHHHt$rt+H\$H 0 Ãt H[FAHtH1[SH t[Ht1[SH t[Ht1[ATL%,YUHHHHD$u11LD$LHVuHLUu1 H|$H]A\SHH=ۿHt?HL@HpHHAHXHyfHnI H7fI:"@Hq[ATL%UHHHu"1LD$LH裘u8HL袲u'Hl$HuH4H5H8%1H.H]A\ATSHQV%tHS%qV%HL$L3 H=jվIHtDML$MD$I\$H HAHHwfHnI LfI:"AD$LGLZ[A\Ë[S%ATUHSHtHP%>S%HL$L H=OBIHt[HEIl$HtHML$MD$I\$AD$ H AHHwfHnI LfI:"AD$LGL[]A\HH=11ĹSHH=贽Ht?HL@HpHHAHXHyfHnI H7fI:"@Hq[UfHnHSfH:"HHH=)$FHtS( $@ HHEHtHH/L@HpHAHyfHnI H7fI:"PHqH[]-AUIATAUHH* t2HmH}H-HELHHMAuHtD]A\A]APHFH;t H;u^*t"Hc^&HHtY'1ZAUATIUHFHH;t&H;tHHtl]A\A]LH)tRt3HuLIHt:Hu HI $Iu(LH LH5I1H9E1L]A\A]AUATUHSQH9uHWH/HzLfHH5I9t\L-M9tPL4uDLL%u5H5 I9t)L uH5I9tLuH#HEE1HtL`HԸHt\L9~HHHuEEuDHjIHtNLHI $AuLvAuHMuHb1LH=JA)ZD[]A\A]AVAUIATUSHu SA`LGIXpHt@H{t9HHIA蝎HHt2LHLSHMAuHLH=Ac)[D]A\A]A^AUIATE1UHtHLHDHMIuHcL]A\A]AUIATE1UHt$HźLHrHMIuH!L]A\A]AUIATE1UxHt$HźLH0HMIuHL]A\A]ATHGIH;^u yI$=SuE1/tA\:H HPH51E1H9LA\AUATIUSQLoLHu1+uGH hHP1H5H9賟HMt81HH1L9}>I|HGH;uH#HHuHMuHH|HZH[]A\A]AVIAUIATIUHAQbx2Lbx&LbxAXLLLH]A\A]A^Z1]A\A]A^AUIATIUHhbx$HuLHL]A\A],HDby]1A\A]HHPHp8fAVAUATUSHHGHo H9|H11[]A\A]A^HWHH)L,HxH9HOMdHSXME4$A$MsJ{KPHL$QE4$ZHHYLHIHSH[]A\A]A^HGHtHgHATHHT$y E1H|$E1HtHAuHGP0HDA\Q A1Eu HiHZSH A1EuH;HtH[HH H5 H91RtHH5<&H:12H8Hu HHHHT$H0tHD$HAT HtHHAuH@P0E1DA\AVAUIATUHAQLwMMtLLfIHu9Ly?H@HHtHUHAXL]A\A]A^I$H}LY]A\A]A^ZL]A\A]A^HHtHH0۞PHCH5dH:1ZVHH rH5H9s1EItHRH5VH:S1%HPHu HHHH0YZZATUHQHGH;t H;mu"H}E1_ t/HmH}H-HEHݧHMIuHLZ]A\AWAVAUAATUSQ Ht:ILp8Au1xXt+H5L I9~I $uLP1ZLL諮DH5tAtIt$H1HH H3 HMIuHMM|$`MtILgHx~HHu聎IMLLHoAMImHAT$\1L'J IMHuLvHtrID$PAT$\Lm81HEP9~IL$hLEhH4I4HLAu 4HExH LL脘yHMuH1I $uLZH[]A\A]A^A_AWIAVIAUMATUHSLH(H4$HuH(LLL[M]A\A]A^A_N H:IH1MEMILDE1IOMLMMII+HHI9~cHMuIH4$IVML\$LL$HvHL$DHL$LL$HL\$uIuLE1IUHxHUHH(L[]A\A]A^A_HHpH8KUHuHH5mSH8HH HHt H]镢1]ATIUHSHHHD$HwM /1ҹLH=E]u1]H;Ht$htH]Ht$HuH/H5RH:0&HE H+EHxH9~ 1HHIHHHH[]A\ÃtttPH= 19HI1LD$ 6HHMLD$ n6H1- 1 jAPHuH=@3HHtHPtHyH=fYZHG(Hp H8ٝSHH< t@-%=uS莙I1Mth@d=@t5@l=t+@b=`t!@c= t@p=t =@s?EAA؁A练rAEA@AA EZwssൃx1҉A@AA AۈA AEA|$AArAA1҃D҃wA ssᵃxAAfT$L$ A练rAEAAAwA stൃx@|$ H|$DT$ D$ H[HG HuS HSH A1ExHC8H[Q yZXATE1UQ` HtHHHMIuHLZ]A\ATSHH=I#Q9Ht{Hc;IHc{ID$ Hc{ID$ Hc{ID$({ID$0rHc{ID$8ԽH{ID$@ƽID$HHtI $uLYE1LZ[A\USQvHH=j#H菸Ht'HuH-HuH HEHhHHX Z[]AVIAUIH5nX!ATIUSHG1H襑H蝧HH9}I|HuHLAՅt1[]A\A]A^AUATIUSQ:VHtHxHcHHE1:L%HHu L}IHLL)H识HuHMuBH8HMIcՃ;Ht LcAHH=w w tH=ՔH=HMuZH[]A\A]X[]A\A]UHF HuHt]+HH萷u]HHXHuHH=-g#@UHޅHHtHHMu H]?]QH=5 F E1HtHPt E1HxADZHH5?,"HT$HD$HtHPuHuHѿ1HATUHQHu!dE1Hu'HżHH8HHAu腿DZ]A\AVE1AUATUSHH9uLA>zKLH >Hu HEXLuMuHMAuC9Iu H}IE1M9}J|HAąuIE1HMuH[D]A\A]A^þMAUATHHH9GtH=! IHHu@H=E1lHT$H5d"E1ILLHH=[1THMHuHZH[]A\A]Ã3QHڮLtH5?Lҷ!H5LHH5t_1ZVHH5H:获/tHoH5 H8pH H5Y 1ZQH511!謸HtHPHHDZSH72HB t HB [H=)%SHtH{H5)%[H=IH)%Hu[1xUHSQAAt.HH9u 111HH= HH1Z[]AVHAUAATUSH H$~IHuIHcHiHHtNE1K芤IH&HH5H_I $AuL EH=Hc?CIHHH5+~HE_I $uLŨLIc8IHHH5}H_IAuL耨E]L Ic9踣IHTHH5}H^IuL;LԩIc:tIHHH5}Hv^I $AuLELUIc;-IHHH5J}H/^I $uL诧HhHc8IHHH5}H]IAuLjEGHjHc:袢IH>HH5|H]IuL%H ^Hc9^IHHH5|H`]I $AuLߦEH5Hc>IHHH5t|H]I $uL虦wH=jHc?ҡIHnHH5C|H\IAuLTE1LĩIc8茡IH(HH5 |H\IuLL Ic9HIHHH5{HJ\I $AuLɥELIIc:IHHH5{H\I $uL胥aLIc;輠IHXHH5{H[IAuL>EHHc8vIHHH5U{Hx[IuLHZHc:2IHHH5*{H4[I $AuL賤EHH5|L[HMuH肤]H HHx{HHtWHH5zLZxCHMuH;fHHt&HcrIHu,HMu H1 1LE1RHRHH5xHLZI $AuLˣExHc IHtHH5mxHZI $AuL菣ElHcʞIHTHH52xHYI $AuLKE(Hc膞IHHH5>xHYI $AuLEHcBIHHH5UyHDYI $AuLâEHcIHHH5)yHYI $AuLE\HcIHDHH5xHXI $AuL;EHcvIHHH5 +HxXI $AuLEHc2IHHH5LH4XI $AuL賡EHcIHxHH5'xHWI $AuLoELHc誜IH4HH5wHWI $AuL+EHcfIHHH5wHhWI $AuLEHc"IHHH5wH$WI $AuL裠EHcޛIHhHH5MwHVI $AuL_EEHHtHaIHuL%I$LH5HfRI $AuLEHHtHGaIHuL%I$LH5lH RI $AuL茛EiHHtH`IHuGL%RI$LH5$HQI $AuL3EHHtH`IHuL%I$LH5H[QI $AuLښEHcHIHHH5qHQI $AuL薚EsHcLѕIH[HH5qHPI $AuLRE/HcP荕IHHH5XqHPI $AuLEHcTIIHHH5qHKPI $AuLʙEHcXIHHH5pHPI $AuL膙EcHc\IHKHH5pHOI $AuLBEHc`}IHHH5HOI $AuLEHcd9IHHH58pH;OI $AuL躘EHchIHHH5oHNI $AuLvESHcl豓IH;HH5oHNI $AuL2EHcpmIHHH5oHoNI $AuLEHct)IHHH5\oH+NI $AuL誗EHxHtH ]IHueL%pI$LH5 HMI $AuLQE.HHtH\IHu L%I$LH5nHyMI $AuLEHc3IHHH5nH5MI $AuL贖EHHtH\IHuoL%zI$LH57HLI $AuL[E8HHtH[IHuL%!I$LH57HLI $AuLEHHtHd[IHuL%ȗI$LH5mH*LI $AuL評EHcIHnHH5WmHKI $AuLeEBHHtHZIHu L%+I$LH5mHKI $AuL EHcGIHHH5lHIKI $AuLȔEHcIHHH5lHKI $uL腔cHH5jLJ]HMuHU[L]A\A]A^H SHufH Hu赕H [HEAUATIUHXHu]HH=:#A\A](h IH=L蟌HHuLH;YH-IHE%HLL)HYH}HI YHMt=Ht8HLL螥x&I $uL\HMu,H]A\A]I1E1LAHA]A\A]麔]A\A] AWIAVMAUATAUSLHt$Ll$Płf.-z@u>D$gD$Ht(IGH H5ɗE1HPH910dyT$A1ɉ\IHuE1YHjIMt+HLLaBHtHLLILvSHLYLI^SL3MtHL[]A\A]A^A_ATE1UQxHtHHHMIuHLZ]A\ATE1UQCHtHHӜHMIuH貑LZ]A\AWMAVAAUAATE1UHt%HLDDHHMIuHf]LA\A]A^A_UI1AHPH|$HT$ Ht$Hl$fHnLfH:"HHT$8DL$HD$(HcHP]AT1I1UgS賚HuAD$[]A\HHUhHID$ I9D$tIL$HQIT$L臿 uHHcL[H]A\QAUATUSHQLgMuHoH5H8pHcwHHu4E1tLH˴IMIuLMt I $uLHLIHuHMuH#HMuH׏dHuL%I$ZL[]A\A]PHIHpHL9IL-uZATUSHuL%I$ HH=A#11+GIHH;HHHH5 LY}HMuH#H{zHHHH5 L}HMuHH{H5;HHt[HH5 L|tGHMuH誎Hc{HHt&HH5_ L|tHMuHu1H=LE1=L[]A\ATUSHuL%>I$HH=3@#11EIHH+HuH-HEHH5Q L|tEHMuHH{>HHt&HH5 L{tHMuH貍HX<LE1M<L[]A\ATUSHuL%}I$HH=j?#11)EIHH;HHt[HH5 L[{tGHMuH)H{HHt&HH5^ L&{tHMuH1H;LE1;L[]A\ATUSHuL%I$E1?HH=>#11]DIHH{HHHH5 LzrHMuHTHkHuH-<HEHH5 LNz6HMuHH{H5HH HH5 L zHMuHԋHc{ HHHH5 LyHMuH藋Hc{$ކHHHH5h Lyx|HMuH^Hc{(襆HHt]HH5 L[yxGHMuH)Hc{,pHHt(HH5 L&yxHMuH1H9LE19L[]A\ATUSHuL%I$E1?HH=@#11]BIHtoHc{܅HHt^HH5 LxtJHMuH`HkHuH-HHEHH5 LZxtHMuH(1H8LE18L[]A\ATUSHuL%I$HH=V?#11AIHH+HuH-HEHH5 LwtHHMuH蚉HkHuH-HEHH5< LwtHMuHbH8LE17L[]A\AUATUSH(H,HD$H9uHHcHFIHLl$ uHH5&aH:11HT$Ht$LHGWtHT$Ht$Ly1H([]A\A]AVAUIATUHH5 SHH HHXx`H<$HtoHHuG11E1H9MHsLoHL/L |iHVMEI:1H5YYAH<$rlIHtHT$HHHT%IAuLEHL$HqHt$H9uMHD$Lt$HT$Ht$LL VHt$H<$YHt$uDH<$kaH=H9E~+HCHL$AH5H=`HP1H?XHT$Ht$HN~AąbH<$5H D[]A\A]A^AVIAUATIUHAQ sHt_H5 #LI觋u%HEH=LH5udHPH?1XtAXLLLH]A\A]A^o^Z]A\A]A^AWII1AVAUIATUHSLH(wLwAt$AMtIPHbHXH 4DG ADG D;[AAAtyAAAzHLLLAIH=RtLT$E1DL$HT$HT$DL$LT$pH;MtHULH5k~-1LAI6H It'HULH5LM1E1I;VI2LAIHLLLAIHLLHT$LT$OLd$Ht$HHD$t@H~K|$Lt L;A|$Lu.]yD$ bDL$EoHcu H1]鬟1]ATIUHAPuYLH]A\rZ1]A\UHu H1]S1]AWAVIAUIH=UATU|HHH5THoHMIuHi|M IHu BE11H@WLH@AeIHH1L16CHHtlH5yTHoI$HtTL莋ID$HHuA8Mt$L(ID$HtLV*LN*HF*1LE1wE1]LA\A]A^A_ISHHNH~L1HpH81BHt#HxuHXHHu H1{HH[AWIMAVIAUATMUHSHH(Ll$hT$pIt61IuMHDMIMMLDE1ۉ|$HL$hH4$MLl$h1Lt$hMIMIM;'HMtM]MxLLHMtMMxLELL$HL$xLL$$LL$H|$`Iċ$IH/HMHHHL$hIRINLT$MGP$$DT$ ARt$ H$HPLL$@H0~]LL$`HL$hILT$II)LL$M9&s0MEMkLL`HH`HUHTH([]A\A]A^A_AUATUSHAQH;5I{tIHtHtHHlLoL;-}uHtAXH[H]LA\11A]=@xH1Ht211LA8HtHSHfHnI$fI:"Hh @Z[]A\A]AVIAUIATE1USHcKHtCH|HMtLLH51ŀI1L1?IHMuHcx[L]A\A]A^ù댹AUAATUHtKHHH5T NIHt1HH1B?HHE1AL&H&D]A\A]ATUQHuA,I`HH?u H|$S)LgH|$HHunHl$H|$HHwHWHu.HumHMjH53GHD$H:r_ ى؃ u#t@L_Gt L_/L_HIA< uoLu%t@LWFtLW.LWHIfAj$H,LHcIHMuHjL]A\A]AVHeAUATUHSHH9GuHHuHuHVHv5H=S@=uEH=`SY'H}LuLm Le(H5khI|$H9t QtH fH52`H9nLzHHu=IHt,HNHMIuHiIuA H-iLH=HtwHL~?HtgLH=hL1L5*L+/HCHt@H=3fLLL1 /HHC1HuH{HtHCHuh[]A\A]A^Ã3QHxdLtH5.Lpm(H5L_mHdH1H01)1ZATSHQH0tH i11H1)H"HriH5k1HH61)1HLjSpAHtHAugDZ[A\ATIUHSHHw H~%M$$&1ҹHH=DKWuL%gi{H rcH5H9sld{tHTcH5H:UlFHLcH1H01(HHt(Hu gH5$iH{ L1[1]H6A\([1]A\Àg HGH;htH ~hH11H1(HATH>DFuEuHSh1H01W(HH H@1H5;dHAHtHAuZfDA\USPH=""2H="H2H='"H"{H= "2H="H,ZH5G_E1H8L]En1HVIHHHZAEtmIcHHH9vYHHLDMsG#SAIHtFLHII}tHI}u*LW HI}uLWAHgHgLE1/HL[]A\A]A^A_AWAVAUATUSH8JJH|$J-HuHRH8fIH*D$H=o"HH* s\Hl$(Ll$ Lt$^ $D$@MD$HIuE1e(IHtlIGI*^$J(IHtQIG I*^$/(IHt6IG(H*^$(IHtIG0H*^$'IHuIvL@VIG8MH8L[]A\A]A^A_ATH1H5/UE1HHT$Pth|$Ht$ .tHQH8PeIBH=D"/LHHuE1)Hc|$ QIHuHMuHUHEIHL]A\HHH5n/1HT$ tOA1Et&|$ ,yHPH8dHcPHH(HH54/1HT$ %Ou1`|$ Ht$O(tHPH8ld&H*D$YKUH*L$Xf.]zu)Hu]]&H(UHL4H1H.HHl$HL$ I A1Et+|$ HE)tHPH8c HQVHH]ATHL 4H1Hf.HHL$ APLd$ ATLD$< AYAZA1Et/t$|$ LuHOH8[c HUHHA\VbtHoOH8Y.cHUHZATE111HHt$ H|$D$D$ 9tH#OH8b=|$11D6x,|$ 1136xT$ t$H=g1eI|$tF|$ E1t5HLA\HH1HLD$ HH  ;LA1Et&|$ >yHuNH85bHc NHV6yHMNH8Y bHTHZATUSHD$ Ld$ 3LHH.y(XE8u Kt12HMH8a!Dd$ HcxMH=FHD1dH[]A\AVH1HAUHH 5 ATUSHLD$LL$+KA1EttDt$\$Ll$D$ 3Ht$ LDI!AL-y(D8u DJt1HMH8`t$ LHĠ[]A\A]A^HHH5+1HT$ 3KA1Et&|$ yHLH8}`HcSLHVX yHLH8YT`HRHZHH1HLD$HL$ H +A1Et,t$|$ yHMHHIHu,H{HuLHMuHLH{ Hu6yL/LkH= "AXL[H]LA\H=&1A]>Z1[]A\A]UHOHHWHAHH H HAHgH(HGt=H}HtHEHuKH}HtHEHuKH} HtHE HuKHuH]L@AATI1UH-~HH(HHD$HuHT$Ht$H|$P: HHuQKI|$1HH|$IHt%HT$Ht$ MtI $uLKE1H(L]A\AVAUATHGu }6E1H JIIIH5>RH97x\MuL-fLLLIHt:HPu0H=GHJ1LH5GRH?I $uLaJE1LA\A]A^AUATUHGu5GH IIHIH5\RH9G7xHuH-LHL]A\A]]1A\A]AUATUSAPHGu b5H nIHIIH5~RH96xqMuL%NLLH^HHtOHPu3HsH=F1LHNH?H5ЛHMuHEIYH[]A\A]鄅 Z1[]A\A]AUATUHGu4GH HIHIH5"RH96xHuH-LHL]A\A]^]1A\A]ATIUHSHHw M~"Hm#1ҹLH=S,8u)H-yJ{8HD{H:tH5:ME1H5kE1hMH{h18]t&{$HCpu-H[ uH荷 HHuE1>HuGHJH{1HH01 IHtHlC HuRIHCpH{haL[]A\AU1IATIUHPHHHL;y'ILE1HH5H=2\FCH,u"LHvE1H5aH=t[LH IH|$tHSHPL]A\A]AWAVAUIATUHSHH(HD$HwH!51ҹHH=6unH}Ht$KXH IHT$LH\$H0 411L=7 L50IHuSH|$E1I;\$H|$HH vJ11H1: HHuIHyHPuHRH5VOHpH~,1HxH9t H|  tH9H9~ H|  uHMuHHL$EHL$LLL1CHHZHxu3HWH5OH@1H;HMH!EHpHuHHE{MD$LLLD$LL$xI|$HMHu tMT$(LGMLHMuHDM\$Mt ID$(H HSGHB< It$HtI|$(H=-G=H|$II $u%LMDH|$I $uL3DE1H(L[]A\A]A^A_AWIAVIAUIATUHSHH8H\$ Ld$(HL$HLHL$b H|$ HL$uHEHHD$ HLH,HL$HuH EHT$ Ht$(1$IHuHL$HT$ HHt$( eLIALHL|SI $AuLECHt$(EuHL$HT$ H HH|$ H|$H8[]A\A]A^A_AWMAVIAUIATIUHHVH;E0H8HIL$It$HMLARukHLLLL I|$8HHpIL$It$HMHuAL聰KALnR5HMuH2B1 LLHHFH9HuLHVIHtA|$0I|$8HIL$It$HILAQubHuLIULb I|$8HHt\IL$It$HMHuAL蛯:ALQt(HMuHSA1HuIULL HIu)L,ALLH?HL]A\A]A^A_˘ H]A\A]A^A_Pt$PD$PPt$Pt$Pt$Pt$Pt$Pt$Pt$PAQEAȉщ1tHXSHuH=H5H8EA$HH:AHtH{HC=E1D[HuH=H9GuI'H5!= yH=1 ATH5|E1UHHHT$@H|$u=E@H5®LHLDUuH=IHL1 IHFuDE@HyL xHLDUHt$H=IHL1[ HIL(A~ HEH +@H5IHPH91H|$HuG?HL]A\ATH5rUHHHT$?yH&;E1H8@H|$uH}1HwH= IkHSu(HuHT$H=c1Hv HIK(A~ HUH T?H5H1HRH9H|$Hup>HL]A\AUATUH H=_:H5aE1H?]CHH=HD$HgHAąt+;HUH >H5LH1HRH9fHT$H5uaH>yH9H8Z=?Ht$HuHT$H5aH_>yEH=C1H H|$IHuf=MH|$LH|$u{Ht$Hu+HU(Ht$H=1 H|$IHuC=HMIuHw4L]A\A]AUATIUSAPH_@H9u6GIHHLIMHL)4H<HHtlHu^H[]A\A]dI|$u (a<AD$(HEHHIHt/LL7uIMuL3HMuH31YH[]A\A]eZ ZH[]A\A]ATSoHtHHAuk34E1DA\H8Ht H5R3PH3H5.H8O81ZATdHtHHAu 34E1DA\ATIUH(Ht$H|$HT$!pLHHtLHL0y H==8HT$Ht$H|$xH(]A\AWIAVIAUEATUHS1HH4$DL$ H;$}mItLIHt H|Eu'3|$ u9L9gt+Lhy3I9tMtI$LdLHH[]A\A]A^A_USAPH~tH.H5<H81F-HHtHHtH{HY[]1Z[]UHSQHFt H~H+HuL.HH1HVI:H5<1H8~L /H53I9K61WHvGUHHHu0H{ HWu HRH5j<^Hu"HuZH=,H5}<H?5BHxHs(H2HEH9tHHN u HQH5j<L-1I81!H}(Ht oy HHu(HHZ[]ATIUQHHHouHPtlHt HBHHDHHtHIT$HHtH5o~!HW-xIT$PHt6H52~!H:-y#HMuH/E1THuH-1HEH;-1IT$It$u1IH1pIHMuHo/LZ]A\ATUSHh HuE1WH{(HHu L%61I$SIHuHMu!HSL1HH=# k!HMIuH.L[]A\ATUSHHuE1gH{hHHu L%0I$IHuHMu1HSXHKHuH0M1H= H6AHMIuHu.L[]A\AUL-,2ATIUHGHL9t H;,u&I|$? uE1vMd$I<$L%0HUH;,tL9uH}? tHmH}H-/I$HLHEOI $IuL-HMuH-L]A\A]AUIATE1U Ht"HLHH HMIuH-L]A\A]ATH5^ IUHHT$ 輩Ht%|$ HLH HMIu.H4-$ID$H f/E1H5<9HPH91HL]A\ATH5ʩ IUHHT$ HHt%|$ HLH聘 HMIu.H,$ID$H .E1H58HPH91HL]A\ATH56 IUHHT$ ԨHt%|$ HLH HMIu.HL,$ID$H ~.E1H58HPH91HL]A\AUATE1UHSHHHwLML9tIA`HtE1HH9PXAHN`HH=H9yXEtXLtOL-j HLLp1t.HHT$LH\$;BH;(HusHue+E1HHT$Hl$H5 BH;Z(HuAHsH9ut7Hu)+EtHHT$H\$H5Ф AH H=(HHH[]A\A]AUATE1UHSHHHwLML9tIA`HtE1HH9P`AHN`HH=H9y`EtXLXtOL-} HLLo1t.HHT$LH\$AH;_'HusHu8*E1HHT$Hl$H5 @H;-'HuAHsH9ut7Hu)EtHHT$H\$H5 @H H=&HHH[]A\A]ATHHH4$IuLH5 khHHT$LH5 MhHAHtHAua)HDA\HHt$HT$H5 hHATUHHSHH.HujHH$IHuHH5 gHHH\$H5w gHI $uL(HtHMuH(H[]A\AWAVAUATUHSAPLnMKLGHWM@HtLZAHDL-y%H )H51I}LfIHIT$H%uALBHWHtLJAHDL%H H541I:bLLLuGHUML$MGHtHJHDH=$H mH5/1H?/H}(IMHS LMYH[H]1A\A]A^A_Z1[]A\A]A^A_AWH=fIAVIAUIATUhHuH'H55E1H8*,HHHH5j1H=*E1j7x&HELLLH' HMIuH&]LA\A]A^A_SG uH c'H53H9+1lHHu9ptH8'H53H:+1AH;5V(tHuHsC Gp11LH{H٧HuC [1hH11H111Hv ATSAP uL &H5E3E1I9*HH1 H{ItH{HY[A\PHtIHK&I9D$u;H{GpC I $uLt%L-&H5ntE1I8{*H (H9uLZ[A\S uH%H51H8*1$HHX H{H腦HuC [H5 USH(HoG HUuLh%H5 21I8)RHHtHzHuH=C 1H?;&M}pt>HoH5 %G H>HuH51R)H511?)}ltH G 1H9H;5%tH$H531H;(G HEpHu1H5+'HE11ElH1芼 HHHD$H5LHHD$P1HL$QLL$LD$(ZYLD$HL$H1HT$ H{HȤHHx11HH{HtH{H(H[]钤HtKL#L9]HMuH"HSHz#H5qBpH8C '1YH{LGpI8C tHkHu#LI:'L %I9uH(H[]H5'$eATWH@H<$H)D$)D$ PH|$(IHt)H@LA\ATIHUHHID$HyHxH9H= !H5?H?&QHuHHUHL]1A\36 Ht$ AEtI|$T$ tIL$(H $$)1H]A\AUI1ATUHHHpLl$ LMuH~ HHu1PHALL HT$R1jjI H HHt4LeH5I|$H9t tLH5I8%1LIHtH}1LSt8HtȾCLu"HMHH51H=05)Ht$ HT$0LH|$HD$HH|$(tL,HpH]A\A]ATSHPDgPHdHs DAXH[H=-1A\SH>Hv[HUSQH!"H9GtL H5-I9$1ZHHHHu'I1Mu6,HH9vH=R!H5H?c$1]Z[]AVAUIATIUHAPHw H~%Im&1ҹHH= uH- Et$EyHH5T1H:#AD$uYH=7]A\A]A^%H;- u1ɺ1L HHuvHEHIHtHMuWH1ZMIKDLLAEtHMuHHH8}-1ZH]A\A]A^H;=SHct]HHuIMu1H[AWE1AVAUATUHHHSHHHtLyIHu HxHu,PE1L@1HD$ PjjH HHMHUtOL/MtIuQILgMtIuLILwMtItFLOMt IIu9ILW 0IIE1IIIIE1IIIE1IIL}xMMt%I9uE1I9tJH=+_ 1I9t2t.LLT$L $-IHtH L $LT$xuXLLT$auYH|$$P4$D$ t$xH=[11H7HHHqHuHDžMuI9uILH yIkL^LgIIuLMy)H3HH5aH;I~HH5QH:HcI9|l?~A^LcM9}L)IHu Iw?H1LL$HL<HDLLMH)Hl$MIM9MADIIN \HuII $uL|$HL-+tHjE1H:'(H )HHH(LQ1H([]A\A]A^A_HHHHuH~ HHu/PAL1HD$PjjH HHu1H?DžxH5=ʶHHHHHuH~ HHu/PAL1HD$Pjj%H HHu1H?DžxH5@]HUHH~H5wH9t tLH5CI:1Hƒu)H1HupL WH5 &I9X1V~p=4@H IHXO 9|LDH5 &1I8s1XHH]UHHHHuH~ HHu,APALM1HD$PjjH HHt2H/H5fH}H9t tH H5. H9~1FHrǃu$HuHJH5H:K1xHHH]UHSQH~H5H9t tHH5 H812HÃtHH ZHt1Z[]UHSQH~H5nH9t tHH5: H:14H~ÃtHhH;H Ht1Z[]UHSWH~H5H9t #tH(H5 H:YHŃtHt#wHt";tH\H8^[]$YHc[]Z1[]AUATUHHSHHuH~ HHu.PHA1LHD$PjjH HHtnLeL-I|$L9tCL7u7L;AătH]H{L9uHt"LtH H5 H91SHŃt0DIA}tHEH:#>HtHcH[]A\A]AVAUATUHHH(HuH~ HHu2PHA1LHD$Pjj{H HHLmL%I}L9tzLunLAŃtLuI~L9uOHtYLu7LAƃtHmH}L9uPHt"LtH H5G H91IHAăt#DDD5uH H:!HtH%HH(]A\A]A^AWAVAUATUHSHHXHtLiH~HE1Hu8E1PHA1LHHD$0PjjH HHKLuL%I~L9Lu~LAƃtL}IL9u_HtLiuDLmAǃtLEIxL9u%HtLLD$*HT$tL *H5I91YHL"IHuH%iHIMIuLItHH}HtHu H=Lm L-{MyH= H5H?1HRH9tHl$Hqu1I9tH\$ LHTu1nE1DMHDHHD$RH|$IEMy)8utpH y H99,L"M611IHHX[]A\A]A^A_UHH~H5]H9t tH H5)H:y?HoŃtyH ]H8Ht Hc]h 1]UHHHHuH~ HHu,APAL1HD$Pjj$H HHtTH/H5 H}H9t tH H5fH: HŃt.)HtH1]UHHHHuH~ HHu,APAL}1HD$Pjj| H HHt2H/H5 H}H9t tH  H5H91?HŃtyHq H:1jHtHcH]UHHHHuH~ HHu,APAL1HD$Pjj H HHt2H/H5/ H}H9t QtH V H5H9G1?H;Ńt=yHH:jHtHc4H]AUHHATUSHHuH~ HHu+PAL1HD$Pjj H HHt2H/H5a H}H9t tH H5)H9y1Hj ÃtD$Ll$Ht#8u0u`H|$LILDxHH:Ot$L莨HĨ[]A\A]UHH~H5 H9t tHH5^H:?H ŃtfyH]H8 Ht Hc]1]UHHHHuH~ HHu,APAL1HD$PjjY H HHt2H/H5 H}H9t tHH5H:1$H Ńt ZHtH]AWAVIAUATUHSH(HtHYH~ H1Hu31PHA1L6LHD$Pjj H HHtmLmL% I}L9tCL,u7L0 AŃtL}IL9uHt"LtLH5I81L Aăt LHuTHtH}ŅyDD u_tLDDILy&=u98&5=u*=uPcDDI5LKyH=H?X#u011Dy DunHHcH([]A\A]A^A_AVAUATUHHHuLeL-\I|$L9u$}HֹH=3guLVuOLZ AătH}Ht$MuHtLuI~L9t LtH H5H: {LAŃt-Hl$DDHI LIMy# IHt2H3H8ItHL]A\A]A^HtH1]A\A]A^AWAVAUATUHSHHuLeH5I|$H9u$-HֹH=u/ ÅtH H5H9 LAŃt+LuLu*HH5>H: LHtLIHHt$HHLAoxjEL4$DDILDLHHy/8u tÉHt$DL"Hy!uHH8gHuHHH[]A\A]A^A_ H1[]A\A]A^A_AVAUATUHSHHuLeL-I|$L9u$hHֹH=_uL|u:LAătLuI~L9uHtLBtH=GH5H?8 1L)Hc؃tH}HuNHtBL,$y&H wH9H[]A\A]A^%H1+HD$Hu18u=KAƅu4DLHIHD$Hp 5LHHx(E1H|$HuAEuHH:H9t H|$HHD$H[]A\A]A^AWHBAVAUATIUHSH8HwLuL-I~L9u'LH=uLÅuYLAƃtH}Ht$L}ue HtVI~SHmH}L9t L[tL`H5I8QHDAŃuHtE1HT$LH$uH=H5H?LIHHt$(H|$ HLAxsL|$ DEH $DHD$LH|$HHyl8u "tHt$(DLHy!uH H9HuHH8H[]A\A]A^A_H81[]A\A]A^A_AWAVAUATUHSHHuLeH5I|$H9u$-HֹH=u2ÅtH H5^H9 LAŃt+LuLMu*HH5;H:sHtLGIHE1Ht$HHL xpEYL4$DDILLH9Hy8u tÉHt$DLHyuHWH8HuLHuHHH[]A\A]A^A_}H1[]A\A]A^A_AV1AUATIUSH`Hl$HHuM,$H5I}H9u!(HֹH='utL!H5I81LÃtI|$1HtrHtɾCHu#IL$HwH5?1H=xiyI|$Ht$tLt$HT$ LHt$ILIMy>8u=tIt L"HHtH|$tH HH:]H`H[]A\A]A^AWHBAVAUATIUHSH8HwLuL-I~L9u'LH=uLÅuYLAƃtH}Ht$L}{ubHtSI~SHmH}L9t L/tL4H5I8%HAŃuHtE1HT$LH$uH=H5 H?LIHE1Ht$(H|$ HL xsL|$ DEH $DHD$LZH|$HHyC8u tHt$(DLHy!uH H9{ HuHH8H[]A\A]A^A_H81[]A\A]A^A_UHSWH~H5H9t tHH5qH8@HÃtŃu +HtHu YHc[]oZ1[]UHHH~H5&H9t LtHQH5H:B1WH6Ńt!H|$胲t"HH8` 'I1MtT$ t$H=1wH]AVAUATUSHHHuH+H5H}H9u!(HֹH=|utHH5)H:y1HjŃtH{Ht$^uHtH{H@tL4$Ll$ULLIEL;u t낅u HH"HeH8H[]A\A]A^ H[]A\A]A^AWAVAUATUSHHHuH+L%[H}L9u$HֹH=bduzLVuXHZŃtH{Ht$NuKHt?H{H0t/LkI}L9t LtHH5H:1LAăt L<$Lt$]HtauDLLILtЅu HcH$aHH8H[]A\A]A^A_H[]A\A]A^A_AUATUHSHxH~H5H9t !tH&H5H:1HÃtII1MtLILt8uKYt1MPt$Xt$Xt$Xt$Xt$XLL$XLD$PHL$HHT$@Ht$8H|$09nH0HH8Hx[]A\A]USHHHuH+H5H}H9u$+HֹH= utHH5H:HŃt H{Ht$ H趋 uZKHtNt$ H HHu;tHH8 HuHH[]H1[]UHSWH~H5 H9t 2tH7H5H8(@HÃt0Ńu HtHu YHc[]ֺZ1[]AUATUSHQHuH+L%H}L9u!aHֹH=uXLu6HŃtLkI}L9uHt"LNtHSH5H8D16L8Ãt1҉މxHH HtZ[]A\A]UHSWH~H5H9t tHH5}H8@HÃteŃu 7Ht+Hu YHc[]{Z1[]AUATUSHQHuH+L%+H}L9u!aHֹH=]7uXL)u6H-ŃtLkI}L9uHt"LtHH5H814LÃtމ=xHH HHtZ[]A\A]AUATUSHQHuH+L%OH}L9u!aHֹH=[uXLMu6HQŃtLkI}L9uHt"LtHH5H8 1OLAăt$1ۅII sHtA9~ ΰLHHZ[]A\A]AUATIUSWHuM,$H-WI}H9u$iHֹH=cuHRu;LVÃtMd$I|$H9uHtHtH=H5H? vLAŃtAHغH AHH,I %H!HH I!H I Iu EHt9HuYL[]A\A]Z1[]A\A]UHSWH~H5:H9t `tHeH5H8V@HLÃt讵Ńu HtHu YHc[]DZ1[]AWAVAUATIUSHH(HtLiH~HE1Hu4E1PLA1LfHHD$PjjH IHt8M4$L=]I~L9tL|ŅtH=H5 H?p1FLLIHuHHIIuLItHt3Il$H}L9tLuHŃu HuMy"H gH9!HL1HD$HHuM8u.9x4Ht$>1HVH HHx%HH:H|$Hu/-(L9t H|$H\$HAIH(H[]A\A]A^A_UHSWH~H5H9t tHH5H8)HÃtY[]髳FHtZ1[]UHHSHHuH~ HHu+PAL\1HD$PjjH HHt2H/H5H}H9t 7tH<H5H:-1.H!Ãt1@ HtH[]UHHSHHuH~ HHu+PAL1HD$PjjH HHt2H/H5^H}H9t tHH5&H:v1+HjÃt1@E HtH[]UHHSHHuH~ HHu+PAL11HD$Pjj0H HHt2H/H5H}H9t tHH5rH:1'HÃt ߃ .HtH[]UHHSHHuH~ HHu+PAL1HD$PjjH HHt2H/H5H}H9t tH!H5H:1(HÃt Hc$ }HtH[]ATUHSHuLeH5I|$H9u!(HֹH=utL H5-I9}1 LnHc؃t*Hm gu)LBH5[I8C1Ht볍C?vH=H5ÜH?1H;-r"t6H;-r"t5HL%iu%HH5H:1cAE197L HuH5&H>1)HH t"HHAHEHiHu HDH[]A\UHH~H5H9t ;tH@H5H81(H'Ńt9]A蜿Ht1]ATUHWH~H5H9t tHH5}H:1WHŃt0I+Lt!HH8Y]A\Ht1 HMHZ]A\UHSWH~H5H9t BtH GH5H981H)Ńu)譾I1MuxHH5H:1^@?wH謰;HuHtH5HHt HHYH[1H=]Z[]AUATUSHQHuH+L%=H}L9u$dHֹH=IuL8u6H<ŃtLkI}L9u豽Ht_LtH=H5H?1gLÃt E?v&H H5xH9 PHt1*މnyH+H:1 HhHZ[]A\A]UHH~H56H9t \tH=aH5H?R1aHFu)̼I1MuEHH5͘H81+P?wHH p"HHH@HuHH]UHSHQHwHm1ҹHH= u2HH5oH{H9t tHH57H815H{ŃuHt蓈xH)HZ[]AVAUIATISHH5c7 H(HD$Lt$LH|$HtH;=uHHD$uHD$2Ht$LH|$HtHD$HuLH54 LLxzH|$HuHH5AH8rXHt$LSAąu4H|$HtHD$HuHt$H|$LMm HH|$讔AH(D[A\A]A^AVIH5-6 AUATUHSHH0HD$(Ll$(LfH|$(Hu!H=H5oAH?AHt$ HWH|$(HtHD$(HuRLH5x5 HH|$(HtH;=uHHD$(uHD$2Ht$H H|$(HtHD$(HuLH54 HrH|$(HtH;=uHHD$(uHD$2Ht$H"H|$(HtHD$(HuXLH5; HH|$(Hu!H MH5&AH98Ht$ H|$(HtHD$(HuLH53 HH|$(Hu!HH5AH:\Ht$eAą7H|$(HtHD$(HumLH533 H+ H|$(HtH;=:uHHD$(u-D$/Ht$H|$(HtHD$(HuLH52 HH|$(HtH;=uHHD$(u$)HsuLH|$(HtHD$(HuSD$PDL$DD$L$HT$ Ht$(H|$0ZIXZH|$(AH0D[]A\A]A^AWAVAUATIUHSHhL|$PHt$H51 HD$PLHD$PHu LH5=I;HPu!L=HRH5D1I?"VLhHLHH;E1LL$XH|$PM9}YLGHLL $K6MHAu"H-IQH51H}aMhHLMHHzE1Ht$XH|$PM9}aLWHL\$0Ht$ K<西FHt$PL\$0L9nHt$ tH1H5RH;HD$XJDIHtHD$PHu6LH5, LH|$PHtH;=uHHD$PuHD$@2Ht$@HH|$PHtHD$PHuHT$PH5}+ Lu`LT$PMu L H5I9;MZAu!L~ISH51I8ɭMjHL赑IHE1Ht$XH|$PM9}WHGHHt$ J<HT$PHt$ L9jtH=H5tH?HL$XKLIHtHD$PHu~L$HfHnþ8HfH:"D$@fI:")D$0)L$ Ht($(d$ L`0(l$0`h Hl$HE1H|$PHh[]A\A]A^A_AWAVAUATIUSHH8Lt$ H4$H5u) HD$ LzH|$ Hu HH5H:UHt$Hż1H|$ HtHD$ HuLH5% LNH|$ Hu HH5nH8qHt$HOH|$ HtHD$ HuLH5% LHD$ Hu LH50I;iHPu!LHRH5/1I:-,HhHHIHE1Ht$(H|$ I9}WHHHt$JHt$$/Dd$$HEuHH9vH=H5AH?iH{ AƋW(9~ H5ft~HxHT$(Ht$@E1PLC Ht$@E1L\$(AP(McM9ABF<Hc<EA9~AAu$H5jL[1AI;车E1LC fAnHt$8f:"HT$0Ix0fD$轐LcShLL$8C4L@Vt@HuL=H5+AI?jMcC,@t@uL5H5"AI>9Lt$0D$ 11H|$@E1E1Lt$LE1H\$IcH;t$|D7AXAK=SH  H>H D9AT9@E9AA9AE!@ u%Et L-H5AI}uAA]tHc€<6DEu/@t*EuEt|$du EA EIcAƉT@AIcHcD@A9E9AD!9AD9A!D8tU@,@t @L%uL%L4HRHHDLH51I:AxD\$AvH\$E~]CpLkHL+k@D)ICpHALk IE+AxzDu+McG|B<Qu LSHIzIRHSHHuͅLL$LKhHĘD[]A\A]A^A_AVAUATUHHSHH@ yLE1I:)HLt$1HH H͎IHLLIMIuLID$H?v=|$uIt L LH5|1I9"HHDHuu8tHH:YLHT$ H5<16HI8L@# ѥHuHMAuHHMuHE1H@D[]A\A]A^ATUSHHHuH+H5H}H9u!(HֹH=yu訸tL H5NI91HAătHH{HxuHtL$H H$LHHDLAąt D HH8j1%1uHĀHHHHHĀ[]A\AUHATUSHHHʊA1EtnH$ HHL$ΰLHI谧L趫u(]8u Ct1HH8LF HĈ[]A\A]ATHUSHHl$H)A1EtZL$H L5LHt$ HHtHaH8! Hc|$ H[]A\AUIATUSHH$Hu(LCL 1E1H5IPI9ܟHt$ HHg|$ u)HuHMHxbƉH9uY=xUHI赢HtHH:葢uEYDAt:DI9u2HMuHA]ABH=H5H?H H5H9HMAuH~HD[]A\A]SHHHuH;Ht$ u#HֹH=QFu1WH{Ht$tH{Ht$ut؋T$t$|$ IyHH8H[QHHH[SHHHuH;Ht$ u#HֹH=觼u1AH{Ht$tt$|$ yH H8H[HIHH[HHHt$ t,|$ 躂yHH8HHH1HHHHt$ Vt,|$ 2yHH8H;HH1HAUIATUSHHCHu(LCL 1E1H5IPI9Ht$ HH膤|$ u)HuHMHxbƉH9uY=xUHIԟHtHH:谟uEYDAt:DI9u2HMuHA]ABH=H5H?H H5H9HMAuHHD[]A\A]SHHHuH;Ht$ u#HֹH=eu1WH{Ht$tH{Ht$ut؋T$t$|$ صyHH8H[pHHH[HHHt$ 't,|$ yHoH8H+HH1HSHHHuH;Ht$ u#HֹH=ۦ~u1AH{Ht$tt$|$ yHH8H[H HH[HHHt$ Vt,|$ 1yHH8HZHH1HAVHAUATIUSH蝹uL H5#I91L褯HHxyE1IH=~SLH5I81HPtEKtHHMtNHHMuH.II9tHLL{HHu1[H=(H5H?HMu HHMuHHLyHpH80 HHH[]A\A]A^AUATIUHSQH_H5H9tH華AŅtID$mHC`HtFHtLZ]A\AVAUIATUHSH0vI}0A&zHuH a1H9/1HHH~Hp1DHtH=J辀IHu15ɾADLHPHL3eH5+!PP1U艽I$H HHI$HuLHtH5n+!H֕HMIuHMvIM=H~$L111OHHDHu谾[]A\A]A^ÿk HUHcSHQtHb}HDHlHHDX[]ATSHH=K"Q赴IHHH1HSL{{ID$(FHSLID$0hHS LWHS(LF艒Ht LE1ylLZ[A\AVHAUATUSH@Ht$(u3HH:5tH *H5N1H9E1輞FI菋IHuAI?1LHyHHuHD$HݻC|$Ht$LHLD$EÅt$HD$"u M9 MH1L#Ll$MuZH豟u xIW|$芄IH%HH4H5rH81I $LqLHILH@L[]A\A]A^AT1UQIHtc蟴HHtLHHtHLt HjI $uL谦E1HMuHݻ薦LZ]A\UHH~H5H9t ţtHʸH5kH:@H豼ŃtzHHuH]H8Ht]9z1]UHHl$HSHuH߶H8HzH]ATUS(HyIHu$H;H8tZH5a HyIĉ+L[]A\AWAVAUATUSHHHHT$@HL$HLD$PLL$Xt:)D$`)L$p)$)$)$)$)$)$H$ HT$0D$Ht$D$0HD$ HT$(KIHHHsL5 LH)HHLHHH5$LHL$'HsIL)H9t(HMuH躹HLLHHtMDD$I1HLH=*IHtH=CHH?`IuLSL 8C(;H[]A\A]A^A_ATISHQ讐1LH!Ht H;HInyI $uLE1LZ[A\錐wUHGHHh HtH?Ht HH]騽1]ATH=#vH=-IHH5:H͈H5^L蹈H5UL襈H5NL葈H5DL} H5:Li@H5/LUH5*LAH5!L-H5L1H5LH5 LH5LH5L̇H5L踇H5L複H5eL萇H5ɕL| H5LhH5LT菋HtI $uL̶E1LA\AUH"ATL%1UHLH#tyrHnL-gLH]txL|txLptxLH5IHH(kxLH5?HHk]A\A]AUIHATAUyHtHHL膯HMAuHD]A\A]AWIIAVAUIATUSHHHLwL_Ho A~u_HtHyu\AF$%CuEHuIcVL9u7LLLMu'IcVH;UuHuLHHL[]A\A]A^A_PHLCMK<LT$ L$LD$sIHHD$8LHLT$ IHD$HHt$8LLl$Ll$L|$MHKHHLT$(Ht$ 7Ht$ LT$(tLLCHIILMLL$Ld$Ll$L|$ E1E11E1IM(Iu01I}@MMhHtHUH1HtHCAUAQIWLVLQLR1UjAPMPMkHPLIbMHHL[]A\A]A^A_HHVHYAUIATUH@Ld$LРH5L,I}+HHHL4HEHHEuH至I}tQ H5UL̝I}HHt~HLجHEx=HHEuH/LH=1HHtAHL蛬HEyHHEu%HHHEuH߲Ls L1H@]A\A]AUIATUH@Ld$L蘟H5LA}(uH5kLќy"H5TL贜yI}HHt~HL迫HEx=HHEuHLH=1HHtAHL肫HEyHHEu%HٱHHEuHƱLq Lԭ1H@]A\A]A11 AWHBAVAUIATUHSHH8Hw HMe$|HH=1dufMuH5 I~H9t BtHGH5E1H:5.L(AŃu諅Ht E1}L H5"E1I9DuEtLʬH5K E1I8ȵH H9MHHt Q51H# IHHOxIuLPcI$}]uIH=ޮ <L%2H5<I<$E1/(H5H苞Hu AtAAEL1D1AAH5I:/H5#LH6suH=J- I $uLj1H5H1觭IHQDL5LI6:uH=ɭ 'H1H51QHHHuH}xHEx-HHDžHtHDžHu议H}8Ht&1H51HHHuH} 11AHNH5C讬I $IuLMMtFH}0MXI6L ƅyIMuLHE"E1 H=s1H7LƲu H=LH5nj1H??LөH11I0doHHHu莭LfIHHE1HRxIuFHIuuLEH<$LL$DT$D\$H|$LL$ DT$(D\$,HH HHkH} 1H01nH IuHMIuLͬH}xHEx|+HHDžHtHDžHu萬H}8HuHc\$(u1Ht$EyyH} L$$H$q1H5虪IHPHPu:H IHRH5f1H9}IuHIuL t$ HH=1葾HHH*H}81LDD$,H3H5HI H}xL}xC*H}xHDž_H9}H- H5H}sdH1t$ 1HRH=L߽Ht=HH)H}0t.H|$u E1|$ ADHBy L)E1H8L[]A\A]A^A_AUATE1UHHHHHtLaIHuH~ HHu,APAL1HD$PjjʩH HHtHL$`HT$Ht$PH<$LղLͲHĠHc]A\A]jHĠ1]A\A]AVIAUIATE1UAPSHt"HLLHHMIuH輥ZL]A\A]A^HGt Ht1P!1ZAVAAUIATE1UAPHt"HDLH@ HMIuHOZL]A\A]A^11 UHHH轵H]H鬰AVAAUIATE1UAPuHt"HDLH菍 HMIuHޤZL]A\A]A^11i UHHHS1HHtHYHHu HxHu,PE1LT1HD$PjjϣH HHu1BHtH?MlƅxH Ńt HcKh xHtH[]SG0t 1< 1Y Ãu xHu Hc[g1[AUH[WATUHHHfHnfH:"HpH=HD$HLd$ H|$0HD$P)D$ L$8L$XuH~ HHu7PHA1LD$APLYjj襢H HHuE1H}Lt tH}Ht$ Hb'7 tl$ |$HIʼnt wH H|$@HHu6AMt uH5mH>- H|$XSS\wHZHIL~ HpL]A\A]AWAVAUATIUHS1HHtHYHHWHfHnL$HLl$0fH:"L$hHD$@D$XHD$`HD$D$)D$0uM~ IHu1PHA1L]WHt$VLjjH HHtWH}Lr tGLIIL}Mt^IH5lH9t 蒉tH H58H9舦E1LxAăt HIu>uHtAH}HHt$ӁtIAD|$Lt$HAH|$PHtHLDDyn LD躆H}t跓8umt蠪H IcsHH|$H(H[]A\A]ATSHHHt$vAątLHD$L`IL艪HHtHT$LHAHr s`E1H|$Hu衚HD[A\HAWAVAUIATUSQHHxH9wHHE1IHuK`E1|IuLHnhLUHHtRHK4$H}t!HH}uHAH McI9|HH}uH IL;LLE1ɲZL[]A\A]A^A_AWAVAUATE1UHSH8Ht$RHD$H4HxHH9v B_E1H!IHtHNIHHIHIVtHHt L1L6H5'11I;jzHLsSLHHD$cSH|$IHNHEHt$(s3LHt$ sL|$(II!=HHt$ H=F1HV Iw gH|$(IHuNH|$ Hu?MHLH MtYIMuLHH;l$JIuw9LH5kI:H|$(HuԗH|$ HuF IMuLH5ܲ1H? gLIE11H^xIuLaHXL[]A\A]A^A_AVIAUIATE1UAP設Ht"HLLHHMIuHZL]A\A]A^H AQLL$AH(AUAATIUHSQ蛍VL)Hu.vLHH=s#HpH}-uHULHIH5s1LpAHt $ HHHHEHsHUH} L蘝jsEH@H5HMIHtCHPHx L]IMu+IuLV0H HP1H5H9/eHu#LHltH=5H?LݚZ[]A\A]ATIUSH CHLH;tH5&_1ßH;H []A\sH5r1襟I$H;1H5r萟H;HIl$H;1H5rHoHHtHUH;H5r1NH H=}r5H;~HT$Ht$H|$肁H31LH;车HT$Ht$H|$IwTH3 gH;荦H []A\HdAUH1H5rATE1USHH KHT$ID$VLd$Hc|$xCH藡HHt24$H|$LH‹\$qu)HRD$9=?~ hWIdD$Hc|$1ϠIHt@9\$~:LcB|p HuI $uLaHE1RIT$JHoRHL[]A\A]SH1H5 qHLIH2HL$LL$UA1EtBHD$t$Hx EH|$Hu֐uHsH:3 HHH[ATH1H5J(H HL$HT$HD$TtHD$8uH="H5膕E1zH|$H;=MtHt$iktH|$ mH HD$1H|$UIHuH|$>HH:pH1|H|$I>H LA\AUH1H5oATUHHHT$SuE1UH|$1v\IHtH<$1E1`\HHtHLyHcŊILPHtHPHL]A\A]AVH1H5DoAUATE1USHHT$+S$H|$H[IHHRKH;$tH=H51H?HxHH<$H9vTE11H`HHt裁H$LHH軉Hƅt"uHH94$wVLvHJ43XIHuTELLHLm;HtH ։E1H9蓝HSIE11H7OL/OHL[]A\A]A^HHH5 o1HT$QA1EtHt$1ʁ1HzHHHH5m1HHT$QA1EtH4$H|$聁1HgzHH(HH5cm1LD$ HL$HT$>QA1EtHt$H|$T$ 11HzH(ATH1H5mE1HHT$Pt5H|$OHD$IHuHyH89 1HyIHLA\HHH5l1HHT$PA1Et-H|$H4$H$HHt 1hy HWHHAWAVAUATUSHxHD$XHD$`D$hD$lL-H5^E1I:+dHtL-H5E1I}<HGH9GHHt y.1H^ IHtQHSI $uL莋x5{]uFH=E1! L%uH5I<$uE1H5>yHu{_uL ՆH5ިE1I9;tH xH1H5~1GHHtHuH{ 1H51!IHpH{8H HZHD$XI $uL葊<_IH+HT$XH1HL$8HT$H5n'HT$`WNHL$8HHqH)t$XH#LH{811I0KIHH*H|$8YLL$4LL$(AH Ld$MH|$ L,H{8MHt$#H{8HL$ 1MHiH5HI IMWLT$uLmH{8H;l$Lύ11I3 KIH@H@HL$(1HT$PLH51iMHT$PHBLbIuLMuL$4Ld$H+l$L$`3M)AM)MHt$Ld$E1!Lt$Xl$hH6Ht$8L|$4Ld$L|$ H~LF LME1H|$MiHL$ H1HT$PH5Zh{IHnL-IHu znHx /H|$RLHtHHD$H|$KDH==I )HHuE1[H@tHMSIV1Ld$HD$ ILt$OHHT$0H9\$  LH&HHuLd$MImHp,Hu mLhLL$0MI~HHkHp LHD$8fLT$8I uLkLFCL9u[MtB|,N/tDO/IHt$K<.^f1LHLHH5<lyHMLd$MIHLd$MI $uL3kMuHMuH kALo6Aąy#HMuHjIuLjE1L~IHHu [lHy11D(nHu+HMuHjIuLjLE1+c1ILHHH5o;jxHMIuHYjL+MuSk11H5;L4xIIuL$jMtI)LE1 jkE1IuLi11;l$(}*LYHHuHANk HE1L1H5:1wHHt Hu ikI $uLxiHt HEu H4M @ t@LUHt LU0LUHILE1HcL9}4uA 2uA rA wMIMAuąt0LHHIHtHMuHLh JjHH\$O Dd$,H5IHE~)A  McBD,OHt$HytAŅu&A EuHt$H=AAHMuH>hEuHt$H=6(tAHXD[]A\A]A^A_H5AWAVAUATUSHH8HGiH9Gt^H=ikH=!IIHHt>HPt1Ht$,@|$,H 1HHLH=gsI1MmHMuHtH9} H[HD$ 111@H(@Mt7H{LG M9hhu)|$ t"DL$ D9K$uHtMPp1LT$H;L$t31H~ HL薤L[D{$1Ms D|$ IVpMnhHT$HŅHHCD{$Hp LvhHNpMtHujH=GDL1*4HHtߺLHD$;H|$Hu D$-fD$u!DLLtg^H[HL$H~!@tH8HL[]A\A]A^A_颣1H8[]A\A]A^A_AWIAVIAUIATIH=%USLHLD$!HH;zgHLD$HL;bgM!HH;GgtBHL:HH=Dq1HHy:y?HH=}Fpy^111LHH=nFp9HH=py !uL;=ftTMu2MHL9HH=5spyHLUy111L ML;-5fM}Mt.LCHtLxLH5:IHt HHu+L111LHH=oy{HN5IHtL9u1IAu&L^^E1H|$L_\HMuH2^T$,1LH=?+IMHuL ^HM2Hl$HVLT$ MjMt.LI=HtLhH|$ H5=4IHt HXuLRLH=iEH5H=H1^0u#LL2LH=&IiIuL:]LMuH=*i LiÅuzL9t~H)IHu^LH=>hDLXAuLH=<hÅu! H_HuܺLL 2LRy^LH=zhH|$.HMuH`\S|$hH8[]A\A]A^A_]LH1HMH\LlIHtH}3LcI9uCLcC| DL H&KHtIHcI)I9}HHH)H)II<+AMD) wLH@uIH-<LHbgLLWgA}tL2A| tLH=?1gt1LHL-gL~ L gH=<fILZH8[]A\A]A^A_AUIATUHBH@tA4HMuHr>H 3A1D&y DAl[D]A\A]A^AWH1H= AVAUATUHH5PSHN1HMIHttL5)?L=RIIpHD$L+I9tPIUMuHL9tM9uMmHLLЅtLL4yI $uL=E1 HH9\$uHL[]A\A]A^A_AVH1H=AUATUSHH5{Mxw11L5ICsLIHu]LЅu'HH9k~NLlIE@tHHHuIUHHtLLLЅtI $uLHJHmH5,;IH}H9t K$tH P9H52H9AA1zH5=Ńt 1H5LH=tLyHtLXAąt.Hm7D H:*K1衉uH=HZ]A\AWHoAVAUATL%7USHHT$HRLD|$4Ht$ HL$(LL$8Hu Hi8LH5_H81 H|$L3"HD$HH#L"7LH51E1I;{ H|$(lu!L-8LH5w_1I}L cH|$Ht$H"IHHH9u!LL%6H5c_1I<$ H|$(Ht$P讠HD$HH;-W<H1IHD$HHH5)_*HH-H|$`E1L$0H>H5H:ZIHMiH9\HuH}N$MD$I$AI|$I|$HHHLHHL$@HT$XAWLLp8H5^1LL$LAQL$3ZYH|$H$0H$D$0L$DHW H|$`t$@)H$Hu8;I $uL8IL;uNdH5H5]H8=2 HHf81HT$XLLH5]H$0H|$`OYG1H$MLHT$XH5]t`$0$H|$`f>L}3I:=G-L4H5]I;<HMLd$`uAH77HMuH7I $uL7H|$`HHD$E1b*H$0H>EtL2I:FH|$8tAH|$8At!H$0D'Et Ht1ۃ$tH$tˀH$L$0t:L$H$LSd/LLHEH$t:L$H$LdLLHEH$L|$XH$1H$MH TH5(\H$H;=7L$0t56ƃtLH EtCD$8h t$8Ht>LLHEuL$0L5CEt!L 1I9DH$0bHL$ LD$(11H5H=HQ8HL$ExeHt$ |$4MLLL$LH$Hv t,MtH|$ L0E1Hw8I8\Hc$0HMt LMt&IE1HD$E1HD$E1HĈL[]A\A]A^A_AWAVIAUATUHS1HHtHYHHYWHfHnL$8Ll$ fH:"L$XHD$0D$HHD$P)D$ uH~ HMu5VLA1LkHt$xVHjj2H IHI>L^ I~MFH +HH|$LD$HMNLL$Mt HHMf Mt HIn(HtAH}H51H9tUADžuIH4Ńt HuHt;1M~0Mt[IH51H9t tL%/H5r)I<$7E1L3AǃtHup-HtE1IF8HtHt]M^@MtE1HtRMVHLHD$E111E1E1E11E1E11E11E1E1E11E11E1E11E1E1RML1ARASPAWULD$8HL$HHT$@?H0IL HL[]A\A]A^A_AWAVIAUATUHS1HHtHYH?HWWHfHnL$8Ll$ fH:"L$XHD$0D$HHD$P)D$ uH~ HMu5VLA1L#Ht$xVHjja0H IHI>L I~MFH +HH|$LD$HMNLL$Mt HHMf Mt HIn(HtAH}H5j/H9tUADžuIH1Ńt Hu Ht;1M~0Mt[IH5/H9t DtL%I-H5&I<$95E1L)1AǃtHupHtE1IF8HtHt]M^@MtE1HtRMVHLHD$E111E1E1E11E1E11E11E1E1E11E11E1E11E1E1RMLARASPAWULD$8HL$HHT$@H0ILC HL[]A\A]A^A_ATSHD$ HBH9tH/H5H:41x1H=1c?A1Ex^ H|$ 111dÅu uHN*H8>!Dd$ Hc)H=yHD1+AH[A\AWHSAVL5ZAUfInATfH:"IUHS1HHtHYHX4WHDŽ$D$L$H$HDŽ$)$$$uM~ IHu8PHA1LH$VLjj,H HHH}LmJ #HHtLmMt$HHu"E1JL-N/E19L-=/LeMt HH}HUH} Å1H|$P l$L;-.MtH (H51SE1H91+L -M9UtH-)H5FSH}1L,HuI}1HT$(Ht$I} 1HT$0Ht$ ~T$ ~\$fH:"T$0fH:"\$(T$h\$XyMtlLj,M9D$tL <)H5RE1I9*1_LM,HuI|$HT$`Ht$XetbI|$ HT$pHt$heu HD$PD$H$u5|$t.H$u#L'LH5D1I;E1$L u㋴$L u΃AMLDEH$MLD-H5H= ;xY ۋ\$PIƒuBtBH$1҅ud$Xl$hHT$0)d$0)l$@^Au|$t=H$1uDT$XD\$hHT$0D)T$0D)\$@Ao$t-1uDD$XDL$hHt$0D)D$0D)L$@8A6H$1҅ut$X|$hHT$0)t$0)|$@1ɿALGEyH5%E1H>P98L%+I$+Ht$'BHL HL[]A\A]A^A_AWHNAVE1AUL-y ATfInUfH:"HSHHHtLqWH)D$@Ld$@H]/D$hHD$pHT$PD$ L$XL$xuH~ HHu8PHA1L'Ht$ VHjj%(H HHu1H}LtH}Ht$ ZtH}Ht$\tIIu0H}HuH} \ÅyHt$ tIuɋl$ T$hLD|$Dt$at$hLKAEDDEHT$xH5 H= i8, |$hIŃtDD8WH|$`AuEtDD3uEtEHDDA DD#LtH "Ht$xH9 H H-6)HEL2 HĘH[]A\A]A^A_AWHLAVAUE1ATL% UfInfInHSHHOfH:"fH:"HHtLiWH)L$0Lt$0H5,T$HL$DŽ$H$HDŽ$HD$@D$XHD$`)$$$T$huH~ HHu5PAL1HH|$ WHjjk%H HHRH}L>H}L*IItH}Ņy $LHD$WHL$h1H$H5`2H=5L%>I$HH1HD$HHH HL$Ht$PHT$$IŅx H H$Hمt%LHD$ALD$My2H|$Hu$I8"XH$[1L9t H|$L3 Hl$L L HH[]A\A]A^A_AWHIIAVL5AUfInfInATIHfH:"UfH:"HSH8H$HtHIH $W1H9*ML$H$DŽ$LHt$L|$@)L$@H$HDŽ$HD$PD$hHD$p)$$$T$XT$xuI~ IHu9WAHL1LLD$ APLjj"H HHHt$H}H}LH}1LÅCL_u!HMH!L1H57VL$$ItrLMMfIyH5!L $H9t L$tLH5LI:'1L#Ãt I HtA$DLuRH5TH=SSL$L$H$H$}2Y^w>$Ht$`H$H$Iƅx AHc"H$AEt IHcHcLHtH$1" Ho#HH|$jLbH$t#L-H} 4AąH8H[]A\A]A^A_AWL=UHFAVfInfInAUfH:"ATIHRUfH:"HS1HHtHYWH)D$pLt$pH5&)L$ Ll$ DŽ$H$HDŽ$HD$0D$HHD$P$$T$8T$XuI~ IHu8PAL;1LH|$WHjjtH HHu1H}LtH}LtLHtH}Åy뿻$LquHL$XH$H5,H=0x$Ht$@Iąx LcH$t LcLcLMtH H$H9H H-!!HELLHH[]A\A]A^A_AWHpDAVAUL-:ATfInUfH:"HHS1HhHtHYH &WD$8HHD$@HT$ )D$L$(L$HHuHx HHu/PE1L1H|$WHjjH HHHuA4H}HtHt$HtH} Aątt$8DL]HT$HHuH1H5H=#S./Ll$0MuL-L5IHuH|$H1AHB-HHu E|$8HHIDžx HLEt 3+HHLHy*4I8"u HSkH|$HE1z1H,IHthHIHL9t]A>uKLH)IHt!HLIMAuLEtI $uLE1I~I1E1HLH|$HhH[]A\A]A^A_AVHAWAUATUHHSHfHnfH:"HĀH`"HD$XLt$0HT$@HD$`)D$0L$HL$huH~ HHu2PAL*1H|$ WHjj&H HHQH}L=LmH]IMHuLH5BI; LHD$HLuH5~BI:v HuL ^H5wBI9O Ht$L臀HHH0>uLH5kBI8 oHt$HIHtZHT$h1ILH5H= <+x)|$XLHx% H|$P9H|$h1Ht$Lv3Ht$Hi3LmH1[]A\A]A^AUATUHHSHHuH~ HHu2PHA1L%HD$PjjfH HHLmL%I}L9tELu9LÃtHmH}L9usHtLtH H5gH91HŃt#A1H5H=|)y!B Ht6M 8u0u#߉ILAsEu1HH:y( HHH[]A\A]AVAUATUHHSH HuH~ HHu2PHA1L7HD$PjjH HHLeH5mI|$H9t tH H54H91LuÃtH}Ht$IuHttH}HgLtdD4$Dl$A1H5jH=EDq(x68DDI(Lt 8u{t1HHHHH:'H []A\A]A^AVH<WAUATUHHHfHnfH:"HxHHD$0Ll$ D$HHD$P)D$ L$8L$XuH~ HHu5PAL1H|$WHjjGH HHu1H}LtH}Ht$-HtH}HJtD4$l$A1HT$XH5H=E'xH|$@DILLAEyH Ht$XH9H H-4HEL0HxH]A\A]A^AWHAVfHnfHnAUATE1UHH5SHHfH:"fH:"HHtLaWHHDŽ$L$DŽ$Ll$0HDŽ$HD$@D$XHD$`D$$)$$$)L$0D$HD$huH~ HHu5PAL*1HH|$WHjjcH HHH}LH}LIMIuMH}HtHt$tzMItH}HuH} ŅyWHtKIuH$$D|$tH|$HuH$t%H|$PtL VH5;I9W1AHL$hH$EH5H=~DEAEE1x$x?AHL$PH$Iu ut!AA AHD HeLt!H 8HT$hH$H9H HgHLdL\HH[]A\A]A^A_AVHAUfHnfHnATIH9UfH:"HSH1fH:"1HHtHYWH)L$0Lt$0HDŽ$L$DŽ$HDŽ$HD$@D$XHD$`D$ )$$$D$HD$huI~ IHu5PHA1LHt$VLjjH HHH}LH}LLHu9\$ AHL$hH5H$H=XDE1O"y$^H}HxHHH$tH|$HuH$t%H|$PtH= H5;9H?1HT$PH$It  HgL}t!H HT$hH$H9}H'HHH}Ht$ NvLLHH[]A\A]A^AUH=;H'6WATfHnUfH:"HH`HHD$ Ll$D$8HD$@)D$L$(L$HuH}L5u HֹJuLeIT$HuL 4 H581I9#LHD$HL H571I8Ht$L,uHHH9u'H= H57H?Ht$H(1TLxHT$H1LH5DH=xH|$0HbHt$H9(H5 H>HL+H`H]A\A]UH1HSHHHL$LD$u1OH\$l$1H5}H=mHىOxՉމuH_ H8 HHH[]ATH1HUH&HHL$ LD$u1PDd$l$ 1H5H=DxD>uH H8 HHH]A\AVAUATUSHHHuH+L% H}L9u!aHֹH=uXLu6HŃtLkI}L9uOHt"LtH H5FH:1LAătH{Ht$zuHtLt$1DH5H=MxdLDILJyHH8H[]A\A]A^KHHH[]A\A]A^AUH1ATUHH5KSH=aAPx5HILAEt-r8u (t1 HH8Y[]A\A]H;HZ[]A\A]USHHHuH+H5 H}H9u!(HֹH= u^tH H5H8=H Ńt$H{Ht$tHt$H[]LHtH1[]UHHHHuH~ HHu0APAL1HD$Pjj H HHu17H?ŅxH5H=a1xH5F蹩H]ATH1HUSHHtHAH$H0HuHx HHu-APE1LHT$R1jj H HHHu%H,$1H50H=XHyH?Hu1IHHtcH~L FH521I9mHyL"H52I8#PHkH=& H>pHu1@H HpHHLu HH9uI $uL E1HL[]A\AWAVAUATUHSHH8HwH$H~)HEH$1ҹHH=]uH=]OH=OHD$H= OIxH|$ItH H9T$uL H5E1I:MtI9uL H5I9 E1HtH9uH-h H5E1H} H<$HE$1H5H=xL1H5O1ZHHu HuAH|$L5N11L)IHu HIHuLHxHH:۾HH9HtX1LL1IHtHI $HuLHxH H9lHH9EHt%H|$L5ML%LLH|$LIHD$MHIwvH|$LGA_LoH|$HD$`H|$HD$ tHuE11E1IL1H5@M1HHu HuH<$LL:LLH,IHHLMALPAHLHHHHD$(H<$IH|HT$(HHtHMHuHIuLI $uLHHS I E1HH H FH0H9HHu/&IHL&I8HHuHE1H:*HHt Lh| IDHL$ HT$HIIuLL|$H|$I7H4$HH7uLnHM1LH5H=E11E11E11E1E1L HH|$LLkH<$u"L1H5J1HHu!$H<$Lbt(HuH|$H8[]A\A]A^A_H8L[]A\A]A^A_AWAVAUATU1SHHLVHtHjLIBLfL}HwHt1PLALLgHL$ Q1jjH IHt?I $HHyH9t3HH $:H $uHSH5H={E1`MT$IR u%LHE1H52H=A)MHMl$MtIIuIMt$Mt IHuIIl$ I9t+IuuL H5M+E1I9zI9t4I~u'L\H5E+E1I8JHIILYPHEM{uOMt#H9u'H=H5WE1H?<H9L5H5+E1I>H9tyLEM9t(H-HQpH5*L1H} IE1MtHM9~CJTHrH;5t$H |HV1H5*H9IIE1Mu1HH5H $H=LT$Ht$H<$1IIHI9tHx@IELh@HuI9tIMw H9tHEIo0HII9(HHL[]A\A]A^A_AUH&WATIHH6UfHnfH:"HpH=HD$HHl$ H|$0HD$P)D$ L$8L$XuH~ HMu7PLA1LD$APLĵjjKH IHuE1I<$HtI|$Ht$tՋ|$HLd$t LIjHT$X1LH5H=N xH|$@LI3LAEyH Ht$XH9I L-;IEH7HpL]A\A]ATUSHiHuE1gH*KHH*C^XIHt(H*HEH*C^XgIHuHMuHHE IL[]A\AVHBAUATUHSHH@HwL#H5ZI|$H9u$+HH=euWtH\H5H:M1~LAAătH{E1H~Ls HtCHt$I7x2LL7x#H\$ LDHWtH=|!' 1HH@[]A\A]A^ATUHH(H~H5iH9t tHH55H81IHyŃt!IL% t!H=! 1I1MtLH(]A\AVAUATIUSH H|$Ht-HT$LD$L[t HD$HHD$E1Hcx HD$Hu5_McIk HHK {HHH@HtAHt$HE AJlH\$D9k~5HHuH|$HuN1UHMuHHPLDt$XDL$IHLPIHEHHEZYHuHHL[]A\A]A^A_HE1jsHHjcHHAQE1PHAWAVAUATUSHHH|$H=Ht$HT$ D$<HD$HXH1HL$H9tE1E1KH=@諴HHtH;4tH5IHu E1HIHtH=HYHHt@HHHul)HPtHUHHu HH6H=:L #IHtOHLL$(yLL$(HIu LL$()HptHIHu L ̞LL$( LL$(HIu HuLuLuPLIعAWH|$LWt$8Ht$8H|$0xH HIuLuLuMuLl$< u?hH|$sHHu LI)LD$ LMHt$HHP LIMBI $uLLȣ1HH[]A\A]A^A_? ZV Ht HxYP!1ZUHHUHuHt H#Hu] HH5H81] USHQH=REIHtV1Hx MPHHI1HHIXAhLMXIqAfInI LfI:"A@MQZL[]UHH1H5cHLD$I腮A1EtH$Ht$HZ H]AWAAHAVAUATMUHSH8L_L;DAAADAAEED!DD$HPDpL|I^H$H|MAHLD$DDL\$HD$WAǃLL$t H=nLl$M9MMUII I} H HHH|$HL;ADAADHHI~EHHHeHt+HLHH5H1I8LxH=hBu H=r,y AEt6L5I>贏tI>11H5eE1:A1AxEILE1ֱMtD9~KEtHHSI HHSIMtEH=L!H1LIH=L!y7LH;E1S $ZL[]A\A]AWL= L!AVALAUIATIUHSAQHt9H}EtHELAXL[]A\A]A^A_LHEYI[]A\A]A^A_H5LE0LLHDISL1ZL[]A\A]A^A_HH1?HHH,AUL-LK!ATIUHLHtHEH}L]A\A]H5UL襱LH1NL1H膱H]A\A]AVL5J!AUIATIUHLAPHtHEH}LLY]A\A]A^H5L0LLHL1HZH]A\A]A^HAWAVAUATAUxtEAIIʴH={J!wLLDH=ZJ!A ӊ]DA\A]A^A_AWLO8AVAUE1ATUSHQL LwHO(LG0HLL3 IHtIL9+vDHCJ,Ht2HKHULLLD LRt LE1_] HmIZL[]A\A]A^A_UW1SH()$HD$HHzH HYJHD$HumH=CI!AH=*I!H=&I!H$՝H<$tH5H-H!HXH<$H5JH51H9tH|$HtHD$HuH|$Ht1H5:H|$6H<$Ht(HD$H([]f.f=m!ATt/ 諘IHt1H脮LA\\ff.@HHoH)LnH9uHHDeff.LTHE1?L|Au.uGH9tEu/L9t@LHE1A PHuL9t_HA1ff.HmH"LmH9uaHLfHHHHmH)LmH9uHHDHHLHHҾHEff.AWAVAUIATUHSHHT$pHL$xL$L$t@)$)$)$)$)$)$)$)$HHXHLHJMH{H mLXLMLOH9!E1f;H\$tK1kH2H{@K,uw1H{8LT$fnf:"fS,蓕H\$HEH+)HE1JdoH|$0AVoH|$(Lo(tff.fH1AWAVAUATAHS㥛 USH8H9MIHHE1L|$Hu]L袶ÃEAAEt0Eu! tuH8[]A\A]A^A_EumEuLUÃGEA@u ElEt @tD1D!qS1H|$ 莄H@BHHHHD$(HL$ HHHHiHfHnfH:")D$ELLȯÃEADt(EtnNff.QڰXHGHwAWAVAUATUSH(HHHnLLD0I9HHHLL vǃHL@L9ubHSGLBD[ EH&L#E4$H([]A\A]A^A_H@HHPtL|$tOH<$H8HPHHDLHL$賋HXLLH<$nt%tOLLRDEtLL$L9PuC CbC C D0S D C$ ЉCHDff.@H/AW AVAUIATUSHHHt&HHHxI}IPHIOMH;@H=;u. I}`HHt L47I>uTH8H;H{tHcsHHHwHMt5I>tHs0L趆HuHp$IH;HLxIHI$Hs0HL]'I/E6$fDI}hHH!I}pHHI}PHI8IHfIHtMH; MMO 1L輼IH:I@H; I8uL8M8I} I}(uLS(MU(IuLMI uH I HHH2hH5HhH5uHuhH5~H^hxH5HGh+H5H0hH51HhH5HhMXAIl$I9K\LCA|MM`LMt LS`MMMPMt HCPH MMhMt HChHDMMpMt HSpHMMtHHvI}0zI}@u IuLC@LME@MI}Hu IuHSHHIUHII}XuLSXMtMM;VXI}8u L[8MIuHH Iu"HHtMI;IIuHH IuHH!ILMIIuHH[I I(u"H(HtMuI;(hI0yIHuLHMIuHH. HH1@I@I[I}xIH54H|$ HH|$H5[4HLLKxMMMxIDHDuI@H H;5 L=2IL nHuI}PuL@PMEPI}`bI}hJI}p2IMP1M|$L9|%I1πIH[]A\A]A^A_I|HwtLH뮀@EI@7L5|L9@#HpI@IMUXvI(MFhMMEI9u H0HIyu HHH6 Iyu LPM Iyu HpH Iy(u HH(H Iy8u LP8MIy@u Hp@H IyHH@HHMIAHINpHIEI9u LMIyu HrHIIyHBHHtLApI;@IAM^`MMEI9u I H Iyu IrHIyu IBH) Iyu IJHi Iy u Ir H Iy(u IB(H Iy0u IJ0H Iy8u Ir8H Iy@u IB@Hd IyHu IJHHIyPu IrPH IyXu IBXH Iy`u IJ`Hs Iyhu IrhHIypu IBpH Iyxu IJxHIuIH IuIHIuIHoIuIHwIuIHbIuIHIuIHIuIHIuIHIuIH+ IuIH IuIH IuIHIuIHIuIHIuIH"IuIHIuIHvIAMM11IHIEI9u LMDIy_HrHRHIq@MFPMMEI9u H0Hi Iyu HHHIyLPMMtMXPM;SMQL0MwMu*M0fMt I;IM;0;I}HsIHIHL;I,$IHL訬IHHpLyH BHIwLLyI/H(H HDuAMI?LL۹HHHpLCyHC襂HMHuHL NHm[I(HIH@HMI;@HUIUHMH1OHcIP)1H9=MtIFtAHHILXpM]pLPhMUhLH`MM`Mt I;[IOL5Z,IL eHMH1LH=h*HHIHLũ;HmMuE HL@HH= LeC@u"LLOwH$ 豀H LHLAHmEH H;CAA oEHL/HjH-ةH9HEH,Ht LYpM;MMt IxhH;7I1I@HIqMtMXhM;S8#MQ8MtIxhH;wIqMt I;I@iI[IMo@IA.HypH;wFMt I;I1MtIPhH;J(=II(4MMQMtI{`H;wIqMIIL5 (ILMC`I;@XI{`H;wPMC`I;MuI1MuISIxPH;7lIS`H;u2Mt M;^8M]8Mu;IMuSIMt I;IMC`I;uI/L|I{`H;ukI{`H;p IiIZ1LH賊IH$ HI,$H H%H;hIH C@u"HLoHuxH HLL޵I/A HHPb1̥MXhM;SC;IPhH;JVIMtIS`H;{IoMuIxII{`H;uVP g Dff.@ATSHHCHHH F"L$MIT$H5",HH=DGE I$HHI|$1|\L UID$I\$MMZfInL IfH:"AD$IZHL[A\fDL%"MtAI$HH9Tf.H=H1IHUH=̡1IHt"I$L%*"9DATUSH$HHw(HHHw 1HHbIHHhHHX薏uH2Pu&I$L[]A\H Hyt HH9 ATH~US VHH H-áf9 HC[]A\ÃdttD EutHuH8ADž H@DHID9?DD9DD9Dž rADשH9|AUH HwGHxHH=^GH9uSHHt HT"]fHaHH H=KHH9u&HHEgHtH"]H]HfUHH$Ht H"]HHu]fDAWAVAUATUSHH H_H_L%D,I4H~H9trLnIEHFHtHHL[]A\A]A^A_D~(D;~,w&DHDHV^(HHNHOHyfE1L"M~EHL "O4MM9KIFEjADM4HtMLHDP$EnMNM$fHnDfInpED$D9uwLhIMHHLH+5"IFHHHL@$p MFEnE"I,fHnfHnHUD[fDnLh0EAAA0D)fE:"MX,LxfDH$IWHJHHEnINE$ M~ L="MIG(DP$== L-l"MMIW H=BMHF"BIHt H5%"H "IHH;5"H5"vH5"DIGMoAG@t EOfL"L="AG EOMO"AD$ ID$HH=$"I|$HL]A\@H= )$yIHLfo$DATSHHHw 1IHt'HXHׇu!HsPu)I$HL[A\H RHytA<fDH'HD$HtH|$#HD$HfUHgpH11H] f.AWAVAUL,7ATUSHHH|$H|$ Ll$(HD$@HD$HHHHLd$PfHDŽ$L)D$pDŽ$Ht$x)D$P)D$`  HT$XH|$LELl$(HD$pHD$HD$L9HH|$@Hu%H|$HHu3LHĘ[]A\A]A^A_ÐH/u赗H|$HHtH/u蝗H?@"H IHl$D$T$`LD$XRHT$pLt$PMILAF @S(LH)HDpEVA?HA.L)HD$HT$pDFALYLt$Ll$(LM9!HL+t$ L3~HLuH HHL9rL9 (vvSxMI)IDpENA?HA.@2HL9(wt@*HHڃHl$H+l$ L5Lm|$Hl$0Ll$8uH|$mD$T$MmHt$@PATHl$(UHT$`RHHL$XQLL\$XASH|$8LL$XLD$PB H0H|$@H|$HLNF 1$IuHHS!H]HHLt$M99HD$ H4I)I)LL5Lt$L+t$ LMl6L5nMI)IDpDPENA?1u AAJ?  AHA*D#-HT$pLHHHt$LOMI)IDPxAr?uu ADwA? AHHAfDRI9`t f HHH9D$HLAIHIHAAI H0fnHIH(AAE@H8fAnہfAfAnfAfnfAfHffbfbflbVMI)IDPAz?HHA frL9AA1&MI)Ixw?u DpEVA?DHAI? HA)7ADaIHHA)L91j1L)HD$HHT$p`1LSHL$8H+L$0HL$hI)Ll$[Lt$HHA>>M)I1EnA`A8`QxD_A?1@Ld$P1LLDŽ$HD$xa1'L9L9(LH)HDpDXDHEVA?u AA{?Aq?A HA 7ADDIxw?w>Ihŀ@փAgjuHmDpE^A?fAKM1HAhŀ@փ+1Az*|$`UH|$0L\$8IM9I)L\$DXAk?A1@MI)I~]pDpD^A?u AN? HA.p~?1@[Ht$ DL$`Ll$XLD$pBARAf-$fCDEHD$pI1LHLHL$pH|$LSD_11QG=3H81@y1 1@yff.HUSHHHG HH)H9DC0HH+D9DCEH{4uwH{(H9HMDHHHbE ƒ @CHu0{5HsM Hm1HkKH[]DHLFLIIML)IH9hL)`H{DSH9{4tHAHIHH)HH9|H)LK(L9LMLE9{5HL>HHoH+<<ADDD[LMH{5LKC1HCE9DHHLC HE111H觿H;H+H/r"H+eAqE9DHACMHHLC HE111HKH;H/u͉C5VQf.AWAVAUATUSHHHHIHH90AE1AH{IHwIHL=͈LxLwH=ADOE*I$EI\$ID$Al$ AD0ID$(HL[]A\A]A^A_Ð*HXHAAH9}HE1 fI\$M\$HID$ȠAD$ ID$8ID$0tnAEtAI\$@M\$(/fHAE1H?bf.ID$@ID$(f1fA[L%F!MtzI$HFAE1HADHID$(ID$@ID$8ID$0bLVIAzQAE1^[]A\A]A^A_Lff.fHIH@LIHH9r eDH€:kHBH9uH9vML#uLR L99L9 HH)ILIIr2LLHHNMAHIAI9K4IE1At A:A>AtCfBIAt GFÐH)LIHr.HH7AHHQI0HI9xK IE1t A:A9tC4fB4ItGFÐH91IHLHHGLRH9ELOM8HGLJLRH9#HWLHGIPMPH9LOMHG MHMP H9HW LHG(IP MP(H9LO(MHG0MH(MP0H9HW0LHG8IP0MP8H9v}LO8MutHG@MH8I@H9vfHLu^HIIH9wLLML#XLRL9LI#IL9MH9DEHpEH9DPExuHpEPH9vhDHEx^HpEHH9vQPxILXAPL9v^DPExTHEPMHH9vDExHIEAH9uH)HH)fE11H9LHH)IMIthItVItDIt2It ItHWAIPJ K INOIJKIJ K INOIJKII9oJ K N\O\JTKTJLKLN\ O\ JT(KT(JL0KL0N\8O\8I@I9HHthHtVHtDHt2Ht HtLOAMHNOIJKIJ4K4IN O INOIJKII9J4K4NLOLN\O\JTKTJt Kt NL(OL(N\0O\0JT8KT8I@I9fHu f.H/u%DUHHw H/HtF5Hu0H;uu HH]bfHXHHHH]BHH]HtHHmuH讀H-?!HHEH@SHHGHHt HH[G @tBHW0u9H f7!HHt?H9tHH/uHD$$HD$HWH뼃uHw뵋HH!HtWHHwHHH9t%H}HHHEH/uH[]MDK HHK ]HN>!HHAVAUATUSHHG zH~HIIH9^u LnIuLoIH>HE H=H9H}(HL$LLHPHHH}(;Ht HD$HkH[]A\A]A^DH] H{Lt$:HLLSH{(IIHS HRHIMfBOM4IH|$I$HH}HtYMfLe(M.Lm I} M\IFL5"HHEILuL5"ImI} H[]A\A]A^@It$@LWA@tLC MkDMN4RI9N4BI4HLLLLHkuHmH] HHHL }HM9L$u I|$IL}H]HMHIHrfHnH HfH:"MHJlff.UHSHH_HCxHgH[]ff.ATSHLgItHL[A\@G H\@Hw t1@tH{0uHCIHL[A\H{HuHCIp"H5޺"H-Q"HLIMH(I@IhI@ I@(IXIIxIyI1HIApI)AIxHHL[]A\A]f.I|$0cIHdHsIMH(I@IXIPI@ IHH^H3HIIxN@IM]AT@IK|%({bIHLHLH(HhHXLPH@ I_IIsMAMFAA8fCD)+IL$1LKD!HHKD)IIIIIMHL9HtfHtOHtAHt3Ht%HtHt MYMHMHMHMHMHMHL9fMM\M\M\M\ M\(M\0M\8H@L92ACD)L,?HnK|%(`IHt0H=:IMH(IhIXIxI@ g ff.AWIAVAUIATUHSH8HG H=VqH9~L@(H@IH=LHMLMM!H=ZN$6ItjK)LH9+HzHPHuH0ff.HOHILB(HyI!LHoB| (yfDIKIIDH!|(xH LJDH!|(xAHHHDH!HgMMyDH^fCfHOHLL;HH`Lk vH@DD4L91LcINIHIDL!L9<LcmHL,GHHkIHH.fo IHqAKLQMSL9HHyuHHHytoIH0A[HAICL9uf1E1I9})HLHH<HLO IH<LLHLL-v"QjID$(M9DLW+7HL ?zHHJL9Lc,HG`0fUG Hƒ}H(Hƒ` `NH}LzL@M9YHSLH=%L95HH-!"]fucHHH=R(!U!H}(E H\@yƒ @u2HMHH9tDiE .fDH=@nHu0H9uΉ``@H}8HtJLEH@L9hU HiHH=;H9u/H]>H;}HuH}HHehHMH6H]H]A%DHHbUHH=H9uEHtHH-"t ]HH H=H9u H]->H]Ht=UHHH-\"7t]HzHH=LH9u H]=H]>mS]IIAP ;="H ("HRHHL L)HweMt`MPLIxMtA(tN[AX$L A(<IHPfHnfH:"A)HL@LB[fD1[A@ IxL"MXH@HL_HI{HSIPLCDCK MH9u Hs(HusK4ADKD;KAtaK<uKH97H{(L[ HL_ HQ HC fHnHx(fH:"C HtHZ(HY D;Ft1L"HC(LC MtIX(H="H"H"[LK(LS Mt\MQ HK HuIH5T"H= HF"Hs H3 H[H-"L"&LI(L "UH HG -HdHH9Vu*HVHt HG HL$PHx>HD$H ]@HHt$UHHtHE Ht$HL$HPHyH 1]fAWIAVAUIATUHSHH8HdH9FHW HBHJ(IH=L@MMM!HAH=YN$7ItaKdI4HHVH9uH[(J,I/H8L[]A\A]A^A_L9.tbIO4Ot1M!H=~H=3N$wIuII IHxfDL9Nc$Àz  } HBH;EHQu z @t$1@D\$@HA A@Hu0@ Z@@tiHz0HLD$ LL$LT$HL$bHL$LT$ALL$LD$ CH=LL@MMM!dHzHHuHxff.fHcHXHHBX@AUIATUHSH^HH_(H_ HH@H&2IHHrH1LHHH}(HIl$uiH ^rGI$@t;LbIl$M\$MMQfInL MfH:"AD$MYHL[]A\A]ÐHEfPIHEMl$Il$uL_HdHEH1FfDATUHHG IHH`H9Vu-HVHt#H H9O t>HLH]A\OHHt$QHHt$H5{H9u Ht$uHLH]A\H]A\AVIAUATIUHSHH HHH(Lk HL$LHHAUIHH{HK(H*ILk I}yLLFMU MMIu(K(tUH HHHHLJH|$Im1HHGHwHI^fUHHSHHHtWH~RHUHHPHt@HMHHH Ht.HuHHp(HtLDILDHH9uH[]fATUHSHEHH9P0FLHTMXE$A1HMAE$HH]Hx@HIHu@N1H ]A\A]HT$Ht$H|$;IE LLHHPHT$Ht$H|$I1My11DATfUHHMHXHzXLb`BXHjhHBhHuMu=Hu H]A\H/uuLHmuXH]A\]LDI,$uLILATfHnUfH:"SHHHutH{XLc`CXHkhHKhHuMu&Hu9H[]A\H/uKMtI,$uLKHt@HmuHH[]A\KHMH9A{H)u1jff.ATUHSH?w[]A\ IHIpLkD$L DOpL9t,DMT$M\$AIM IMT$M$$L9uHLd$@DLkl$fInL5bD)D$@O.pL5L9Hl$HAMoIHLAMWMAI LIMWI9MIWHHuLD$HMI?LIHIfInH;L I0fH:"AL|$HL;L9uIHHl$HkD$HCHpLxH9t-L5BH fL9tLL?L9wuHL9uH9Y|$0HHLLl$@LL$PfInLL$ILl$@)d$PL"H7LOHIxH7IHL9uL|$PH\$L5UI9wH5BhL|$@,$)l$`M9Hl$8L-V?M9tzMIoM?I^L9LHE)H;?AH;DAEHH~HLuMtL>I~LuHl$8E1Ll$`H$L9fHnMc)|$`\MIvH$MQHLAI MQM^HL$hAI M^L1Lt$hIFIuI^LMLt$@M9uH<$LJLL$@M9t#MAIIAH<I MAM M9uL L|$@1LM9tPL1LAHLQHMIAEAL HHAHL9u1҅{H6HL9uIL%L @AhM9tcI_ IHHt5IGHHVIouHJ?L;|$@tL|$@LH葦 L|$@Lt$P1H5BL%\L>@AhL;t$'L=@Lt$PI({L;t$SH|$HrI|$0bHHt$ HtL.Ld$(MtI$LkL$L?L=?L9 MIIHLfLnfL:"J+GIfA;H[]A\A]A^A_HHl$LHAIH6tB:I0{G!N1pf.L9I}H:I9EH9L/H9GL9I}II9EH9L/H9G|L9I}I9EtyH9L/H9GtWL9I}II9EtqH9|L/H9Gt/L9tnI}II9EuKLH9tTL/H9GuH4fHLHI4fLMH4LkL$H5=E1H==NpHLJ@L9tDMIL9uHe=L8'L=R=L5K=E1MII9tDMII9uH==L@AFIH4$I~% I](M}11LHHHH(xImuL;L;l$`AH9I^Q1JL<I(Hg麼HM~IFIFLAInL;ff.fATUSHH9t0HL%f.HCH{LHHH9u[]A\ff.@AWL=AVIAUIATUHSHLgLHx+M9u@LdMID$@(Hs1H[]A\A]A^A_fJTHzHT$HKLAօuI\$ItHt$H~H$LAօuI\$ItH|$H?HLAօvI\$IeLD$IxHLAօGI\$I6LL$IyHLAօI\$IH|HtyLAօHsfDHHHu,ID$HID$HH H9uA$%u~IHLff.@HHtHHHH9uHO@u1DfDHHHuHGtHHG1fH5IH9uDAEuHH|$H|$tHGtHHG1H@HG@u1HHHuHGtHHG1ÐHH9uuHH|$H|$tHGtHHG1HHG@u1HHHuHGtHHG1ÐHIH9uuHH|$H|$tHGtHHG1HH%AWAVAUIATIUHSHHG HPHX(HLp HH5"H9pM](MM~vH=HH9u~1L=}HHL9tKL#MtMD$A@tMHM4ID$tHHHID$L9uD1H[]A\A]A^A_E1DH;HtLՅuIHM9tH;HuIHM9uM~L 1L=L9t/xM9%u8@HI9cM](I,HtLUA@tMHMuHEtHHHEL9ufDM](IH{(Hu1[HC(H/u**HCH/u*HC0H/u*@HGAVAUATUSHH=w)GH5w"HHHH[]A\A]A^fHx;IAAIuF|HtLpX[]A\A]A^HIIu IAM1IjHc)HnA?A?XD`HcHHMFDp =ff.@ATSHHH HHXHIu!Hq%Pu)I$HL[A\H P%Hyt鲲魲@ATUSHHFH_Ht$HHH|$I9HHHSHt$H9u)1HLLH|$H/t)H[]A\HLH|$H/u 1 ff.AWAVAUATUSHHFH_ĸIHIIH[HEHHs5IHukMI}H HLLHHAEMHm2HD[]A\A]A^A_DHPHHHtLLLI,$AHmuMELHMIMHLO(LO HIIIKt AOL\)HSHI;MuH51A{H51AgI,$bL-[UH颷H5L$H>DL(HI:-AUATH8L% &L9fuP~ yJH~dCt:FL 1%H @M A;uI9quMiH8LA\A]HT$,H4$H|$H4$|$,IfHnfH:"H|$L9fu~ yH~dLAtQDDfH H E1AKdHHHzDHH/Su%IAHt$)$I,H|$yXH|$fo$Ht$qff.fAWIAVAUATIUSHHH$H9FLnII$XHHMLuHQHUMxHuLHHHALIHٵIH} LHHpHHILE(LHI9HHkILM0LHIHH4ItULTLHHD$IL\$HuZL\$`HHD$HI9ufHMAHHMHHL[]A\A]A^A_fHMIAH@AE1@H IH9Hx IL$HH"EIHL9w3@MKLHIHHH;-@ IM9O$I9D$LB L9t|M\$LHIHHlL; tcIOM`OI9}H- H9LH; rjAs @SH; utEL$ AA@@I^H9LMH9v&HEHH)HHHH)H|*H|$L+XHH9l$0\Lc$L|$(LT$@MKlmHAL,EHDŽ,L,D$AOH/u(H|$Hl$8H}H/uH|$H\$8H{H/uH|$HL$8HyH/uH|$H|$8H H/uH|$tiHt$8H~(H/uH|$tMLT$8Iz0H/upH|$t1AHT$8JH8MHc$LkIAD$ENJDŽJAHl$@MHNA UHH9AH9LFMML$ HAIAHAEHHt$ II9~M8LK4[HH蔁}Hk LuIuAH} MH<$HE1@Nt5(L[(M~IMInHtQIHE|$ HLLێHmI/lHK L<$L9y MFIVLs(IMxMIhHt[IHE|$ HLLLD$_HmLD$I/LK H$I9A IMpL9,$1H([]A\A]A^A_Hs(M~IHInHtQIHE|$ HLLɍHm{I/LS H$I9R fIH<$AkgHHHHHmIBMuRmA^HHIH7HHL}Hm ImȏL7HHuI/uLQHAI~(LLLD$HT$5H|$LD$HcH|$LD$HT$HHLLgLD$Hm鈏LLHT$HTHHT$HLLHm=馎K,HJK,HcHL)H܏H頏LLHT$=LL$HuGLL$HT$HHLL}Hm閍H.Hv镍&nigHjގAAWAVAUATUHSHLo(Lg ±HUHH9B0H HX1 MMtI,$uL Lc 0"LUAOuL;fhEYL--."D0"KlHt!HtH[]A\A]A^A_1MsH=-"I9gLE Mp MI}Ht H/II}Ht H/II}Ht H/II}Ht H/ItoI} HtH/uItRI}(Ht H/It9I}0Ht H/It AK|HtH/tnIM9uLȪjHA@Hsi_(U;KgAv7ZH[]A\A]A^A_X[]A\A]A^A_fAUATIUSHH_Lo HML1H{0HtH/tQH{8HtH/tRHHL9|I|$uSHc=1"OGDGL v."M$D0"H[]A\A]{fkfHtHL[]A\A]xH HMDHtH HHaHff.UHHHHXHJHHtHH] /HHt$(#Ht$H1H]b#fATUHHSHu H|HmHtH=L$J\%H9 UHEsH9uHM9iH9ULM 9#L9U LU9L9UL]9UL9ULE9LL9v}UHE9GH9viUHM 9BH9vUU LM$9=L9vAU$LU(98L9v-U(L],9rL9vAI9v1\IHP <uZ  @qI@0LIHHH| I9E#HIDbEKDJESDRAs@r΄ԋ<uf Ӌ@IpHϋIIIJT%I9L]L1LHL9HBHL9HBHH9v9)HHfn< %@IXH!HHL[L]A\h!LeIE1II9MGII9IGHH9v͋1HIArw2w#LH5 1I8 E1[L]A\ÁwЉwwwwwDEA[D]A\!HIHL% MI$MMAC A IIESA{HL HH HH IA 鳉I@Hff.fHAUIHATU%HHIHwHNpHHAHLL9uK ɊLM9\$u@IT$Ht5HޡLLHH9E t?]A\A]uD]LLA\A]LHHu]A\A]fD]A\A]6kH~hHt'MD$MH`MtILH(oH=/ *< HtFAUATUSAPHHGI ӊHOHH(H;tnH HG HHHH9P HHHHIt$ HHr HHHE1LmIHu IH~0HkLD=0LL 0IfMPMt~MIIIM9uH1HHΉMl$I|$Lht8L%EHxH@I$HZfHnH H;fH:"EHzZH[]A\A]IM9lFF&FfFI DADSFHH(LHt^[]A\A]"FIHo IHEHHHHL9H<IHH=hHHpA~L$ L I("fI:"IH IL$MT$ LHHH1IL (" ITHH9tIt$(HHtHI|$LH}H]MMefInL I$fH:"UI]bfDAWAVAUATUSHLwM5IH HNHO'=HgV/'I녱y7HHHIII|$ HHHHIHII|$(HHHHIHItcI|$0aHHHHIHIt7AK|/HtxHIHHIHM9ufDHc/'L1HHtGH[]A\A]A^A_Hc/'I1H-L LH߆H[]A\A]A^A_HφfDAUATIUHSH_ @@t@LmLL9t 1H[]A\A]À  H}0LL1ff.AWAVAUIATUSHHGHH;G OHpHwyA}K Ãh؃AƃS^L*Mc MA@L H?IU8H9B7HZLLL[/HHZL$LI |AmL HD$I׮IHI4H|$u A>u @_3MHL9EPBu A_MxL9A@u<_IpH9EHBu A_MXL9ExBu A_IxH9EHBu A_MPL9tjEXBuA_ulI@H9tOAxu@_uRIpH9t5EPBuA_u7I I9tE8BuA_uII9uH|$LD$I9uoHaHD[]A\A]A^A_H;t9H;uHIH Hu'I/uLHMDAL7HD$H~IDAHmu~fH~ATISHQHwH衱~H9x~I$LZ[A\ATDUH-z JDSHt H[]A\É@9HtP ~@t HH0JDHHH@UHHGHV\~O~ Hy ~ y4H9t HH]験1H]Ht$ց V~Ht$/~HIHXHJHA8HB~HGff.AWAVAUATUSHxGHGLL$HHD$LXHHIHHHLMOIHxHhME$HT$L$$HD$(Hc]L9IOHMI$hIM$hHHM_I$pIM$pH]HIWI$xHI$xH"Ht\IOI$HI$H+Ht5AK4KhHKhHII9uDE$nLc$H$IHLc}M99 ML+$M9I91H9$H|$MNI8aH$H4HHI0H;$HL$M,N I9eH$LHIMH;$}tLD$I<IH8oH$L,HIEL(H9$~;OIhH$L IMhHH9$ufU-H}XHLEPIxE$OH-"1LLXIB8M$IMKIAv NAN M $Mq|L觾An HxL[]A\A]A^A_H/N聾HIfH\$0E1HHL$H$JIML5{It$I\$ILGfHnL IfH:"AD$H_pE$Hc}L1LH9H$w1IH=,rL1T$薄IMHsH=/^5{ILM+H J+LEHÃ|$HMpRMARL]LL SMDH 1AUL-uIu}I/H HI/HuL1H+4sI$E1LJHKL5;ID$I|$M $MIkfInH H}fH:"AL$I{+DH/蹵H}XHDIH/v艵lH/~utL\$PL\$`ILT$HKt;LL$@L\$XH|$8H|$8LL$@LT$HL\$P>L|$hIL9|$Hl$@Hl$XH\$8LLl$HMMHtL\$`L<LL$XH|$P覹H|$PLL$XL\$`HH9\$MH\$8MHl$@Ll$HGH/QuGH/ a1腎HH/>T~IILD$H$HL Hh}I rHHMpH LH01={H/蹳1ݍIH/薳LHMpL1H6(I2zFLLH+$1H=3(!D$I~IhpH-MH\$8MHl$@Ll$H*pMfAWIAVAUIATUSHHHoHH9U0Lu(LIMHۮHǃrsrI$ID$@ID$HMt$(H`HEIl$C$HIEMl$0[(AAD$hAD$pA\$lAD$tID$`fEl$XHL[]A\A]A^A_DH5LYjIHHxH5H9j]ILMLc[s HCXHSPDL%O""HRHcHPHMIL$-4""H %""I9t$H=DGEGI$I\$ LI$hHID$@H~*H1H$qkH$ID$8ID$PvID$8ID$P_H=H$oIHpH$Lc[HX ypMMDIM|$8QLH$)rIH}pLH$AzuqLc[ILIHHuL|IHpH1H59pHfZoID$ppoH)HXHB8AWAVAUATUSHHL5t$HMXIXH B B ;qAu0I}vL%Z( fA<$lwH{ LhLT$Lc_HW0H|$Ho@LO8OE\fSEL@eDShIEAAfAEA$HT$ IcELHHHtHH7EL & ML+$$fA9EHdDchIDEAfDB$H|$IcHMHLI:I HwNL%2& ALED+$E $ufEkEH5XdD[hIDAAfD$H{0LwL9_ˈHs(L9^LD$MMNLH+$MIICNHHIAyaLGM9A}aL^M9YoaM!HHI$L!EPEL/% ALE zfEpShAHZcIDfDB$IcHEM0L$L)LfI<$EL_H?HIK8AMHHMH|$(1H|$(1HHII9KH}LUH/t\M9KH}LUH/tEM9KH}LUH/t.M9KH}LUH/tM9KIzIH/uLD$(L5LD$(vHH}H;=LH;=oNH/v~IcL # L$$ELHEM< EfEA7H=aKhID@fDB$AL$HLELM?KL%IcHHL$(HMHXAPgH5 ELLH+<$DEUfEKAH8L{hIADfAEB$oEALf:EL% ML+$fA<$ELKDShIEAAfAEA$IcHHL$(7IHuL\$(M@H\$(HLEp@IH\$(HhL APSH ELLH+ $0EBf9AH=&KKhIADfAEB$AQ?I1HIL$I|$HH|$0HL$P詆H|$0HT$PHD$(H/eH*{ZH|$(I|$H}EPEL 6 ALLH+$E!zfEpEH5]JChIEAAfAE$DHHMHHHL$(H|LT$(AI*uLEEPEL ALML+$AfA?LID[hID@fDC$Ic贡IHbDH&<HL EPEZH ELLH+$:EIf@EH5-IChIEEAfAEB$LeH}HLH|$0yH|$0HD$(H/`DI,$EHL$(HMHEPEHW ALML+$2fEL HD[hIDEAfDC$H}H;=.0<HH/tH= ALED+$7*f!ALHD[hIADfAEC$HELMHMHmHs0LL$(HHHL$PHD$0rHmL\$0LD$PjI+{WH`AtH|$(HWLGHP0AEAEAEIEPIhEEL ELLH+$A;E3f*A7HGShIAD@fAEB$HMHLaLeL9Y>LHLd$0HL$(&MIHD$0LD$(H(5@I(_>LeMrAPH5, ALLH+ $DpfEfELSFKhIEAAfAEA$LeH}HLH|$0^H|$0HD$(H/WjI,$UHL$(HMHEPEL} ELLH+$EEfEALEChIfDA$LeH}HLH|$0_hH|$0HD$(H/@=I,$LHL$(HMHEPE&L ELLH+$EEfE AL DChIfDA$H}H;=;H;=KH|$(UH|$(n<McL$$IO<ChIEAAfAE$H}H5H|$(HeH|$(H5HD$0LL$0HeH|$(HEH/^IAHH8HI HH11LLL$(1H|$(1H@nLL$(I)[LHD$(蔆HD$(H ML+$HH+K@MþzHHIHD$0C\LD$(IHPH|$0I<$APLHALDBfE8EHD$(H= =IEEىChAfAEB$LeH}HLLd$0H|$(#GH|$(HL$0IH/`H)fHH蚅LeM EPEL @ALLH+$EfEzA7H=g<ChIAD@fAEB$LeH}HLH|$0kH|$0HD$(H/BWI,$KHL$(HMH EPEHALLH+4$DfEAL ;shIADfAEC$H}H|$(\LH|$(AH/JBLUEAL%>I$M"APGH=ELLH+ $7E6f-EL;KhIDEAfDC$ML+$IIcHH McH ~ELHIHHM1LH+$EfEL:ChIDEAfDC$LeH}HLH|$0>H|$0HD$(H/CI,$IHL$(HMH APLELLH+$EEfEEH=9ChIDAAfD$LeM4H}L%HmHEL_L$L$L$MC8A4JH4H|$(H$1Hl$0H|$(1HiH|$(fMnHt$0HfL:"H/eHt$(D)T$0HHt$(fDoT$0II$HnDAPL%ALML+$A$fEH8DShIEEAfAEB$LeH}HLH|$0~H|$0D$(H/[^I,$&BT$(AP-LELLH+ $A:EfEH7KhIEAAfAE$IcH{8Ld$MdH#[H~LH9GFKHFHHHHEPEL*ELLH+$A EmfdA7L Q7ChID@fDC$IcH{8Ld$HItLeH BLS}LL9G; I,$\7APH5zLH+$ALDfEEL6ChIDEAfDC$EE1AA9H}H|$(H}A9A9A7H~H9G6M6H}EPELLH+4$ALAfEH5shIDEAfDB$LeH}HLH|$0\JH|$0HD$(H/[I,$p?HL$(HMHUEPEcHLH+4$ALDSfEIA?L65shID@fDC$LD$@McHMHOI{IKH/EPEH=ELLH+4$EfAL4shIADfAEC$omHfH:fH~HHALmjL ML+$$fA9QEH>4DchIDEAfDB$LeH}HLH|$0&kH|$0HD$(H/=I,$=HL$(HMHAPLiML+$ALA;fAH3DShIADfAEB$DALMLeLD LLL$(HI,IL\$(M`YIMFYAPH5ML+$ALfA?H2DChIAD@fAEB$L\$HMMcHH{0KtHHL$(词LT$(AI*RE^APmH5ML+$AL^fUELB2DChIDEAfDC$H{(H `xH9OXH5GB3HBXHIHI$APL~LH+$ALA0fEL1ChIEAAfAEA$Ht$IcH{8HL$(LwHFXLVPH+HItL9GXpEHQYMt I}XLL$@H|$(IHBHXHIHI$APLLH+$ALA fEH=0ChIEEAfAEB$A:IE1MbIjM:ID$H;@ OHMIM:LLLL\$(H|$(H/NI,$ZMXI}XXHuI}@H?{p*Lc{pO NEZxAm)HS@HAH)H9%'H}LeH&'MI)IDA9H}LeH6Mk ML+S@IDF9}TH}LeH6Ik LH+S@HH;~'I|$IHf6LH+C@H;K4|xz>O<HߺFD|MDD$(#BIOI $II|$MM()ML$H$LH$H$HHL$PHT$0?HL$PHLHT$0?`H$H7UH$wH$H$HIH$HIGIwHH=LH+ $AL7/f&EL'KhIEAAfAEA$HD$(ERH}HMHL$0HQgHl$0EQEPEH LLH+$AL1fELv&ChIEAAfAEA$H{8H?LlL9WGH5Rm'HuIMt I}X#IHH{8HH54lI,$GAPȿLsLH+<$ALE fEEH5%{hIEAAfAE$舂HIIcDd$PILH\$(MHIH["LkLK4Ht$0%?:QHHUH IHMH-5gHLHH9kM{I,$ML`0D$lHct$lH$MIH&L%hLl$0Hl$PH\$XI4$L#}0Ls(1H$H/u t$0*it$0t$PH18Ht$(L$PH>HGH|$0HHCEPEHML+ $ALDfEݹEH=DKhIEAAfAE$1fHuIcDd$0IH\$(HH?-LkLJtnBAHHL$@McN IyHW2IAH/uhEPEH=LH+4$AL fELshIDEAfDC$IcLd$I H9HDHOEPEL BLH+$ALA9f~A7LkShIA@@fAEA$H}H|$(4H|$(IH/LeMEPEH=LH+ $AL7fELKhIEAAfAEA$IcLd$H{(HL]H5ݣITLeL\$(HT$0HH9MMI;09L`gA8HS8HuHhHs0HL$(H|$0KI,$GLD$(I8HOH|$0IHGHEHAPLML+ $ALE#նfE˶AH=DKhIADfAEB$H}LeIt$HH;5YgD$(H/:H..,|$(-<AP6LALML+$A%fEH5 DChIEEAfAEB$LeH}HLH|$0CH|$0HD$(H/udI,$j4H|$(H}HxAPL 2LH+$ALEwfEmEH5ZChIEAAfAE$LeH}HLH|$0(H|$0HD$(H/=I,$6I,$uLbHL$(HMHnEPE|L 'LH+$ALElfEbAH=OChIDfDB$LeH}HLH|$0*$H|$0HD$(H/;I,$(HL$(HMHEPEѲL|LH+$ALAfA7H=ChIAD@fAEB$IcH{8Ld$MdH H8VH@HuHcHUE\$H4ALUHmMcAL$J,HLAHLbHcHL$s|L\$(UL\$(顴LUjIH)LeMǾ@HHD$0HL$(vUHD$0HL$(鷸H|$0LT$XXUI,$LT$XLLT$0;ULT$0L߉T$0HD$( UI,$HD$(T$08H;=YTL<$H=McALIO<fEL D[hIEEAfAEC$TL]LULeHI|$LLL\$XH|$0LT$PNGH|$0HT$PHD$(Ht$XH/\&H*7HH.HTI9KLMHLLL\$(賅HT$(錹HxH/Y#HxALHH/E HH\$(IiIEPEb鰤OMLLD$(IIBL\$XIHLT$PHTJt LL$0eLD$(4Ht$XHL$0HT$PH¾LZHt$0Ht LMkJT @eLD$(D4H|$0HH\$(HLkLLD$0JTJteLD$0HuH\$(G@HljT$(RT$(鎴L=\TL9~HHt$(SLT$(AI*qu MtIcL$H5ALHM<8]fTELA {hIEAAfAEA$HH/A'L%ALED+$E $fEA7H=DChIA@@fAE$MT$At M9LHLd$0HL$(IAz1H/KQIk ML+C@IDD9;=LQ HH/QPH9:HH+S@HD$(@HDPA9I|$Il$HyIL+C@DHIE9I|$Il$H1HH+{@pH9I|$Il$HHH+S@DPHA9}rI|$Il$HIL+C@DHIE9}KI|$Il$HdHH+s@DXHA9}$H}HH#IL+S@PID9|MLML]L\$(I8IHMHuM`HL$0IpHEI@`H|$0VLNHEHl$(OHt$PH|$0]Ht$PH|$0D$(HLD$(MOLD$(鴿IIk H݋ML+K@IDZE9AMIt$Il$I:IBI2MD$MzHD$(MBIL$IJH|$(L{pHH+{@E1HMH}H]IL+K@IEuMHHD$(xNHD$(H-_PH$LH$H$HL$XIl$HT$PHt$0HEHt$0HL$XLHT$P7H$H,H/#MCpH}LUHuHEDoMHUHLOLUHk DMMA8L$H$ H$A,H$1ɺHl$0H|$(VC@\M閻I@I+PLHHH)A}05)L*M鵷I,$LMI(LLH/LD$(LLD$(Ht$(LLD$0ILbHLT$0LLL$0LMMPHl$PA}0HT$(H|$0LILD$(IHl$XHl$PLLD$(FI,$LL$(H'LL$(Hl$XIVE1LeHuHULD$(HT$PMT$L;6LHt$0&{KoLKLHL$(MILDd$PEtH}HAH/uIIHmHM$EPEH?LH+4$ALf|EH=iqhIEEAfAEB$HHHT$LL$(McNdLVH|$(H GHs0LS(~vfI:"rHwHMMJMBLH(lIpMPMHp`ASIHLHH I@APT锛wJfLLL$0LD$(JLD$(LL$0I1I9ILHq@HL71I,$+HEHLIMA,I|$IHMHULeLL ']HHt$(HHD$0fLD$0H|$(L'Ld$0IL'GLHD$`MIHD$`LL$(Ht$0LLLD$( LD$(Hl$PHD$(IHD$(ӡAIH\$PIcLdM$APIl$ޙHML+$ALDΙfEęEH5DShIDEAfDB$LD$(fHD$(LH|$0LD$P8H|$0HL$PIH/uHL$0.HHL$0HMLL%ELD$PH|$0AH|$0LD$PIH/M| LAz4ژHјAxEhEVETEtWMP1LAL9=IHLH|$(`rH|$(L賈LLLAHMM?" fI}@ H|$pKKI,$uLFHL$pHMEPEӗL ~LH+$ALE×fEEH5ShIEAAfAE$D$HD$hMH|$G |$HD$LsD$h9Ht$DL! IyH/? IyAIYH/ EIHH\$(I:EPIjEЖM\$L\$XM~ A}08HT$(H|$0L?IL%IoHLEL%dHVHl$(OH @LLD$(H1Y0I}@LL$(H LLL$(GLD$(hI) I(HEH|$( H|$(H<$McINLLT$(I0TLT$(t&L\$XDIHHtHJH.!I*L@|$PLH\$0Dd$(t6HHT$(L\$(I+uLHD$(@HD$(HHDIDd$(IH\$0LӅt"H{HH/uHT$PN@HT$Pڋl$(H\$0LkMIEPIiE5H5LH+$AL>&fEL ShIDEAfDC$H/?H|$(GH/?Ld$(AD$~H/M?HL$(A;H/ g?HD$(@H/K?L\$(ACH/}.?HL$(AkL?M?8L?ͽL>ELH0HPHHHH;5@ HHtHHtHLAuL}LU H=<7 A1EJMXIXQH@LHгLH00MGI7@GL;=@I/LL\$(L\$(111LLL$(3H=麤=SHT$PEHLL$0=LL$0HT$PMHMHnA$@111LIHL@A@LeM$D$`H|$0H5yIHLXAHT$PHH=1 HHbHHD$(4HT$(H$H*uH9P ~]?UH\$(*r|Ll$0Hl$PH\$XyDAVIH5L!AUIATUSHH!LHHHH=<IHHCpH9fID$PHI\$IMt$ID$@HAD$ H[8ID$0IT$pHIl$XW8H~1HQP V29MXAF$HmH*L9HLL1[]A\A]A^A_ f.HS H{K|HL$CIHL$L5+IXLn*~ ~ A;;H= L\$E1L$,L$L\$Hm2L92Im L)L%'HP1H5l I<$KH1[]A\A]A^A_I?ff.fAUATUSHHH8HHI1HHIHH;;*u1HUt$H}uMHL[]A\A]fDI|$LXMt9MHM~I;XtHItI;X tH|$"ALLFMEH=iE9LgLD|H|$PHH L-LL$ f.ULMSHHHLL$8HD$8(bHt$HAQLL$@&ZYHuHT$HH[]EAWMAVAUIATMUSHXL6L$EA@<8aHHH PHcHD$L $Ll$L9L $a /σH{ L $MMHALL $H3/HC3L $MML0ALL $I/ЃHCIuH8iL//-AփLsI}M>L $+\LkL $IE/ZLCMpLsBL[ICHCoL[ICHCH{L_L[HSHrHszHSHBHCLSMBLC;LCMPLS~LSIJHKL $HHsL^L[LSIzH{L $L $HQAcL $L $Hy*L $hL $HL[ICHCkE1L;- IEA/HSEHDD LA/1ALDHLT$MVLLT$L$HAӅsL,$LL$LD$=Mc`E|$IM ExI$Ml$eH=LLLHX[]A\A]A^A_; L $bHL $IxuEeIHEeA/LSAsD߉3M :/AIDL;-6 I:u Az1MUABH|$Ht$HLL$L $1HL $t$HT$IHD$HHMNVL[ICHCpH{HGHCHCLPLS^LSMZL[FL[MSLSM uAZIM[LHt$HLL$L,$HIEH}H;D$HLL$HSHrHsLLH=~Lr ISLsM^L[L H5c I9 'H=H5 H? LLH=L HsHVHSHCHPHSI{H{HGHC=H-@H5Q H}P L-$H5 I}4 xL $D$L $D$HVAHCH-H5 H} 'L H5 I9 H{HWHSL{uDAUATUSHHGmO HH7ʃ``u1Ht&LKLMK ``u2Lc0HL[]A\A]Lc0H{8tHtLC0LEK Lc81H4IHtXHpH~HC8IHIMIu HHK0HImuLK ʃ`HVE1ZfDAWIIAVAUIATUHSH8HG H=H9~HH(H@IH=L@MHMM!H=_N$6ItoMx7K!HtdH=>!LcQIMI0ImIW`IHtLH:t HHHOHHuHH9HfDLF(MNM9H<MXL^MIJH(M;ZHM;Z HFM;\HH9uD$H=!1H,IFHD$H[H9n0QD$H+IL4LI9tHHuL;&"Hn0jH_hH-HH;=tcH;5cIFD$HD$&IwhLKD$D$HLxLNL%M9YuH9\$ uI8D$IGPIH_pH-6H_PH-'D$zIMWIGhIH-ILIIWPI~IOhHIGpI?IOpHM_hIIOPHkH9\$(H-M_PIM_pIH `;!HIWpIIWhIH1;!HcE1 ff.SHG LL_(IHHMH LW Hx{L9}vH_HO(HuH<@HHHyHHHMHqI1MHH:[HHI91ɉ[f.H}Hv1HxH9G~H_ H{HK(HHLkLHIYL@HKILYL[H1H0I9H@1LHõM9LHD$蝢HD$HCI3LMI9~;/vkL[IsHsIKDII9VDLd$0H~eLd$0AMfH?Ht$01HWALC;IKLII9mf.HuHN8H?Ht$01H跴H?Ht$01H螴IMHHL$I}HLQHLT$H9L ALd$0ff.@USHHHLD$@LL$Ht7)D$P)L$`)T$p)$)$)$)$)$HCqHkH$LD$ $ Ht$HD$0LD$tDH~:D$H{A/v=LT$HSMIJHL$IHH[]L\$DHCAR$M IHtʃ/wKI LC Ar4$LHt/LT$HS(MIJHL$IHu.|fLL$Hs IMYL\$H0HSLL$HLRHtMI3L9)I3LK(AD$L HHD$1ɺA/v.HtLXHHH0H9tD$L\$rDLLHAM3MH9@HH9|H9~Hu`HH!HHL ǾAPILDH9H VVHDHHH5_ H81ծAYAZ1HzL„HL qPMDLVH9VHH=8MD1IH5 H?L}Z1YL@AWHIH?AVAUATUSHLWLgH ArHAZ$CHu.IcJH9LLLHL[]A\A]A^A_uDHLp(Lh0LI4Hh@HXhE1E1HcGHLLSUAUAVPAWjAPI1VL@HX[]A\A]A^A_ÐLp(Lh0Hh@HXhHI4E1E11E1fDLAu)MLp(Lh0Hh@HXhHu I4E110Lp(Lh0Hh@HXhHt2LOLIcI4E1M:LI1fDE1E11LOIcjL9u$HwLHLp(Lh0Hh@HXh9Lp(Lh0E1Hh@HXhff.SHH= HtEHXHtHHHpHHyfHnH7L@AI fI:"@Hq[@AWAVAUIATIUHHH+H9B%LrIHG L|$LHLPHtPHu2Me LLHLAT$Hx0HD$H]A\A]A^A_DHD$HtH]A\A]A^A_1ff.AVL5'AUIHATIH1USIXH脣HHM~cIEHHhItNIUHHpIt9IMHHxIt$I|HHhHI9uD1HLEII2DK IEQDS LEH'k [L]A\A]A^MH]LuILEMkfInL MufH:"EMsff.ATHLgI$Ht1IHHPHH; ytOHtJHLA\H|$u"LIT$H5 1E1I8کH|$HA\HH=aHR1H5 H?謩I,$ E1ff.SHGHH=HHL@HpH@HHAHXHyfHnI H7fI:"@Hq[ff.LGMt5HGI;@}ITHHGHHHGI(t1HPLC1Zff.@AUATIUHSHHH@H?HXL- A A A9ELEI@HA@ H}LHXDJ EQDR E]AA2E9~ HXE$H[]A\A]HHT$5HT$uKHH?HXL-b~ ~ A;}UH= HT$HT$71L1LSHHH&H>HvHFtEHT$px3H|$HuH+HH[H/uHH1UHBHSHHHH>HvHVt>H H[]鱩HT$uHCHH[]HD$H[]H=MH5 H?>1f.AUATIUHSHHLnHwI9uHw(HH[]A\A]骵LHs(LH苵H[]A\A]AUATUSH(H^DfHADnHHAcHDHc H@H;HEH+HtH/tH(D[]A\A]@3H(D[]A\A]H=H9}H;-HpHHHH9vAAH;HHdeLH5!MAI;FAUATUSHHHtrLfLoHM9uNHS(HBHLeHr L9uI$HL[]A\A]f.HH[]A\A]LL%uHIUHOHHWHAHH H HAHGHgHHtH/tH]Jf.H]2fAWAVAUIATIUSHHLwHI9HVILHHHuHEIT$H HtwHD$AHI<t(H|$LHl$HD$H []A\A]A^@Af<}t5ffZt_H|$LHl$\HD$H []A\A]A^HhH9)uHH[LH|$LHl$HD$nLY DMk@OtLi8M9HI9E(HLL肘H9uLL¹HHH{XAWAVAUATUSHHH/HIHhH_HENHV=} ~ H H9WL9?Mt$LmHL)L9E K|5AA@H}H}L L9M8M9L$AT$ փ@@8wPEt @6HH H;HML[L]E1A\1A]A^A_%DAT$ E@AD9ABAIHE111MHHE11MLLLHmtnL;H[]A\A]A^A_Hm0I$L#܃<tM<AAEA@ht,AAEEHHL;눾A)AT$ ff.@M_AWIAVAUATUHSH(Db DE@A \Lr0A@G AAʃAA Dl$ @Lo09EEDMLMMMIs:AMtA $A A1H([]A\A]A^A_M$MkIMOt'Ot;M)MM)MIIrM$IRLHM]L9sHHtmHtZHtGHt4Ht!HtI\$I]M<,M|-HM ,ML-HI,ID-HI ,IL-HI<,I|-HM,MD-HH9M4,Mt-MT,MT-IT,IT-M\,M\-I\, I\- M|,(M|-(ML,0ML-0ID,8ID-8H@H9fLoH9ID$\$D$|$\$\$\$ H_H@ K HEIA@Hr0HD*0ILHH)HLI9dHjHHHL$N< MMIL9AL9AEjH `oIIf80fsf80 QItYoXf80fsf80a i0It7IE1I Bot f80fsfD80B|Q@FDQPIM9uIIJJL9LXfhfkD`fDcDpfDsM9vUDhHhfDkDPfDS DHfDK PfSI9v&D@fDCD` fDcDp fDs@ fCH LE1J<8H9B8fByILrHC|LPE1LM9MBLM9IBE1HN8L9B<8B<~ID~MIHfE83EVHDHHfD[DhfDkDPfDSDHfDKI9w|HrHHD*HA@ALHHILLLOH@"KEA@Lb0Ll*0IMHOLL)HILI9rEImE1L4H9MBIBE1N 3IK\I9xC|CrH\$LD$HHHh#HHHT$H^ID$ILH8O, M1LLHA1LHNjH|$IH}H/.H|$H}H/H|$~xH}H/H|$~bH}H/H|$~LH} H/H|$~6H}(H/H|$~ AJ|H/IL9l$H9HHL[]A\A]LH?1H׎IH|$ HHL11[]A\A]HHHuHNucI|$LO8tA' HVLHv&I:HLzIff.ME1AWMAVAUI1ATIUDSHHH<$HHL$ÜH-HL$HL9~oLl$ D$ HqLd$Ld$Ht$0LL蕝L4$HIHLLnHIFHLLJHIFHLL&HIFHLLHIF HLLޜHL~MHuAI9t$u^HXA>V JN 29} LXAA$HD[]A\A]A^A_fH[]A\A]A^A_1DL AŅuItpHu AI9t$xLAŅeItBHtI;t$u ACLHD$AŅ+HD$HL9uE1H5HlIHHHXL5{J J A;LL11zwHXEHŋ~ DGDF AgA2E9} LXAB$ImuLHt/HwHmAH=S*5Ap@HGHPhHt HB8HtPM Zff.HATUHSHwHHJuzH{~xHs H.u^H{~\Hs(HuBH{~@Hs0HAu L9c~JtHIгt[]A\11ATUHH9tDoHHtWHXH9EE1H;-AHmt7HD]A\fDuAHD]A\ÃuoAUDAWAVAUATUSHHHHL%fLcHI$XL-1B B A;EHOL~I9-IHtkDHHH;tMI$XEmN N AA2D9}M$XAD$$H[]A\A]A^A_DH(HCLMt.L=IcHAHAH;puH(#AuH9cHHLAt:H|nH[Hm1JL5'H5 HMLCI>p~1 H9HѬHLHL$ДHt$uIMMLIcHAHAL=L9I/HUHH HމL$DHЋt$L9\I/H=&vt1gHGHNUHSH ~ H9SLME1L;Nu]M F ʉ@@8u? @-H}0 -IѨ@H0yE1A1@HD1[]Hc6ofDHx|uyHHH[]x5uHLHH[]Ãu xfDH=q 蛰3HHfbHhHbHH臩E1A fH}H HvHITE1AfDHiHHHHt$i Ht$t'~ H}H d@HcGpfnf:"H4@PHWp7fD7xff.fGpGpHH@HDxAWIAVAUIATUHHT$0HL$8LD$@LL$Ht7)D$P)L$`)T$p)$)$)$)$)$HH$HL$ fHX$D$0H}XLu`HT$LehHL$HEhEXHuFMuyMu\LH衊LHIHMu+H1]A\A]A^A_H/uEI/uL2I,$uL!I.uL tDAWfAVL5AUATUHSHH)D$PLd$PHDŽ$)D$`DŽ$)D$p>Ƅ$o HdL$0HD$xHCHD$@D}EHA%u \f%tKHuHH)uƄ$HL7 D;EHHA%uEH]<0H5DE1BI<.SH{LC0LcHI@Igfffffff0LcM)LI?IHL)I9"{OIH<$zH<$I1LL@ HHvfH<%JDD$0A/wDEALT$@DD$0I2LLL `Hr<%LPLT$8IrHt$81DT$0A/DAHt$@DT$06 Ld`D\$0A/DAH|$@D\$0H?MHHLLHL HmH褡T$0/H|$@JՉL$0H4//HωT$0H/HLLLc T$0/ЃHD$@T$0H8nHHLLHL E0l$0/ALD$@l$0I8HH}LLHL DD$0E%L^qE1D|$0A/DAHL$@D|$0HHl$H5I1HxD\$LcAXfAx3LHLSJHHHu9HE11AHL$8HQHT$8iHqHlCHv 4H@{HE1ۿE1ofATIUSHHH?H{~vYHCH+C H9|LSunHK HKH@HtE$D@Hk 1[]A\fDHHHG StHS II<,MIHHSMIM9LML$E1L)HHM9H IGHHM9IGE1LN$L9lB4fB4RIWHS H{HMHH4LI<,HI9gIM\$E1M)IILHI9IGIHI9MGE1MK H9C4B4If.M$HQHLM\,L\)H)I)HHHHlI4$HHAHHH2I9HHHtiHtWHtEHt3Ht!HtMD$ALBO N IO N IK J IK J IK4 J4 IO N II9O N O\ N\ KD JD KL JL Kt Jt OD (ND (OT 0NT 0O\ 8N\ 8I@I9`HwnH;Hf.{4HLHDHHC53Hk 1 A4$1A|,|)EL,fDL)Hk 1A IIfAIECfEAACfAAAsfAqE HIDJESDRECDBACBaAWAVAUATIUHSHH~ LnL9HtL9HHL[]A\A]A^A_ HtI9LOM I9IAMM@AT$AD9r`MT$M+T$ M9}MtLL& It$ I<$I9|fI<$E1M1HMl$ 1H[]A\A]A^A_L1HA9r늉ʃAAEEWL) Hy_ HwI\$ It$ qcff.ATIUS~ HvHnHAD$ @t9{~vRHs H{H)H9|BH;E1I1LHk 1[]A\Ã<~<E9SsDH;u"{4uC5HI$L#xHk 1HHӸHs H;E1I1L%Hk 1y1rff.AVAUATUHSHHO Lu(ω@ @){Lm0A0HH)HH9Hs`HLƀ`HmIHH5"DNEpI$AT$ I\$M9I|$(H<Љ <u*@AD0HL[]A\A]A^<@Mt$H!fA^H}8L9t HH觚IH:ڷLmHAHHHHHI|$H]Ѓ@ ̷Il$HIl$(I\$@ @MD$HAHt$ёHE8Ht$HE08y Ҷ@MT$0L9莑AT$ ID$(@遶ff.ATH5H8H׀L8IH9urHuHHt&H A\HA\HL騀H9H H=9H9u-MIEXHtHh HA\HLLfAVAUIATIUHSHHyHF@HtMH)I$IH9tHu IpH~MpI9t MMt[ID$@u{H 1HEHLH[L]A\A]A^CMHIHtH9t1Hu黵H>HtH9u LFMI`LʤHIMM\$A@111LBI9I\$1LH1=VHL HcLL9HIbtHu_LHI/eMI9t MMPMM111LYB111H[HyLH(.H9uՈHSմHyHHXHHzXHAUATIUSHHtrHFHHufHOH@Ѵ@ĴtaA$@HLH[]A\A]u1Z[]A\A]H1ߍIL9}ItHJtH1VUHHt1H59dHHtH*UHm1xH]谎1ff.AUATSHH0HT$Ht$ H|$({HLd$IfnChf:"MHH9CH=fD$l~L$HIIELHI]fAM 謝LH|$(Ht$ JqH|$Hu1H0[A\A]@H/uE1H=I9|$NHH9S=fD$3l~T$HIt1I$LMeHI]fAU Le ff.@HfLXIHXHIx`H>IphH2I@hA@Xff.ATIHUHPHUhHAXL]A\)fHPwhH ɏfATIUSHxNI|$xHH?HgHED$(HHc9XxAHGDHAD96DPEH$DXED9D`EHPAD9pAHHAD9x AHDP ED9DX EHD` ED9P AHt~pAD9|rHAHtexAD9|YDPEH tKDXED9|>DHHPEH t,D`ED9|HXZHAH9t 2AA9~[D]A\fHGHGf.HG°HG f.HiIHHLHXH}HtH/uI蒅HKMu~HIKL|Lc[H]A\5o[]A\ hff.AVAUIATUSHnHH֎HSIHHsIUH1(HteIUHs L HtGIUHs(LHt)AKTJtLϖƯIL9u[L]A\A]A^fAWL=AVIAUIATIUHoLSHHH]HHH@tNHELLLHyHmIt`Mt$L;%sI,$1]A\A]A^A_ÃHHHELLH-~HmIupkfATUHHSLeH*SHtHHL\Ht8HPtH[]A\HHH1fAVAUATIUHSHH@HBHPHgHHt$LL$LSHr1M\L\HHs5Ht$LH]QH@[]A\A]A^HtDCDD$HM2HXHM1H9sHHtgHtUHtCHt1HtHt MjMiI4 I4 HI< I< HM M HM M HI I HM4 M4 HH9!M, M, It It I| I| MD MD M\ M\ I\ (I\ (Mt 0Mt 0Ml 8Ml 8H@H9rL4Ht$LH$9IHHt$HxINH$H0HsLHHOHT$I9zLH$kBH$efAWIAVAUATUSHHH $LD$HLrHM HHL)H9I<6H臐IHڬLHD$HѬH|IHI$HtkIOHIL$HtXIwHIt$HtEIHI|$Ht2MG IMD$ HtAOIOIL9u@L|$(Ll$0HHD$8Lt$8LLLwNL\$0HD$(LHHT$HII HLZLHHL$L3NH|$0LD$(LLHt$HIH~ LHMDMtfLL$0LT$(L\$IIMK(MTLLLHMt,HT$0HD$(HL$H|$HHHTHHH,$Ll$1LeLd$M,$HH[]A\A]A^A_fL$Ht$1M8HHH[]A\A]A^A_ff.HVUUUUUUUAUATUHSHHGHHHHH?H)HH<ϪL$L$fHnfH:"I)$HH~ L1H8 tfL \zLj  HEQIEsHLk fo $HCIK LO L[HH[]A\A]H=6{]HHff.H;=}tH;=t H;=|u1fHHWHB`Ht/H@HHt&L L9uj1HH~HÐHJpHt'HHtLhL9u+HGDfHrhHtHHt@Hf.H(HGHHu^HHtH5DH9uHW@u1H(HH(HHHuEHGtHHGH@PHtHT$H|$Ht$H|$HL$HT$qL8EL9u%uqH|$H|$AVAUIATIUSHHHHH-CH9HG@-LsMmIN@LsXMJI~@H{ HH{(HH{8H)H-cCI9L_A@0Ls@MIN@H{HHH{0H-CHH{`H-BHH{hHtLBM9u~LOA@1H[]A\A]A^LAԅuH{@HLAԅuH{HHH{0H5H{`HhH{hHtI9tHLL[]A\A]A^fDHAԅnH{HLAԅSH{XH8LAԅ8H{ HH{(HH{8Hz闦MHM`HGHHGHHHHGLsHHGM鲦f.HHH`IFH{HHIFHAQDMHMHGLs@HHGMIfHHHIF3H{ HIFH+*ADHHHIFHIFLsXM鈥fLAԅDI9u@eLAHAI9o%H5@H9tA%|H@H9!% H5@H9A%LY@M9%}jL )@L9u|A%@zI9uC~?%H->I9u4_?fLADLALALH|$AH|$H|$H|$H|$AH|$'LLy閣鰣fAUATUSHH~HHIHt!H >H9HW@ H`H]HXH6L=L9udLOA@LPMM]A@0HHt HK@uw1H[]A\A]LՅuHPHLՅuHHtHLH[]A\A]DHՅfLHMHCmHHC`LHMHGHHGMHMHGLPHHGM魢IHHuTIEHHIEHH5!=I9fDH1H[]A\A]A^A_LAԅuAtLLAԅuMtHLLH[L]A\A]A^A_fDItH=7I9uIw@rLHMIGVHIGIfDHCL@ IMI9Axu1IpH|5Ht#L$7L$HBH +7InAx0u1Ix8H|=Ht#L${7L$HH 6I,AxXu1MH`J| Ht#L$97L$HH 6qIAu4MJ|Ht#L$6L$HvH _6)IAu4MJ|Ht#L$6L$H.H 6IZAu4IH|Ht#L$a6L$HH 5II Axu;IxH|=Ht-LD$H4$6H4$LD$HH u5AHI(I9uDE1DAxuoMPJ|HtaLD$LL $AԅL $LD$H$H 5II(M9uPH5I9u(%HII(M9yLAff.UHHHtbH;5ntYHoHaHEHt$HP8+HDHHt$H11HHSH]HEHH?AVAUATUHSHHwHL3III~NBMܚIL5mIXL-kB B A;EHM(HiHH;HsIXEUDG EHDO AA2E9} MXAD$$[]A\A]A^HNH-h1Hw(H}HH5'i <1I^HM1H5Mi Lu(L-JhHILCII}<1gHGt  1RH gH5U HP1H9IH/VHtmI~H/HtYI~H/VHtEI~H/8Ht1I~ H/HtAK|.1!ff.HBATIUHSHHHHu~ HU[L]A\1f.ATIUHHuHt;HHL]A\H \HH9Fu&HVHtHLH]A\HKHHt$(MHt$HH@HWHHvIH9tiL_HyI9LHIHMtILJC|FLA9D)HcM3Hy~tAOu2HZHfDJH5ԙLcIAfD+HQ[H@HZHLH)xE1HAÃLIc LDE]HZHAuCDLRHtnHA|DLD9IrvC|FLD9@A.E HBf."H ܘHcHHXWHÃH5ϘLcIAHAVAUATUSLoI9ِHW MeHHI9.HI9|&LgH[HHJ4H[]A\A]A^fMIMIQILHLHT$-HIJLL$XMt I/M9Mt}Lr+1LeM~U1AL.H*HHILImt;I.Lt_HXL[]A\A]A^A_Åt4LetM"E11LHD$UHD$LIHtH/t HuUMu|LLL$ULL$  H1H>5IH3E1111HI/uLHD$^UHD$ImXLIeHT$HH5<LUZH|$HHILMIu H5o>LG IHVI9^M=LH5!>HD$ L\$HHMFIAL9taH5=L\$J+IHHL>YImL\$uLL\$D$ATL\$D$MVMALD91HLL\$3I.IHD$MH}t8HD$H1LH= !ImIHD$œEfMcNDLMt(A8AMcNDLMuf.AcLT$H|$0MRM9%HD$EHD$hDt$D11D$$D$HD$XHl$HLL\$hALcA|$jr@&&H9LT$I|H;HT$hHT$x:(<Ht$xHAL$AWL$PHT$8L$6_AXHLl$x1Ll$hHEnA9;IDt$DHl$HʑHT$hA ;wIIA|H|$$|$ MC|$$LD$hA{@$DDOA@\$@|$$ӐIL\$h9\$DH9E;AOƀrEdDl$$H|$At9\$D~>D9|$H|$$"HĘ[]A\A]A^A_ÐHD$HH|$0H4mVHHHR9\$1ɋT$@Ht$(L$`H|$X`HL$`'fDEkyf.IL\$h9\$D\$@;LC7LMHHHD$PME1E1Hl$RHZWH$H|DŽ$McpH$Ll$0M}O:L|$M9eH AL5(LDL MLEH|$8L=W uH5 IHt$8EL%(DASLAVHT$HH5Q 1I<$jH$G ]A\2H$9\$DHl$HH|$8EMH NDuL5 H  Lt$8LCHT$8H5R 1I:H$jG L$DŽ$Ld$`AuLD$PHL$8HT$`HcHE L'G oL$HHt$xL$HT$xLD$`AWhL$PHT$8L$2 AYAZHuH|$x1HH|$hDMHcL9YMcH\$pHD$pNDHl$xLD$H|$01HHH|$xHwȌL|$EE9I7I-uH|$xALMAMt]A9PHUAHt3:tPIcLLM+EA(McMwAAAAAIcHTHuH|$8HutH= L H|$8LAHL$8H5MQ 1I:H$^E LlH|$0Iu&RHJH*iLDEAH H2%HDL |$L% H MDH|$8uL5* HLt$8L=@UE1SHT$HH5EO I?A[[H$D 骉饉頉'Dt$DIH鉉鄉AUATIUHSHHGHP`HHHu$L-4@1LHL9t%H[]A\A]L-@L9uImu ImHMHYh#HHC@Hu HCHZL[H]A\A]L-?|AVAUATIUHSHwI|$HF`HLcJH9u0HLHL-`?L9[]A\A]A^fDLO`MO4L9HMuML-?LHL9uImMtLHAL9uIm@IEL|)tLHAL->L9Z&@Imu@L->HtGE1bH9uL-v>L-m>gHO`Ht9HcL-U>L4MLcL-<>WHuL-+>FL->:邊ff.fHGHVItHwMHHNHwMMQIwCHtUHt ItMtAxHcfD1IuA+xHc@Hx+LMx3龎fDːHa=H@MxHL`[HL|HtHXHff.ATUHHIHHwHHFpHH@HH1L]A\DAVHBAUATIUHSHHHL.HL5qAHD$H?I9ULG0HHH] HL$LHSHHuIHL[]A\A]A^@HL$HtHIH[L]A\A]A^Mt$efDIUHujHE1H=*h.t@ HGÐHGff.HGff.SHGHH= BoHHo?L@HpH@HHAHXHyfHnI H7fI:"@Hq[ff.LGMt5HGI;@}IPH HHGHHDHGI(t1HPL=1Zff.@AWAVAUATIUSHLoA@ID$L5L9p0H{>LXA1 LAM9u0uIL9s0u HL9s0tI1Ix@IHLL$-MxL$MgM}0LM9uLEM.HL}0M9tI tEH u;LL$.L$HIt#H8HtH/.;EIIImLLH7?UHOHHWHAHH H HAHGHgHHtH/tH]f.6H]rfHGHHff.AUATIULoHL;-5u7H96H9EtH'HHtHHL]A\A]MHUHuH55LruH572I9lI<$tp]A\A]fAWAVIAUIATIUSH8HW Ho(HIM!LHHH;uOAoD$LR1f<AD$fH:L+fI~OTLsM9H8[]A\A]A^A_@LE1HCL9tYHpIw H9HKL|I!LHHH;uI|$M]H1I|$M(MpH;I9uHImH81[]A\A]A^A_@HPHH8L[]A\A]A^A_AH4H9WHLHL$LD$H|$9H|$LD$HL$H/fML$ LI9l$(ɂH9;I H9w0HLKHMu,H;MtiDH9uIl$(fM9tGILDI9U&LHL$LD$H|$P*H|$LD$HL$sH;I9Li3L9WtsM\$(HLHL$ LD$H|$L\$8H|$LD$HL$ H/HugML$ Ht$LI9t$(H9;霁M9UuLHL$LD$H|$)H|$LD$HL$TIMeMt$MuMCsHHLHL$LD$H|$7H|$LD$HL$H/|wB@SHH=5HtTH 3LHHpHSHLAHXHPIxfInH@ HP(I H7fI:"@Ip[DATUHSHHHWHBhHt H8tHHH[]A\HJpHHH5ޝ@HHu|HH111HpHmIuH1ML;%.I|$tfLBI,$tCHd HuLa-H5b? 1I8H9H9@LHD$1HD$L -.HW1H5> I9xI,$uL.I:}td2 I,$ff.@HWHBhHt H8tHJp1Hu1H9ÐHHGHPhHt HHtKff.HGff.ATHGIHt LA\fDHtHw+H:t1ff.SHHHHGH9CHK Hw LG(H9IHQIKHt LL9utH9KDLHQL9tHuQH9|jKD HQL9tHu9H9|RKD0HQL9tHu!H9|:HHHIL9ufDH{(fHnLGfI:"C H[HHHCHK H/t1[.1@UHOHHWHAHH H HAHgHGHiH]0USHO DF D @LO0A ZA@tGHoH^LV0H9ILN<uGLLLY-Ƹ"H[]LVHHoH^H9ILN<t[}<u=ME1K<K4H9CC I9t@<}p|KI9A A9 }Of|u+1I9tbE9A zHA9t1I9t.AHA;TtfDt H[]1H9@DCDtm)|MOM9tAA 92|LOHA +{OM9tA2A91 |L{LOHM1K4ML9[A<HA;|Rt{LLL(ƒ{w{ATUHSH  |HGH9lHDHkH)IHSO  |@DLNd0<EICO HM9A84$pID$L9YA:t$5ID$I9VA:t$ID$I9FA:t$ID$I96A:t$ID$L9A:t$ID$I9 :HI9uHH []A\H_HHL$;<&{<u*g{LLEPB fD<DLL谽HtH H[]A\fDLLHHH\HL)fL)HEH H[]A\H01H#HHHHLL[ QHHHHzHHHHIHHT$0HL$8LD$@LL$Ht7)D$P)L$`)T$p)$)$)$)$)$HT$ H$$HT$HD$0HD$lHff.@MAofH)HfHXH`H9uHOHtHA01QHtH@0Z1Zff.AUATIUHSHHHHzHH9u4HO@uiH[Ht H{@u51H[]A\A]@LՅuH{HtHLH[]A\A]HHHu=HCtHHCLHMu?HGtH[HHGHwLlL9u4%ubH5LI9u%u,HH|$AH|$ff.fAWIAVIAUE1ATL%XUHSHHHW LG(MIML9}I9IuHt L9H9|cIyIuHtL9uiH9|LIy IuHtL9uRH95Iy0IHtL9u>I@L9|I9IL9tHu$IL9}1H[]A\A]A^A_II9u@HG@?HHHu:HGtHHGIW f.HAօuIW MG(H H9u%uH|$MG(H|$f.ATIUHSHGHP`HtFHHu!H"LHH9t'[]A\H{"H9uH+u5xHd"H H]A\d@HGHVt{LGLNIHHwZMQIwPIt Mt;It"Mt +~HcRfIuD~Hc5D1IuMxMx'H!HQMxrHtHXZrfHwUH^wwH]-ff.fHGHtSHwHH HC[ff.HHHH=`ff.ATIUHSHHHyIT$ fL`ID$`HHP @H@(@@@PHyHX0HHtJL$HPHh8HEHhMMcfInL I,$fH:"PIkH[]A\yff.AUHATUSH. HyIH@HHH9t-fDHH+y111LHHuI,$SyHHtH H9$^y$Hh"HH[]A\A]HIImByytLIHuI,$yH!HxfDHH111AUATUSHHH #LXHoLAHH}HH}hHH#HOHMHHHIuHxHHS@HuDCIH{XHI *LCXIMCH}HCXHtHEH/xMH}HtNHL[]A\A]LOHLMHH7W@HJH;5"=xDL;%"#H"H9C(xH=H?[I,$xH{@fLkHLcPC@HCPHuFMuNMu+LCI@`HCHmuH2 E1$I,$uL H/u ImuLL-\I}H 4"H9KRL [I9c;wH[H;u wHeA[*wL LWL;wL;!H5 L=/ IDHZH8b$ HsH;5vH;5}!H/ L0 IDL%H5{ 1I<$:uDHHHx HH#1Zff.@HH1HX(AUATUHOHHWHAHH H HALGHGAH(LG}H5LUHLOfHnM MfI:"ELWHTHuLEH=e HFII0L HFHEHeH9}H}H>vH} G$HE H/H}0HtHE0H/H}8HtHE8H/H}@fLmHLePU@HEPHuMu0MuH]A\A]H/u;I,$uL*ImuLLM`MDuH}`Hu5F L]HMHL%AM$IUfInH L fH:"MIMu]A\A]USHH?FuHoHHHHt:@tGu+H@t&H HKHiH+Hu#1H[]HH1HjH+HtHjH+fUSRHoHHt%H@tGuH@tHKX[]@HGHuHxHtATUHH(HH9Wt`HT$Ht$H|$d HM Ht A$Pt1HHStH(&tHT$Ht$H|$H(]A\Lg`Mt:tf.AUATUHHSH(HVHB`HtsHtiL*I3 Ht4HUHH9HMHHH([]A\A]KHtHUHBH;Ll$Ld$HL$LLysH}HL$LLHH~'H|$u:HT$Ht$HdHG1'PH([]A\A]H5HlsL@Ht$H|$LM1MHIMHH9uHXH HRH5k+ 1H91f.H;ws HGHHAUATUHSHHL%L9u HsHuHrHH}L9uHH[]A\A]cHUIMrImHH01Hu^rILHHLHH9Imt H[]A\A]LHD$HD$L9uH1[]A\A]u1uIyff.ff.ATIHH5؞ UHHtIHH@t3HuHULHmtH]A\HHD$HD$Hu1DHqATSHHGH;t H;uHIHL[A\Ht$>IHt$HHI,$HtILItHH;tHt$H;rAWAVAUATUSH8H|$HHIHH|$(qHD$HP{qH\${ :qHt$F L~@AHl$HEM)L)MpAE1IAIuUAE ImA@Kƒ.AHgH\$Ht 3C E1ɨAAIMMN,IuA} @IE@@]lAMrLLH)H9HMtEtA3~ E1@AIM9DHLD$HL$D $迋IHB $HT$H|$(EU A pA@MM0AAMHH|$͓H8L[]A\A]A^A_ǃ@C@AM LLH)H9HMtEt A2E E1ɨAMt$N,MIuFAE ImA@ƃ@@AMMLI)I9?HHtEt 2B E1ɨAMfM9JHrB nHZA@E9EBMLH)H9)oAE9EBMXLH)H9[nL.LM9UhIEYA9DBMLH)H9nA]AE9EBH\$C m@mH0HEHMMIHrHEDQAt1EDQAt$AtAu1H[]A\A]A^A_DуI9HHHIAIIIܻEHH5J H: 녽1M|$ ADL9H)69JH-H5v H} -IIL ]JtAM;e11Ml$1DDEIL L9I9vHLZLFDyIM9tLAOEISIpHI9LA@AOLISIpHviI9'A@AOLISIpHvDI9A@AOLISIpH vI9HHHwHI9HA?EEA?EAIL L9A?EtA˃AuvI9bAKHHHvIAIIfDAU1ATIUSHHHD$`Hl$PHD$HlcI1HLTcH|$`H2HL$HSHH)H9cHC1Z4IHHL$`Ht$PL@ HDLP!L$DH HD$HI;IL$)HI|$!ItItI)LM)HHr$ILPAIIHAI9H|$`tHUH|$tHEHĨL[]A\A]@uJHtAAtEDfEDLH4$HL$H-H9SbHIAAElElhHI9D$aI$HOaMIthItVItDIt2It ItMkALiKJIK<J<IK4J4IKJIONIKJIM9O,N,KTJTK|J|KtJtKD JD OT(NT(K\0J\0Ol8Nl8I@M9[`fAHWIHHt:HHt2H [HH9uIJIR ALDDLPHRH5$ 1H=H?Zff.IAHAIJIR LqHH`HAu A`HpHHHHHD@ H@A1Hp(@$Au/AH@0H@8At/f@@1HfDHHAH@8HH0AuHpHp8HHHD@ H@AH5c sSHHHHt'HGHHt HJHuHCH/t&H[fH5ɬH9uo0HCH/uH[H|$HH|$AWAVAUIATUHHSH(HH_HHH]L}HC{ _E1H5H~AąusH5Hh'LhIHIwI DDI/HHL;-H(H[]A\A]A^A_L IHtyALaIPHALHT$R1jj#H HHtMtA|H]L9H&MT$11E18 HAHL)H96.HA:OuHAB: AAAHAH%?ADHIHL9YHAIHC|H[AIt.ID;DA@IL AHLD3DEXIL AEHLH92DAHI%?ADHLDQHDEIM ALDASD+IM wcLHL DyEAw-HLH9D;DII APуvdAHA?EDHDADAKI%?ADHEDYIA?EtHGAAHA?EtH11AIAE11AzItdIt)D;AHAEIMAIDqAALDIIIL IHD;QAEMEMIIL ؃:IHI9t ADHHIAÍQHA?E\HHs[ILIDIII ǍBDVYAEMAMHIL A߃FDEwDMAMHIDH AwDIH^I9.3DqDDMEMIIL A/AAOHA?E\HADyHA?EDHQEJIA?ELHALPIL9A1HHAAHA?ElHEAAHA?ETHIEID$AՉAIAE11ANIt`It(DALAEIMAIqDMEMIIL ؃?ILD+DYAALDIIIL ADILI9%LˍVI DMEMIIL LDAALDIIII ōAAÃLESLIDHIDL Aw_ILI9D3DYDAEMAMHIH A-AqHA?ETHAKH?AtHEDYIA?EDH8AÍNHA?E\HAHA?EDHƃH?AtHcAHA?ELH8AՉABHAH)H9M~H5I~eSAƃHA?EtHH@ L%}@ 1S'S,Sff.HOHHHHHH~ |HrtHt|LBtH9tHxHpLMt|M@uH@HSHGHHp(Hp HHH9RHH7HRL@HX [LÐAVAUATIUSHoIT$HH9B0H LXA1uRI$A_I\$(HH~;L-H;HL9HH/HHuI|$(It$@H9t8I|$L L@M9MT$I|$ML%A$~vA$MtAIAu[]A\A]A^DH7}Q[]A\A]A^[1fD{M\$IjIL MIjID$HLA`M$MPLHGAWAVAUATUHSHHNLoLvHAM9MMNMHvHj{IHu H{ @QItdHu(H{(+It>AJtJ|LD$LD$t[IM9uAOH-Jc4HfDM9ucHHH[]A\A]A^A_fE1At7AtIDJtJ|H[]A\A]A^A_AM9uHHH[]A\A]A^A_fDAM9lM9aM9VH(HO1HHH@H?AVAUATIUSHHwHL3IHI~MNHuH{ HHL-IXL5B B A;NIL$(LaMH;HAHmIuH@IXDG EHDO EANA2E9~ IXB$[L]A\A]A^Lw(L%1HNH5 I<$IE1VID$Il$(H5 E1I^L-HHHU1LCI}!NMfHATfHO|OO:UHHSHĀH[fo+HT$@Ht$@HL$0HD$(HT$1LD$8HD$ H\$0H\$8HD$eD$mD$qD$EL$UH|$0H9ucLD$8I9uqLd$HT$ HL$(It$HugALHSMHHc[]A\鞯Ht$ tLD$8I9tHt$(Lɩz1\1I9\$~HItLNALAHHL$H$HLH$HL$uHHeHH[]A\HHH HV1H5 H9O1ff.AWIfHAVI1AUMATIHO|OO:UH1SHxHxHT$8H|$5,L|$0ft$`LHL$0HD$HD$H\$ H\$()D$@)D$PH1HL$ LHT$LD$(LD$atlH|$ H9u9LD$(I9uGH|$LT$L\$I<$MUL]Hx[]A\A]A^A_Ht$&tLD$(I9tHt$L u1HIHT$0HL$8LD$@LL$Ht7)D$P)L$`)T$p)$)$)$)$)$HOH$HT$ $D$0HD$HT$JHWHwILA'Hff.@ATIUHSHH QK~ HEH9bMkLKL)HI9M3E @ J@H0C ׃ J@t5H0E5FT%u&DE91H[]A\HHE~IƃzJ 1D9uIAMFTDE9un9I@LHHIHIAN 1oFTenDE9tY1GHH17-Hx%Mx HHLALIH}HHHIAMHFT]FToHDC IfDUHOHHWHAHH H HAHGHgHHtH/t H]AWAVAUATUHHSHHVH;AH;u H9H5wm IH<HXH2LmHU N4+I9EHI99HxLELuML$HMNO,IMUHMqIOtHIQHKTHMyIO|HIA HKD HtqII(HKL(Ht^Iq0HKt0HtKIi8HEKl8Ht7Iy@HK|@H t$A OIOTIL9uI,$HHHH[]A\A]A^A_MIMIILH<1MLDH}J4YIHHHELuL} Il$wML$Hw\@Ht$^IH?HXH|$LXHGHLeH)L9|J4 HLeIDH]H;] }]LUIHH]LAIHuSHHuH;u }H(I/LnL9FHsHFI<$LEM$I<$HuFHII9FLwI;觷t _I/t1L1qFH=AWAVAUATUHXqIHHH5HIHlGIEH5L ֯IHWGjL qHMjLH5:j L1uIXZMtI,$;GHX"IHI/tImt"Mt7I.t!]LA\A]A^A_LLLMMM IHSFE1111H=VIHFH5H1H=ji IHFH=_i 蒾HcHFH=$i vH?HyF1_H8HY]FH/LH0 HHHH8H]A\A]A^H;Lt$ Ll$(LHL$LL覹DH}HL$LLJHH~VHt$(LT$Hu#Iu|HH9Et1H8]A\A]A^IuYHH_H8]A\A]A^L%%MDI$LHD$蘱Ht$HCHu } AAAA@EAA@ 5CEH0ADHHT$RHCp HT$AAA@ C@@tULP0L\$(E1"B|Au.C< IL\$L9AtABB|]Au fCtLL$HI9tHt$8L#uHĘ1[]LHWH5I 1I:DAWIHAVAUATUSHH8O v A@AAD9LgMkII9HMI)M9 D@II0@ @^M{0IdD9EH<AA @DAC @DMLL)}IsEAMMMeLLd$GD/JDHI$LE1DF:"tzBL"IIAOd%L9}ID98H8L[]A\A]A^A_ÄC.EHBL"IIAMIL9MInM{HIfDHHAA7EINtII9@:uLeM9W@:uLeM9I@:urLeM9I@:u[LeM9;@:uDLeM9-@8u-LeM9A:<$IM9uIuf.Bu#HLE]ID~DLH]IL߈T$/DD$(LL$ HL$LT$L\$IHADD$(L\$LT$HL$ELL$ T$/ dH<AA @kAAC @`AMAILLL9IHgI_IqE_F8\'AI`HD$CB8u IM9HD$4AOIL D8LIAOAIL A8HIHD$MeO/LHALHH A8HL$IDHL$IsHD$ULHIzH|H)III)IdI\IS@@Hf>H<ILLHL< IA>Au>A7<uITIK=A7tՄ=t==>fATLfUHSH=>t#H{@H)>MHHHC@1[]A\HEf.{ff.黢ff.ATIUSH  O>HH9HHN| HHH  >H9yH9pAx H)Ỉ @@"I\00HL;IHR>@ b=@F>IP0HIIMH+IMZH*IAL9M It^ItLIt:It(ItI`H<H<HH4H4HH H HLLHH,H,HL L HL9LH1AuJAu,AuH L[]A\fAH L[]A\@ fA HAtAAtfDHyI9@IH L[]A\H<H<HtHtHLHLL\L\Hl Hl LL(LL(H|0H|0Ht8Ht8H@L9rIXHHH;H []A\ZLKLJ@|;M@HDH LL[]A\K4DL%MU;I$MH L[]A\w} ATSHHHIL8IH@ ;@;IH0HIIr*MLIMQLIAL9rIL 1H1At A At fAHAt4A4HL[A\@MtyIt^ItLIt:It(ItIH3H1HH<3H<1HL3L1HL3L1HH3H1HH3H1HL99H<3H<1LT3LT1L\3L\1HD3HD1HT3 HT1 H|3(H|1(LT30LT10L\38L\18H@L9r?X[A\:HCHA5UHH?w]}H1HuHcGvHtHpH?HNu]HGAUATUSHQH=w H LcILHZ[]A\A]E1HxEH1ÃHuHcHuHtHpEu&HhH?H~tHAAIcf.[ff.AUATIUHSHf}H;t H[]A\A]fH(HUIL$HZhLih9HtH{HtLHH[]A\A]RMtI}HtHLIt$H}H| X[]A\A]HG?HV.AVAUATUSH LgIL$HHnLEIIfMt0LcgHgHjHcFLMT$MIw.AH IcHHHH []A\A]A^M"MIsH_A?H@D`fHt$H<$RH<$Ht$HD$H_H3^yHtH|$HD$Hh7H1H@1MIIDbHcHOsH7A?HXHHDhD?I9DqDOAMcHFHE1IܽMMI_rHt;A?H@DhAA?HHMcDhL@]66ff.AWAVIAUATUHSHhHGHVHD$XHD$PIHHD$HIHD$@LHHHHI9H9jHFpHLeMnHLMHIHIMILl$N,+I96J<IH 7L%LhL`L诪 L GAy JIMWH'HtAI9/HLD$M^H\$HL|$ LMK4Ht$L)HHL$MtLd$E1FlD5MHE1L;|$JMM)IIIA|It\It*AEMWH}IHAHA?D]IA2IHIHLAHA?IDGA DIHILL|A2IHDOIHLމH?OABILDOHwAHA?DGAJIHHH?WEZMMLىH%?IˉGM9jLl$NT-Mt EA?EIHL9d$}L|$ MoMIMHM~GdMAEHhL[]A\A]A^A_IDHHL1HHI9H~MlH\$MW1MfMuL|$ILt$MA\$L33IA~LLLLljH?AvM9vILfDED HHILHH?HljJI9wLT$M)IKDHIIIL9|$XL|$MtGtIQEt;M9LHMIIIWHLIH9tNHILHAtLZtI몋(H?H]hU@IHH<L9 LHL$PHT$XHHHt$ 2I9Ht$HL$@HT$HL΁ p2J<#-mIH[2H\$HL|$XHLIH1LXMJHD$Ml$L\$HJMDHHt EJEMJHkT$HT$(IT$HL)tJM9tH(MFMt$LIvA|$)=wrfDHcHI,$iLL%תII$cf.H踪L4$DL$`IH&DL$ $M3]??pI}?AA?DPID] A?DAA?D` IE$5?É?AP$Iu(??Ax(It}DU,A?DAA?EX,ItXDe0A?ADA%?A@0It4t?ADA?A|HI9uMULLHIHMH߉L$ L$DL$^H $HI<%IuHxHH $=:I9H,$L$ DL$oIM&DL$LD$ HcT$IHHH9%DI߀^|Dd$ E DL$EHIcLH9t$}A }A|$I]D]E ]E\$IFABLC LCLIM9$MM6G|MUEtMDID3L$ IcDL$LL9%$MIwHoeAomMIfAd$Itoou(Ao}(fAt$(ItTDoE8EoM8fEED$8It7AHFoTGo\HfEGII9uLHHI9tJMI)It,HMD~dE~lILfEfE$M9tHDA3DADT$ M9LL)HsHvVNIE1fDo5SJ|IMLIHDo<fEE<M9uIIML9`JIwH\LS?PL97DSMA?DPM9DC A?D@ M $IM $ "@LL)HHuI_DADJ4I<4HLA&E!DD$EIDL$ LLHt$ HT$Hu%Hu VIH8L[]A\A]A^A_fD[IL%HM<I$HH== HHx L1A$0IHE oELuAD$U ID$(ÃID$0@ID$8 ID$@ɀID$H AT$ Dm E1AAAHHIHL9 MNMLL$LnwH EID$HLT$t Mt$0ID$8EuZD] IA  A@t8Hu0HHm E1E1@A@LD?THuHMt$@ID$(뚐AUATISH߀:M ID$H;H@HHXL-q VQ A;U LH=I9H@XHb LL9E111LHt$Ld$LXAUAK qAs  29}wHXC$MtZMl$A! A|$  HL[A\A]A|$ 7 I$LI{LAImE1E1`< ff.ATUHH~SHH^Hu1H2 HtbH71HuHfH[]A\HWLbIPE1LI1HHD$Pjj衅H HHtH L111ff.fAUATUHSHH;=ԇHXHuHH[]A\A]X1H tHH@HH5H$+H}LAtAXH[]A\A]JH53H9mH} AHuY[]A\A]jIH=HHHpLHHHHHA0IH LMLHH~HHuHxsHmtuZL[]A\A]H} H}(dH فH5b H9ʉE1Hu@HxL%q:YHuH=H5 E1H?茉HbLyH5z E1I8gcfHo AUATUHSHXHGHH9tBHP`Ht_HtG貆IHH9XHXL[]A\A]fDHIHX[L]A\A]H H5kH胒IHucFXIH(H}HtHXH []A\A]p3HuH} HX []A\A]X111HI,$HuLHLEII9AMH`Mt[Iu ItGH aHmIuH躂MtSMI9]LImI LIP1H5a I:SHmuHbE1nH蒃HmIXI HwI,$Hf I5H5H9jI1HLuNHt$H<$b{IHHpHx I,$HuL貁LI'HuH=~1HVH?H5 SHuHH}(ATISHHHH9HG`HHHHH9uiH;=ujAD$H|$D$f/qvc of/vUH,'|IMt}IL$H9uCHL[A\f.LIH5huLWIIHQu(L}1H5 I8QI,$E1H=H1H H?=`}HGH|$ D$f/v }f/vH,H1{HHUHlHHH;=~uE]H5~gu H]E]AVAUATIUHHHFHH9m\gAŅu>HT$H5YLLt$MM;t$uI.t=HD]A\A]A^AIVtHLfAI.u @ATUSHHOHQ`HHIHHH9u|S ˆf. $ztEPHHtNH]H;F}HmEuH$G~$H[]A\D$RD$Ht$HHuJ$Hu&L{HQH5 1I:]OnIHpHTI,$mAf.H@ HGHP`Ht)HtHuH1ff.H?mqMUHH0HT$Ht$H|$ lH-~HT$(HH0WH|$(DH|$(H/`tktHT$Ht$H|$ aH0]H|H5ۺHjH \y1H1H1U>HD$(HH(u~DHcH?s@UHHHT$PHL$XLD$`LL$ht=)D$p)$)$)$)$)$)$)$HXHOHT$HHD$HrHt$HtFHT$@H$D$ HT$0HT$ D$$0HD$(t"H֖H|$HH/t&HH]1赖H|$HH/uff.f~HS|HH0O"yfGfAUIATUSHL'ID$HHIT$H9H.I<$HtQHv!LIEHH.H vAHHkD+ HCH[]A\A]11聪IEI,$uL^zI}1̐H跀 H0|HHff.@AUATUHHSH8HVHB`HtSHtIL-:yIuhIH)H*H;E2B|% H8[]A\A]u@H;{#Ll$ Ld$(HL$LLUH}HL$LLMmHH~GH\$(H|$Hu&HuBH9Et}H} aH8[]A\A]fDHuH| @1H= 01H Ht$H_LD$(Ht$E1FTFT ILD$L9uLyL9]uHEHr^MHu"HUIx L9I}H5 }1?H uHRH5 1H9I1ff.fAVAUATIUHSHGHVH9tuKLoLvM9u ~ @8} t61[]@A\A]A^;E1E1҃[]AA\A]E1A^Ic;Hv H} LvAEǃ+]tYD[AHywH[]A\A]A^ÃtHxHXLjALH[tHHvHM9LINH~G v )u2It$ H 7vu tF8uGM9HLvHftYLu3yHvHGuEM9~M9}݃uM9}벃u ~u y뒅AWIEAVAUATIUHSHHx$9MFDL$MtIT$HMX0H MEp ASE9EENDMMMl$H|H|$MuJ+HcH9Hc$H9IcH9HA9AM9~wH$LcD|$J4AE)IMIcItHt$`MIL$H~yI|$H9H|$HIHtbIIA9uMEH$Hx[]A\A]A^A_McI9Lc$I9H;l$}I9l$9$;l$}IPDMH 8 D)HM|L|$`HL5qM11H5 I>EMjHD$M|LLD$@DL$8L\$0T$(LT$ b?LT$ T$(HL\$0DL$8LD$@LT$8DL$0L\$(T$ HT$ L\$(HDL$0LT$8LD$@E11HtH$AH4IcH9HGtQLD$PLT$HDL$@L\$8T$0HL$(Ht$ iHt$ HL$(T$0L\$8DL$@LT$HLD$PsHrHD$ I|$ H9uHD$Ht$ H IHGtQLD$XLT$PDL$HL\$@T$8HL$0Ht$(!iHt$(HL$0T$8L\$@DL$HLT$PLD$XHHD$ L|$(AH\$0HHT$ I|H9@H\$0DL|$(;Llj$LT$LD$貀LD$LT$${MX0E1UE1HcHH9 L= IxL5+S MDL i HMEH56 H#PHnAHAVHH5p| 1H81$C_AXAH= IPH R HDL-6 D9$L% H55 MNHLqnSM1QHH5| 1I:BXZcHGt?LD$XLT$PDL$HL\$@Ht$8TgHt$8L\$@DL$HLT$PLD$XHD$ HT$ H9MH\$0DL|$(LD$1MH\$LE,.McL;D$iLl$ILH\$`HD$hMILM1Ht$hHL>^Ht$`H~Luu2HMHDLN4 L%3mHT$`H5| 1I<$|A1)$IP$L Y L Q MDL D;$H-f H 3 LMHASHl11ASD$H5*{ H;@Y^LlH5& 1I:{tHL$hI9L$IDHHL$hHD$`HcHTHT$`MHt$L }HuUHT$wPH\$0DL|$(ff.HGff.HHH3??9HDFA?DAA?DIHDVA?DAA?DYH~ ?AA?DA HDNA?DAA?DQHttD^A?Dډ?AЉyHtOV?DAA?DIHt,AFA?Dډ?B!|$,UH|$@襪IxLT$ LAuHuvH^L4YHhL[]A\A]A^A_Ë]<IH|$8HtD$AbQHHjAD$UaIHH,:HxCQIEHHHG]H#HDžMu MAEE^E1L$$ILASHcHk0I~ H9l$P6LL$$A<$L]A< k< cD@AU/H|$@"MxH\$ LDsMt1Du(AE4$ H|$@IxHt$ L_s}( uA$ DLMEt$MtGAtQAL}A|$M)IOID$HHtMt HuL/cMd$C<HE1[}D)H%aEt$ UAUAATUHSQ$opIHtrHhDHǀx^I$pHHI$hDHI$FI$PADŽ$PfHnI$fH:"A$XZL[]A\A]lgUSQHHGH H]HDoIHtrH;]rHM AHqHQ(HiIHm(HHuRHjH~/H1H}t&H2IxHHHH4HH9ZL[]HHH9|AH~ f.H)SHHWHZhHtNHCHtEH LEL9uH;ws HHHH[H[H[HBpH [HRH9Ht HxH5 1701HGHcHHf.S03MHt,H_fH@@HP(@H@ [SH|e[AWAVIAUATUHSHHHHEIF ExMVEMV EL`t"M^ISIVI;AK9 AIF LAǃ n eA tIFHIF A#AEAAAAJA_@A6A D8A.HMcBDZA'A"LA\ eDABAŃ6n At"INHyI~I;>qA9 A[~xA{D߃]wM^ DLIVHUH[]A\A]A^A_p tL AǃuA$A(^A)Kf.EAABwAUV AR{AFuA L> AEAAAAvAWЃ vA_tA At#INHAIFI;LDIE9 E Mf L#I^H]In H)HAHD[]A\A]A^A_@L Aǃ t L Aǃ t i@AdžEEEIF HI^HH]AAdžAS@AdžE1E1L AD$LE}$ AT$LE}$ AL$LE} $ uuAt$LE}4$ u\A|$E}<$Lf uCED$LE}D$L u)E}E)G c D$E9i AFHADG*LH $L$_AEEAHLL$L$DPAAv_tXIHcDzLH $TH $LcL MCDy#LH4$*H4$ALL$L$A`AWAVAUATUSHHHkH;kt%HEHCEH[]A\A]A^A_f.{( uZH{0H| Hp=HtBHH{ uH+HUfLnHfL:"DSE@HQ%HH9uC( aH{ tHHH{ LMtsHLD) 2HL;C( L$LHCI9x 1D҃EtRMt%HKLHkHqHI9w y <{( HLCLCLk MM)LcHfHnM)L)M$ fH:"LL) $_fHnf$HJ< L (fHnIfHnfI:"fI:"cMXLHC Hھ 0HL{L#E1IL{A AL;L)ŃxKuC( L;E1DtHGHPHWH; H9u@pAWIEAVAAUIATUSH8HhDD$(DPHPE^DfHC;*uHzuA)E,IUIhl$,DH|$ LbLcfDML$OKH99hHp)LcJcÀAL\$AHT$AAXfIht$0Ht$H1DL$xDIH~AQt$EDD$8H|$;ZYLT$L\$ABIMfInI}HH@HIZ fH:"H9HQE1IUAA@D` EHzI}H;|$ Lb LcBHt$,HHzDDL$xLAQDD$8E:AZA[)IEMT$H MEs EA;LxIhM}L9 Hh HcxLEL$Kr tq:ulLH0MMI9HX8LcP0HHLsOO$E|$ Et9A<$u2IEH9HhHc8HLk(LeA|$ uf. H8[]A\A]A^A_EEHHA,;uH{HtA 8uLHT$DT$L\$m?L\$DT$HT$uE) Ay0DH|$xtDXAD9Ll$xAE;fDHX HGH|$0LD$(H|$0HD$(HD$8HD$@HXfAWAVAUATUSHHt$HT$XL$dLD$PHfHDŽ$H$)$oOH$H$Ƅ$H|$|LT$x)$pL$L$)$HBH$pL$PDŽ$HdH$H$H $H\$0Ht$H|$(LD$LL$8LT$ $Ht$(LL$@LD$HL$(HT$8Ht$ H|$H AZA[H$H$D\$|H9EH$H^Dt$|EH$H9$XL$xD$MH$L$0HI؉L$TLt$XH$H$H$dA^Z`L$I H|$RH|$L)IHL$L$Dd$`MHl$@MHLHHLL[Aƃ1Hl$@D\$`MED$LIH;=DL$H$E1H;=FoHJLBLLHE1^$AI/Mt I,$EH1ftHTHĸ[]A\A]A^A_fLLHE1L$H$4AI/uL+DEVt$(LL$@LD$HL$(HT$8Ht$ H|$HX_AXlH$H$D|$|H9t!E9H$H|$|H$Ld$(Lt$0L|$8PLMIt$(HL$(LHt$ ZYH$H$t$|H9t &H$Hg|$| L$L9$Ƅ$Aru2LaUIM?A|$ hI/MAs6AauJLEIƄ$LBH$H9$Ƅ$>H;=AA:Hl=HJLBLLHE1ЅAI/L&BsH$H9$Ƅ$$L$IOHHHLHD$h-HT$hIH*uHAMI/M@LĵIHt3H|$XH|$XHI.IuLRAME1LLB=H5m I8CFH;=>M11RHHoHLHL$@61LT$@HHtjHH>L\$@~LxHpL-?MH5m 1LI} ALo IM)LE1$1LBHrLLzH>H.At$dLD$PHT$XH<$NHt$IHtdx !MD$IL$PH;=?HDŽ$XL$`MLL;H5 I8D12I/L?Lg0LL#IH褳HtOHLHD$hHt$hIH.1LLH/E1AI/gHl$@Mbff.AWfAnfnAVfA:"AUfI~ATIUHSHDof:"D$@fI~EAH HH4@HFHIc|$ID$ H WHAT$HfHhLxLp(@H@ 1H[]A\A]A^A_DAEHH<@HI|$ DAYAUAt{AADWDЃE *I|$ D9(Mc\$ACAD$O$[1IIfA$Il$M|$Mt$(AD$ID$ 7~aA9~RɃu~F~[~Z~.A9}AutAAE G۸ڹ:INAWfAVAUATUSH(FHHD$`AHA@LgLWIAM9HHIHDq HqHLY0Ht$DEL\$A@A T$E7EID$fHPI9HHGD\/HDڃ{uI9HL)A}~A{uSI9v|$cEMEMDt10E9HMIDfInfH:"]AEfE1AIL'A`HoL#HkHoHWH9DH7N AAAA AEj@HBHGD|0A:t:v.A}LGILCH([]A\A]A^A_@A!HWA!@HJHKL_@HIIPHWLbL9}[H7F AAAA AiEW@eLgDT0A{A}*HIL9|L5H5 I8>1.wA[A{HWH([]A\A]A^A_L9HLbX A߉A A6@ @Lg\0HH0AM9HHWF !A}A:HWfInHMfH:"MHL)A}tC1I9ZLfInHMfH:"U)HqIM`I9~M1Ҁ|$EL\$ELE\$E3A}uI9HMLHWH\4H5e H:]=1L|$`HAI9~ɺtH=4H5 H?=1b@LnHLf0HWH9}0ApE^LIDŀ<]HHWHJA!HKÉA:4,A}L 3H5e I9<1LfInHfH:"HwHMmH=G3H5d H?H<1GAWAVHAUATUHSH@HH(H_ CHL$@ILc AD$rHL,@IMl$ AE,HL4@IMu AFOHL<@IM~ AGJHH@HIW B>HH4@HHr F:HL@ILF A@-HT$HHt$H@LD$HIP HH$H $LL$L\$HT$y(DQ,Ay(EQ,A{(ES,z(DR,A(EW,A~(EV,A}(EU,A|$(ET$,{(DS,}(DU,H([]A\A]A^A_ÐA}(EU,fD{(DS,A|$(ET$,{(DS,DA~(EV,A}(EU,A(EW,cz(DR,A(EW,L@~(DV,-@Ax(EP,~(DV,ff.![wHUu HcH6Ã=6Ã=u=>u޾3܃=uҾ$Ѓ*=u&뻃=u(믍Nľ6wH534떃=u2늃=>s"n=[/R=D'?=1),=*= +#%5f.%YEH38AWHAVAUATMUSHHHHl$PH9fHnH;fHnfH:"fH:"CI9HIIAII$HudHH{HSH9yHt#Mt0tcH9Hc]suI$H[]A\A]A^A_EH{HSH9}HtDMEtAuEH9|Ha.H5` H8b71D_ EDA A@ Lw0A@+E<HHA.A[H9A4@Lw0A@E<HA.trA[tlELoHL_0IA@LI9iA@4EMMDIJGHL$A.tA[tLT$I<$H1H-<-H5_ H}<61v=ff.AWIAVAUATUSH(LoLgM9|H(L[]A\A]A^A_H/E1] HUHHM0HT$HL$Aރ@A D$|$ELD$LDD$C<(:LcMx4HA L)HIL9| Mk IO< M9ZIOL=6,H5_ 1I?I.ff.UHHp2H]AUHATUSHHHWHH9|H[]A\A]LEH EEAA A#EA@|Mh0HjHhElA.thA[HHPA@Ip0LDMHHHQH9<ABE0@IMDLjLhA]twHPHPA@IhHLIp0HQ@AE EILDLjLhA.[HPH9HQH;H@HHL$HHAvHL$HHuHL$HL$Hu`HYH9YH J*H5] H9K31fHhHPzH=*H5(] H? 31;:ff.@HtUHcH]-UHHHuIHdHXHLH}0HHtH]AWAVAUATIUHSHXL9u$H,H9^HX[]A\A]A^A_&HHLA<HL$ AstZ|$Hs.|$,H]|$(T$$=Ht$0HD$@H9H HxH9HOHL$LL$HLD$ Ll$E|$LH T$Dt$ E9ECM @A9s1HHA9DBHt$E9?HtDLt`Lt$D|$ MMtIt$ I<$DLLHIt$ LIt$ HtI<$I1HN 3ML$ 1HX[]A\A]A^A_E;Ht H9HL%͉ʃEIt$ I<$DLDL%P'H5Z I<$P0rL1'H5[ I:20TL'H5Z I;06MD$M+D$ I9@AVAUIATIUHSH~ WH"MtcAD$ @twDuHL)A~Hu HMH)H9H}E1ILL_H] 1H[]A\A]A^fI9L$uHLH[]A\A]A^钕<DuHL)A9zHLL芗D9vUHYHH话Hu H}ILLE1_H] H1[]A\A]A^DHuA AWfHnAVfH:"AUATUHSHHHHD$0)D$ H2\Ff;UD$8Tfu?Hs H|$ SHHH?2H|$0HHH[]A\A]A^A_ffHHHc3HD$H9DCLK E1E1L|$ [IcLk0MfA<$LAÃLL+HHT$DCEeLK JDAMcA@D9HHLk0KHc{IIHE1HT$ E9H|$HL=H[ EL{ fA?LHHcH$IHt0H|$ LVHtID$HLqm1fIL$ 1EdD9}I4LD\$LcƉD$Ik0Hq HL$HtLT$McD\$HL$KDD$DCLK H/f.ATH /i H5i USHH=\j HĀf='Gf=f'LcIA[AAAAHD[]A\@f=0uZDCLc A3fA|$0:AE1l6D9}HcHk0H{ HSAă9ff=XtEDH[ f='cf=)DfA'ENcIAH[ f='Ef=DfA'ENcIAff=0f=Xf=0f=XAE11HcHk0H{ f? uUAă9kL]ff.fH ATSHHH9HHtUL$InIL=IHVIuI@IHL[A\1LLIIHuff.@HG!HGf.UHHSHHH_HCHH;wHSHCt\LCMuMH[]ÿ Ht$H9HCYHHHCHt$H@HHqHAH]LEHGH;wHWHff.HHtHNtHu3YHu-H11AXH=u H5 H?f(1Z=eAWIAVAUATUSHHHF f . f8HD@ Lh AUfuqfLg IcLA]Im LHHHoAM(AUAuMEE,HH[]A\A]A^A_f--fff(H5f HcIM<1f|$:EM(EEHAMA6Au,VLU]A\HH[]A\A]A^A_McMk0Lf>V|LVIHHK HLL#vDAHL|!Me A,$fHH=e DNc IAA|$ It$ LH0HHCAM(AUAuMEE,HH[]A\A]A^A_311LHHL[]A\A]A^A_֎AEIu H0LHHIU LH:HHLAM1J[LFAxsLI7D$IHEMAyHcLHk0Iu HHAMLDqMcIk0Iu PHHE]LECIcHk0Iu )HHLA}HJ ȍGHHLk0Mu DI@EVEFA7DYDDAST$ID$T$Y^D$E1HcD@IcHk0HLk0Hk0LLL$HL$D9t$uMe LIt$0IHI} HLgHHHLNEELHAMEK@A7EkDAU A^A_I7UHHHt$LIu XHHD$ tHt$LIu HHWHLT$ hL J DI@yDM] HAHMIECAKA7WLeHl$(Hl$ HEXZI{H5/ 8 HD${mLHcHk0L)IHl$DL$1EvI>Is@SDmAM(AU1AuMEE,6IcLDD$0Hk0I^PDL$fA4fAD$H0^EM,EE(11AMAUARA7A[[ff+"f-HmPLfH&HHEMEEPDA7E},HLAWEm(AUDH iLzHHaHDC11KLEJ@A7EZDAS3AZA[It$ LHƐHH1AM(AUHAuMEE,HH[]A\A]A^A_ 6Mu LIv0HHIU LHHHEM,EE(HAMAUASA7[]pE1LL:]H[HCH|$EHLk0fC<&pDELIcHk0LyHD$Hl$Mu >CHHk0L,AEAM(AUHAuMEE,HH[]A\A]A^A_ DE$M 1HEA7AV1HXZH1LO 1fA9Im LHu07IHUMU LIxIH6M] LI xHHLAMLLJEEDH@A7DhDAUf[]fAHT$Hu0HI\:ff.f~uHv THHt$H<$jHt,Ht$NVWH|$7DN,HDF(EAXAYHff.AWIAVL5R AUIATUSHhDAf%Ic4LAIw ^ I@AGu?I_ IfDAFI_ 3f4f AG^tŃAIuAHc'HHE1AM_ E9g IcLk0LK4IHDAAHLL뿐AMg  MfMG MH AXL$fA97Mq A6f4LXQ DOc$MAfDAMg tIt$0LpHHEO,EG(AOAWASAu[]If.AGM :AIW JHyHcLHk0HrPwHHAO(AWAwMMEG,Hh[]A\A]A^A_Mg LIt$0HHPEG(EO,AOAWVAuZ_AXIHhL[]A\A]A^A_HD$LD$fA~0f MFPAFHE1EfA#Aà MN0~E`0fA  fAS_ D)9~HcHk0fA<S IuLL$LcL蠽H IuLHD$0膽H\$ 1H\$E1Hl$(LD$XHl$0L|$0MIIHL$PHT$HHLLD$RlHt$PMc̋T$HALD$JtHL$XKLT$HA9VHHMIcM\$ Hl$(HL|$0EFXIEN\ANDAV@VLAu_AXIMoEoM AD$ HD$LD$fA~0 Iv0A~HtMvPfA~0  L+fHH&UDM,DE(MPAuIXZDMOEOAAIHcHk0Iw f>BLHHEO(EGLAOAuA_,S(IXZZHD$LD$AN0Iv0ffV A~HL)I9HD$LD$DM,DE(1MUATAuH=A^IXHD$LD$Mf_LA}@H L菍IMcI}LG4UDM,L1DE(MPAu"IXZpHD$LD$MvLHHLL.HHt.HMDM,DE(UAuY^IH E1HD$LD$HL"NIHL=I? LhI:tu |$t$F9H)Hk0HTHk0HL$L$Mp I.f;GuzLC Lt$EfAfAIx8L-HHEFANLDK(AuS,R`A^IXMH0H9l$s|$L$MMLAJ(ARArEB,IHH5F LWH5q L@H5q L)DM,DE(1MUWAuH=EAXAYI,{9LIp0MH`LL4jIIuHc8HHAGIuHcIHH,$Io A9_HLHL$$HHEO(EGLLAOAuE,AWAYAZI>LcMk0IASIK 1fwLJ McMAHQL=4H5- 1E1I?8LKHHM_ LIs`/HHIG LHp0ƅIW EGAODAuHWH0IXZMAGAA$9,$7Iw LH蜆D$GIw LL-Lk0LvHH!Mw EGLH`EN(AOAuAv,Vt$葻A^IXMuDK(EF11ANAu{,WL!IXZMFP1fAx0SLIH DM,DE(1MUATAuH=A^IXfA@HIpPLuHH@DK(EFANAuC,PLY^I$It$0LQHHMw EfAu+EO,EG(AOAWWAuAXAYIfAfAEO,EG(AOAWARAuEA[[IVLaH5 L7H5m L fA{LcLIk0H}HH(AH $AHDdIlII{8H5W EO,EG(AOAWAWHAuIXZDM,DE(1MUARAuH=CFA[]IDE(DM,1MUVAu_AXIiA jI{ f?Lg8H|$H5| LhLT$H5l MJLLL$HT$ AATHAuA]A^IA~AsAhLMIH DM,DE(11MUASAu_ ]A^IlADM,DE(1MUARAuA[]I6A{L{ LIw0mHHLC IL:HHDK,DC(KSWHAuAXAYIA jLHx HIHuA_tEIIE$EuAH|$BH|$I5LLIIuHcQIHE1LID:HcH|$Hk0IvP@IHؾH|$HMLA;^H|LANXLAVDAv@ILEF\I fA#HL$PHT$HLLLD$XD$H=FLcD$HLIk0IvPHH}ENXEFDAN@AuEV\ARHt$hH|$`迿AYAZIH HT$XHt$PH|$HH|$PIHfIH1HH( L(ZI.uLjH|$HH/|H|$PH|$XnA}MqPIi0A6Ff3H B Hc BF89M9H1IE1LLLH HAAMT$t11L$ 111111IM9]gHH ߳1L HRH5jU 1I9b\Au6A6et H= u-pA6ttـI1LT$L $?IHT$L $MtLL)I~ H{1AVIAUIH5XATIUHHHLLLHHmH]A\A]A^ff.fAnfnfHnH(fA:"f:"fH:"flHH|$00)D$)$ծHfo$fod$X` H(ff.AUATUSHHHwHGfHNH^IHVHNLfIt$+I$XHteLMM~.H;]tsIt"H;] tgItAJ;\tTIM9uHSH11IL$H5 H;IIML9tMMuH;uM$8H5!I9u.I$HL8I9uHHu銱LL98DHHt3LHL8Hmt H[]A\A]HHD$Hl$HLHN11HSH5 I8SfnfnHfA:"f:"flHH)LϾH)$赬Htfo$HXP8H[UHSHH(蟭1HHHD$HO@ @t+H|$Ht$H;׋HD$H([]H{uAH=i HH\H5i HHCHm1H{H=HH{fHn1Ht$fH:"D$)D$fH|$HH/H~HEtH|$Hl$Ht$H;4霰*ff.@AUIATIUHSAPuH5C L|u1Z[]A\A]{۰@UfAnfnSfA:"f:"flHH HH|$00)$跪Hfo$HhXP H[]ÐSfAnfnfHnfA:"fH:"H f:"L$0flHH|$8HH)$)D$?Htfo$fod$HXX`8H [AVAUATUHHGGHIIHLt$HLT$E1L `M?M9t EM9LQHI{A0At:E1IAu.tQHL߄tALt$LfD|$uuh|$tua|$fuZt$@_t$ HT$ @8zu^HLH]A\A]A^QM9tBI{A_L9t5I5H5< LwHLH]A\A]A^yHLLHHVLpIAHL]A\A]A^HT$@8O@1u$z6uzuHLH1]A\A]A^b@3uz2yzoHLH1]A\A]A^pH5>5 L*H5\ Lt=H5g Lwt*H5h LdtH5 h LQHLH]A\A]A^c0H5I9L ӱL IN1LH5 I9THmE1SfAnfnfHnfA:"fH:"H f:"L$0flH߱HӅH|$80)D$)$ϦHtfo$fod$XX` H [HHG%G ƒ``uHwH0HtLG8MtHw0LH[ LWH@LOuHLLHtEtOLLH釀HLLH%DSfAnfnfHnfA:"fH:"H f:"L$0flHH|$80H)$)D$菥Htfo$fod$HXX` H [HqATUH1HIHLHHHtH(?HL]A\I,$LE1ff.fUHSHH=0QHuT1H=Qt%HQH|HͳHH0uH={1HuH[]HHH[]HT$HHT$tfSfAnfnfHnfA:"fH:"H f:"L$0flHH|$8(H)$)D$Htfo$fod$HX`H [ff.SHIH5wuy<0L g 0ALcLgC<9HƸ}0HIHDYHC4DA9|MtI[x=DJA"QHY߀Xu-AL HA<:H,Ot/B;0 jMZI1[DYL NHC<鐹uJ9s,MuH1E1A9|I"H[IHHiDQL HC<g駸龹ff.@StH ]Cը3Hx[X"[HfDHG HtUSHHHoH;-HUHݽHHHUHC HmHC H[]@HHHaff.AWAVIAUATUSHGD$y8I~ HI~HHĘ[]A\A]A^A_HH|$HH@HHT$HL$HL|$Ly AGD$=HL|$PH4@HHt$ H\$PLd$ Lc AD$D$ HLd$XH<@HH|$(Hl$XLl$(Lm EEA[McLl$`OIDD$ILT$0L\$`Hl$0Ik DeAMcHl$hOtmDd$ILt$8L|$hH\$8I_ SvHcH\$pH4I$HHt$@H\$pL|$@L{ AoHcL|$xL4@IH|$xLg MA\$LcÉ$O<@IMl$ MAmAAx>McKIM9jLt$0fAfAN։LD$ L\$T$HL$tHL$T$L\$LD$ 8؉MA.AA\H4IL$ML$HL$(IL$It$HL$LL$ ML$Ht$ރLL$ oAA CuN L%lI$Ld$D3GT4 Ct CL ;CDA LLaAuA\AtAHfA\fADtiAxAVM\$HMVHH|$u~E1"MLaAuA\CnA>HfA\fADnHD$HPHD$HLE1Lt$0xAǾ'1EIHIHAHfA\fA\@cC1Ld$E1HD$E1IIIH7  HIBMAII9vIMM9C,"v'\LA~vLT$8LD$0L\$(t$ Nqt$ L\$(ILD$0LT$8HIHIBMII # THA LLd$CkA{.LT$8HL$0LD$(L\$ t$pt$L\$ LD$(HL$0LT$89CA\H ŻC&xIt$L AC\&LIA:A6LLaAuRL }A\A6xMA<A|IA\Ck\fA*fCljmM\$HUAH5!HfA\LfADxfEfETfA<fA|nC&uL%LT$(M $A41LL$ C4I$LT$ H\$C I4$CM$$A<rkA\A\AHfA\fADr9BHD$LAK4AME1LLd$ HIHt$1EHHD$H:A A HIBHHH9HIL9t$E.A"vA'A\A9A/HӽA~vH|$8DLT$@LD$0L\$(mL\$(LD$0HH|$8LT$@HuwAHIFAHHH+A `H˽IHӽHD$HӽDHLd$ !E9EB ILAGfAN\H^AكAHt$8It$LL$PAAHt$`ALL$HAAALL$@ML$LL$XML$I LL$hAH5LL$PCULG LL$(GLL$HLG LL$ GLL$@LG LL$GLE H\$E LL$8LH\$G ELLT$XA C HLL$`HL$hCH6<>A<~AK4LfA6UM LT$PfGfET6LT$HfGfET6LT$@fGfET6LT$8fAfA\6fCfA\6 fA fAL6 fAfAD6fA<9fA|6LeL fMfC&uMfA42fCt&fA fCL&fAfCD&fA<:fC|&Ld$LL CUJ4LT$PM GET6LT$HGET6LT$@GET6 LT$8AA\6CA\6A AL6AAD6A<9A|6 鿪f?AWAVAUATAH5 UHSHHHc HHD H[]A\A]A^A_LoE1IcMɪIUH9|H{DH AAI|HtDH_  A뭸HDOnH{DH'OWL{ E1Ic1MH9H{(H_0HDLkE1IcMMEL9}CI|HtDHqAHHtDAAH[E1McE1HtLM9eJ|HtDHDAHD*ZH{DHCL{E1McMFMM9K|HtDHALoE1IcMIEH9 L{E1IcM|I?H9FH{ DH{ML{(E1IcE1M[L9`I|HtDH?AHHtD H{HDH@@7LoE1IcMϧMEL9YI|HtDH=ALoE1IcMڧIuH9H[E1IcHHH9{H|HtDHZAHD@pH{DH)bHD@LkE1McMSIEI9K|HtDHAH_E1McHLM9J|HtDH?AHDwH{HnHDW@@HD<lH{DH%UH{HDHAAH9QL{ 1LcE1MtMM9Lk E1Ic1MOH9OH{HV@@I|HtDHALs1LcMMM9|`LkE1McE1M5M9EH[ E1Mc1H I9-J|HtDH AO|MtqA?ukIHtDHL$ L$ MoE1IcM#IUH9}+I|HtDHL$ L$ lA IiI|HtDHAI|HtDH2A 1h1M}HMK|HtDHA}L{1Hc1MH9I|HtDHADHAAE1IEI|HtDHUAtMLMtIyDH+AxIRMUK|HtDHA L{1LcMˡMM9K|HtDHt@I|HtDHtAu鹡鴡鯡骡饡頡雡閡鑡錡釡邡}xsnid_ZUPKFff.? AWAVAUIATAH UHSHHc HfDHH5A  H[]A\A]A^A_HDLAAHDu L}MI?IHtDLBI?IHtDLǠI?~qIHtDLLcM;}HK|HtDL HDbH}HLu1LcM MM9KDHtHxDLf HDMH}DL6LEH]A8l;cD}M`LsAA IH5 Nc IAL1LcMII9"K|HtDLHDGL}1HcM/H~?"HwH{qHLHS@@HDGHuEDA#L9lH~ALw1LcM`MM9K|HtDL<VH_E1IcHLL9`H|HtDLALE1!I|HtDLAIcMIH9|H]1 H|HtDLHcHLL9|HoE1Hu/DJ|HҜDL?AMcL;E|uHDĜHm1LcHL]M9BJ|HtDLHDtAoH}HHHD@L}E1IcMIH9I|HtDLnAHD?H}DL(ӛH}LE1!I|HtDL AIcM[IH9|$HDsH}DL\Hm1HcH H}H9H|HtDL5HD\L}E1McMMM9K|HtDL?AMT$Au$H50I9tLSu MM~ItI|$HHt$ H5͛H9-LL$ASM|$Mt'L#oIHHII9LL{LH_LLIT$tMINt@I|$t8I~~1L/LI蔐HItRHtL1HI9w=HLLpvLL贑fMD$I|1ILLw9ID$tLMVAt>I|$t6I~t/LLHH=wHtAI)L9wLLiLL LLMxLLMpLL]LL}H}EMI|HtDL{E1ÃALnMI}E]AApH y0HB AURE1E1u121 I~/I|$#LLII2H(II]1aI\$HHLDlHHHHH9HLHHH' H11E@`HLH[H]A\A]A^A_-LLLY雖閖鑖錖釖邖}xsdid_ff.AVIAUIATH HIHI9D$t>HT$H5%L荜H|$HtcH|$H/ƛ~H LA\A]A^I,$֛uH=LL1H5 H?lE1AWAVAUATUSHHGHGH;GL>HH Hc4HHu IkHMKHH[]A\A]A^A_L}E1McM$MM9|HuH: ujKtH$ `AHOHuDHuLf0M0Lv M> HU(HrT Le M, HuDM<1HDE8HtN HuHUvLuE1McM\II9KtH0AHuE LeE1IcMyM$L9}cItHDPAHuH{ #LCAHHCHH`HRE L}M31HcI;%ItHHu HuHl žLeE1McMǞI $I93KtHgAHOHuWLeE1McMM$M9LuE1McM~II9L}(MHuDM ItH'DA 5ZAWAVAUATUSHHDGHAPWH;WLؙ>Hw.6H HcAHuHfpHuHHI鬖LuE1IcM'ML9pMLMtIqHAHuH*HmE1IcHHUH9HtHAHuHHuHϖHmE1IcHLEL9HtHPVAHuH6_HuHHm8LuE1McMM.M9IKtHAHuHĔHmE1IcHHEH9HtHALuE1ItHtHlAIcMjML9|L}E1KtH6 AMcM,MM9|dLuE1MuSKtHAMcM;|-HuHǔH7L}LmHE1MLHHuH=7/LEMx0MMp MDM$DE 1HH57H>hHuH cHF4HH= cH#4HBH= cH4HT隑SAWAVAUIATIUHSHH8^=HLuHILCQHHbUHԔHcHD$H EIIH^HLLdImjuEukI/H[]A\A]A^A_ZHHcH|$zH}(LI|yޓ@ HYI|$(LH\$iHHt{TH HPHHI|$(HLHm<魓LĄ4f.AWAVAUATIUSHHt=HGIt-F ƒ ̓@~0_tI$MHL[]A\A]A^A_À~1_uH^HoHF.|/_u<_u I$M1AHپ.LXHuAV E1IvHIF0AЉу@A Ag-ILDC<;_I9wIL)H|L9>AL$ @U9CHIH@  uZ@@ME0A_ILLLCHX1HuILL&HtC@EPIg$HVH@f:_H鬓$ff.HG_ ff.fAWIAVAUATIUHSHHHH9}H5 HrIHxLHH@M}HEHH9HOL9AI9LMHOI)III)LHMLEII@2I4IH>LT$PLT$H|$PM HI7+ff.fATxIUHHi:H; ztH]A\XLHx]H  A\-^ff.fUSQHoHt:H_HGHGHG HxH|8+HsH=Z1[]@HGHtHNt |^@AWI1AVAUATIUSHHt$8HT$HHD$P?zHD$ H͕,HD$H1zHD$0H1zHD$H.1yHD$(H A@VHT$`H\$XHT$Lt$PIHT$HLIH|$XJLl$`?&tfvHHH|$HL[]HmEH|$ Lm!LL~`ӒHl$8HtLH~MtLL~ZADuHHTH|$HL赌‘Hm饑AO@D$u%Ht$ H|$(y}tHt$hH|$LHHt$hH|$|y鑐I.A@EG@MgHD$hL|$pHD$pLt$hLl$xDD$@HD$xkf.H|$pHHt$hH|$H4]HGH HH sHHHt$hHL聊H+CLLLLFu psIH H|$*_IHL4HD$hHDImuLwI.uLwHt$H|$H9HALD$MQLMH|$>&H|$ 4&H|$(*&H|$0 &H|$&H&D$HĈ[]A\A]A^A_HVH H|$(HL$@auIHH|$KuIH)H|$05uIHH|$@HLLLH9HpH(ߎI,$uLvImuLvI.uLvHt$@FHuAOHH=B$H55$H|$(khp騋H|$0Lq8HH`H(IHD$8HyH|$(H@8HHH(VH=#vH5#H|$y6AOIAOH pHH H|$HL辇ۍHmAOHH|$HLyg颍pHHH|$HLfHm΍\pHHыH|$HL HmLLfPLD$8M,LLx9LH?HD$pHH3IHL\$8Ht$hMtLsxHt$hLL{H|$hH/6ӊH|$8sH|$8L&x6ToHHH|$HLΉHm"AOHH|$HLe+|$@H|$hH/TH=E PHT!HH50a鋋WRDATIUHAPHH;=rYLH]A\7DSHHHtJH8Hu1H[H GH@HHHkHPHHuωD$ rD$ ff.@ATIUHSHGHP`HtFHHu!HoxLH/H9t'[]A\H{oH9uH+uHdo[LH H]A\d@ATUHSLfHL;%kqt L;%muHHuGHH[]A\H5>qLYH5mLYnHnHvDAWAVAUIATIUHSHHHD$(HD$ HD$PH (LHH HD$ P1LL$0LD$8d}ZYH|$(Ht$ HHW9HH|$qHJ`HtHLOMMI:t}Lt$0L~HDH\$@LH5I|$]H=KsCHLG L}E1HĈD[]A\A]A^A_nWIHLXL-G2IHGJ,IMwHMHEHj?IH=HmMD$IpI9t$It$H}ML$(A1It$HM\$(Et3L9"IHtMwL;wTIGH/tCDH&I/LE1KoLyAI|$(&oHqH3E]IHHOHL>ADžumI|$I|$(1Ir LHHAtAtfAC=HH|$%H5 HkH8sA LHHHPMHHHt@HD$=H|$IH/ˉI+L%jH5 I<$sHmI/pLmcHtKHT$n'IHHLHI/IuLmM#I,$'H5 L-jI}B؈BHH5ojH>A7HhH;A/nH5 麈UG0H?H HtmHMH=H@H9uSL LH=wM9u?HH-wRt]L LH=gM9uH]BH]H]Aff.ATIHUQ*HÉI|$HHx7IHHHmuHlLZ]A\ÐAWAVAUATIUSHcH(HL$ HD$HLEIHHXMoM~FHcE1H$IWLJ,HEPH:HH H9t1H$u+IM9uI/uLakHD$H([]A\A]A^A_H|$CpHH|$HHHD$HD$O}Ht$!H.u AUATUHSHQHt H;=OjHuHLmH5(LyH;lHHt+111HmHmIuHjZL[]A\A]+?IHLG[NLgQHH1H0IHtHHhIELh齈针f.AWIAVAUATUHSH(H8F dDh9V$>h"H5 LcIAHuULIw8;du?DhH([]A\A]A^A_HuLIw8AA;dtddžlLmHUAM A} HuHt H> H4HE1L9%NLA9 IHuLDm1AHuHE HcҾLIw89d0}m HuLh}$L IcLL$Q|Iw8HMLHV(j8AAq?Ar7As(Aa IuLMW8IMLIR(8LmE1McMs I}I9}KtLnAHmH; HULrAADDN$dLJlADhAL| Oc,MAHLf3HuLHMHLI LMLIqHmE H sD,IcվkLAAHuLTHuL@UJ 7H=4LO@@uMLm ffLLA8WA{{LRC{H5WL;C{LmH}4$D\$JtLLD$4|4$LD$D\$LLD,I8L$&IH{L$E1HuM9JtLL${H}H,$DtAA zHGF IcѾkLs {I8"&HHv{1H¾nLX\{IG8LHHpLiLhpB7{LB"{Mo8MUpIjImp%H= 6H- HzH75JtLL$~zLYBzLDBzHuL$F\AA yH=BHcҾkLL$B ZzLoLW=zLdH,zL$I01LEHH= 6HZ HyH= 5H Hyyff.AUATIUHH0HD$(HD$ HD$H{L-F H~XH1LD$ LHh+{H|$ iHD$ H{H aYH=:\H1LHHt$(ILD$HL$HT$ LHt$(H"{H0]A\A]PLHHD$ P1LL$0LD$8ZYzH|$(hHD$(HyzH|$ hHD$ HzH|$HurRHD$HRzhHHzHOyHl$"@AUATUSHDg,EHaHHtlHC8HHx 9 HmI~zHxIs,ufHS8Hzp x1H{8HAH @LGpMHMABdDlEjEtHD[]A\A]LJldAZAԐAWfHnAVfH:"AUATIԺUHSHH8HqWH|$HH0) $ZyHIIݺHLZLH^HIHyL=YHI7@HHHmyLHy/IH[yI7H@IHDyI,$HmImvyI.fHnH|$fI:")D$ !H8yfo\$ fo$X PH8[]A\A]A^A_H IHxImxx1OIH{xLTiH|TGLoT/f.AWAVAUATUHSHHH;58VtcH;57VtZHHB7IHxH{0HH7LII9u6HEH;DTtCH;OHHL[]A\A]A^A_HEIHtHI,$uLSLeE1H(xIM9}NtHL3HDxH=SIH9xtM9tINLI.uKxLH H}HYUIHwHT$(HL$8HD$8HT$L`Lt$0HL$HL$Ht$LH!t7Ht$0HHHwH5SIH9pVwM$IL2ImHuLRH^wHmiwI_ AWAVAUATIUSH8H;=pTt.H;=_Tt%HwH;5QH;5 Tu H;5OuI$LH8[]A\A]A^A_ÐH;5MCH;5S6H;5PFH;5OH;55RH_H3THHvHI|$4HvHEHI|$ HvHE HthI|$(H~vHE(HtKI|$0HavHE0Ht.AK|H>vJDIL9u1LH2Hm,v!ff.zf.zIt$LH81[]A\A]A^A_1Gff.zt H5OLfTWfVWf/vH RH5bOHH81[]A\A]A^A_U1~%]W~WfTfVf/Rf.zIt$H #RLfT WfV fWf/'It$H `OH;5KauHD$(H/RIHuHXLt$Ll$ Hl$(LLHLOt?H|$ HtHHfTfVf/FIt$H iOAL4/I/HuLSOHt1LH޿(0H+8tfATUSHHH|IHH{fHHH{ PHHt#LHIHqtHL[]A\HD$Z#HT$Ht+PH=PIHtH=PHK HsHS(LfHnfH:"fInH fH:"@HHHI|"HE"HyfATfHnIUHfH:"SHHH= Q)$Hsfo $IHM~6H9}1HC1H)IHHxsI@(I@HL[]A\MyH9~H)I1HEIH1AVAUATIUHHHtHH]A\A]A^f!H2sLuL&RIHsHLH<_rImsHL]A\A]A^f.AUATUSHDg,EuoHG8HAHHxpx0HS8HAH @HrpH~LEhDlAhEtHD[]A\A]DdǂlEPAfDUHHH/tLLI,$HHoHDH[]A\A]A^A_enAZtA[tE1vnAtt?nAauAbfE1W nAdAǁlHLE8Mp8u'MAAAy@EELE8Mp@ԅmAAmE1LHD$=GHT$HH+HtHH H1fDAWAVAUATUSHHHGHt$IILHM|5 HII9J<Y5IH~mL5^HLxLpL5/H5BDNErmMH{I$cH|$~LD$I|$1JMDSL\$IKDI?PIMsHI EIA?DHI({ HI EIA?D@ ID[$IM DI?P$Is(HI EIA?DH(I{,HI EIA?D@,ID[0IM DI?P0Itus4HI EIA?DH4ItT{8HI EIA?D@8I t3A BTHI DI?BtIM9uDtGTLHIHH~ A\LntkIFHw!IMt$EL$EqAvHL[]A\A]A^A_AI$LL%v1DIcHII$MtAlHVt.I9zMxpMl$MhIMt$LHETLzEtI@HI9jE1IMl$MA|$AAA)AEpAE1IH=o?IM:jjff.ATIUHHyH;@tH]A\XLH]H A\=$ff.fAWIAVAUATUSH(H8~F8fևd>LJlH HHc HA$Hv>l LViLE1.+AH(D[]A\A]A^A_HvHVlL6HuL i1MnL9}(I94LELItHAAH(L1[]A\A]A^A_2 IHiLMA9LUMM Hu1LL;hH]E1McH E ARH  L_hI8A_x HuHE SLE1)A`HEH M8IwpLfMgpA8[ I8IO I8IC MAHIAEgMgI8HL?gHuLgDL(lgI81LHwpLf]LgpL>BgHuL.gH]1LcHjHI98 JtL$f$H^(fA~HGHuHLfLUM_8II{HMSHH=L lIH?hHL`'hI.MhH=o 2IHhHL&hImThIG8LHpfH=I IH hHLgI,$gHu L gIW8H:GIH5<@L\eSL'{gLR*LIw%MoeGL&Ze11LLz(I.gHuL-eHMHUL)eE1Mc1HU I9HuLE1AHvH,LAdHuHLE1GALf Ml H(HL[]A\A]A^A_>H(L1[]A\A]A^A_~HvHhL.1I9ApH^HsLdHuLtc}DILJ%cHsH(L[]A\A]A^A_HVHeHH=Hc}l7IHHL%AądImfH7>IHLc1H9/ LEMdI$HIDHHN9 I8IvHI8jHD$Hb$MbHbLEI8LD$MI81HHWpLbLLgp:b<$uHuHT$1Lo5LuE1McMbMM9 KtL DbALf1HcMeM $L9ItL bDoxAEA!bMcMw81LMkKrAaMcAIkIAwqLE1I8AA  cH=xBL]A;I8HHHuHL+44aMo8A,H5#I}(u&8HH atLHuH LJM8AIopH]I_pLnHvH AU MW8} EZoA@IHuLeIw8H sLHV(e* <MG8IuIxHHH`HLAą_H+`<LX!} A_xbHcIw8HkL.A qLE1I6AH(L[]A\A]A^A_(MOA f`(`I8I8II8IMAMH@A _H_HuLs^2LN ^I8HLHwpLfLgp6^1LzL5^3L^H59L i^HLT^WL?^HuL+^HEE1McHKaHI9LqLV5]Mw86LINpAnxLiMnp<]Le E1McE1MtM $M9]M8AIopH]I_pH(L1[]A\A]A^A_AH8R1LnL4D]Iw8H]1HNpLiLnpLcH^L+M9 JtL]I:I8XIH\LqL"4\IO8Hm 1LIpMqixLqpLcE1HM9? I_8AL{pMoLkpL v6HULI1LdK\H56L4\MW8I $lLIR( \M4$M\$INM1A.LH/LLAEgH|E_ABH < ^E1CLT[\K HsDK(DC$H{AwHC,PY^IHA[HL.[HuL[}q@Lw[AFLLE1iA&\ DK(DC$K HsH{AwHS,RP/IXZMZLLZHuL|Z}?LbZAD$LLE1AMo8DHcHkLI59ZIOq9u8~H}HtH5 Pj]LLAą\I.I8HMHW(HIlL E1L9LEOdI $Mu>A Ɖƒ @\[@CYLi0A}*AEI8mHW(L&YIt$LHID4$YI_A(LgXFLE1?A LE1$AH E[H53L4IxXLqL/[X<$M_8uI{pHD$HGICpAkxH|$ M8AIopH]I_p[I<$sI8IgHMWHWI8HH¾LwpIFHGp/WLe 1HcMWI$H9} ItL$OW$˾XLkWIw8NxDAIcLkJDFxLfp1HLvpLIFdžlLU8Ldzn.b I8L_pMkLopHL.VLmMu7HmE1IcHVHMH9}5HtLlVAI}tHL0VWL5L[VM8MGpAoxIXMgpAL!VLVA.WIuL蹼UMeA$t,VVLLU1E1LIcL9}HtLtUAMYLKEA zHy$mI8I8I<$HD$H3LULLxTAULH}ZVH= IHVIw8H~8H謇I.AwXErVIcվL&oTLZTH=  IHXHLWI,$zXGH}%LufLoS6LUSLkSI<$H1 IH HLdI.AL+H lLFJSJtL5SA1Ҿ.LL\$HL$H$HSHHL$LT$6LLRH.1LY2RL4+TLE1AIyÅAG,LuE1McMSI>I9KtL9RA;L;I8H5,oxLgpLwpIFLJlLu8LdL1HھzL')I8HGpLhLopBQHmAo,HvHcH;EiHtL'`QكILmE1IcMlSMML9ItLQAIO8y2HuLE1ٷA6LLL$LPL7LT$HL$`L$$.LLT$AHL$ILH$HH}PH|$HLHDLIHYPEg,IO8HT$LL$EHy(ueHHT$LL$HD$FLD$HHQHt$HD$LLD$Ht$mHD$HT$LL$LD$ I(OH<$HT$LLOL OHmHtAG,1LcL;UAo,VJtLH$IOH$AAxH=j HHOH= #H4H^NYHD$HNAG,I8111&NLeE1IcMaNM$L9I_8HmkxAo,HuKAOLeE1IcMDNM,$L9&ItL@NAHc$H;U}HtLN$ItLNACMMMMMMMMNL"H5t 1E1I;MMMOMMMMJtL4mMPPVMQMLMff.AWIAVAUIATUSHHGHVHHHHHHHHH9WAKHH9PH<IHQH= 'HhHxLc!EHEPII$H+AEA+G?AT$HAuA+w)Ɖ?A|$HEE E+G A)EAA?DEL$ HEU$E+W$A)DA?DAL$$HAU(A+W()‰%?AD$(ЃHt]Au,A+w,)Ɖ?A|$,Ht8AGLA)DC+DAA?GTIL9u@H9gL<H{Kt=V)K<?HH93DFLSA)EAA?ADHL9 D~ HKE)DA?AP H9~$LKD)AA?D@$L9DV(HSA)EAA?ADx(H9N,LCD)щ?x,L9~pDN0L{A)EAA?ADP0L9~JN4HD)ɉ?p4H9~*AD)ȉ?ATHH9uDAuIM\$LHIHH~AlLkHL[]A\A]A^A_HH`H4H<7LOD^D9LEH3OD^D9H]HO D^ D9LMHOD^D9LUHOD^D9LICLG\D9tqfDMtEtH{Et?I9 MIMMHMl$DHIHIHAIHtC|HuHHAD9pMAdHf11LLHnL%nmL"H IIyu,Lff.ATIUHHH;tH]A\XLH]H ] A\ff.fHGHVttLGLHIHHu.LNMIMHIuGvM9u-Hcd@H1HT$0xHD$HÃHc21HHfAUIATIUHSHH(HOHHHHHHL$HT$LHM2H|$HrLD$HtLMt-I<$1H([]A\A]I(uLH|$Mu@H1LKLMuȉD$ D$ HvHHHHHVHD$HGEUH9?AHcHD$HiM0JEA}IuH9uHcHD$H7I$Ld$1L#H([]A\A]fI}x]LD$HH|$MEA}H9HcjHD$HI$I}~LH|$IH/uLl$Hl$MwIH=!H7H\IHNIHmuHqLl$>AO)HcHD$HHI$HHHAWAVAUATUSHH(HGHnIHILHHHHHHII9[I:HPA|$|$ LIHHLLULXHt$ 1 pILHtWHt%ALL$HD$HHHXHQiDa$HT$0DELiH\$IkDd$HM\L\$tfE}Au1Dt$(D3t$(= AE9ELAEM/wHHfDd$HIAmE}1D= AE9ELAE$S/wHHskIL9l$AmE}1Dd$HDm=O AE9ELAE S/QII=H|$H9|$H|$3HL$ Hq8`|$hE|$`$PvLL$8A1$$$$$$D$$$$HD$hHPH$$H$H$ 1H|$xH$H|$8H$մH$ȴH$Ht6HD$H[]A\A]A^A_AD$AAD+$EE)DD H$Hc$HrHt$AMA=H$DWIcHpH9D$HT8 EDJDfnmHc$f:"f֬$MB.I?LcMIM9L$$mI|v AAAA3A fE;gJH\$Ll$0ME9e${Ee$Ld$MD$M,$LD$_D}D$HA9DL@Iu;F$LL$F$IIqLL$D2D$HA9DL@-M]A;C$Hl$AC$HL]Hl$HR H$HH$L\$(DL$DD$D2Lc$DD$H$MAEJT DL$D$L\$( DJfnuHc$f:"fִ$AL\$I?M9t2H|$K46^2Hc$L$L\$B(HA$I| mAHAAAʐfDWAA2MHcqLZE[(D)AADj9EED!ALYE[(D)AADin9EEAD^ALaAl$(AA)ADDEDaA9EEA@gL^Ec(D)ŀADn9EE211D A)01HcIwHtDFEtE`EAǁ`Ak/A /J/C/D"A3DAZLbA\$(AA)ADDEDbA9EED D$HA9DLAMUA;B$H|$AB$LHH|$Aj2@LZEc(D)@ADj9EEo_D"AxLZE[(D)AADj9EE@ = =&҃Ag, ,DD$:HH9D$V,H$1Ht> |$FDFH9i$AHc$ATE1DAAL$IBA)4 t$HcH9MT: 1EARH9~ ABA|BDD$D$E1Hc$ ?S+HɐfO4AL\$@T$8L$0DL$(DD$H=?,HH$H9HM`,Hc$L$DD$DL$(L$0T$8L\$@ D)ȹۃ>ۃۃAۃAۃAۃ/U+De+`+[++,ff.@HGAUATUSH ,LoMtmG AAA +@tbHo0Au^]u_u4Au+|#tHI9H[]A\A]1At|HoHAu ]|]뵋]@f ff.@AWAVAUATUHSHH(HHD$IHtALl$Lt$L|$LLLHtH|$HT$H)HITH(L[]A\A]A^A_ff.@ATIUHSH>^H+H}0HHHSH+HuH"H{+H9tH] I<$HH/tI$[]A\AWAVAUATUSHHXH|$Ht$8HL$0kH!-HSHT$H{ \H{"HH{$4H~p{&$H~`{(H ~P{*H ~@{,H~0{.H~ Ht$0| HH9L$Hl$LeLHH*,LHH,HD$HLL,Hp LWIH+1LLH1E11MI?@DdEAfA]R ED$fA4;IcHH9M11E1fDK 1Lc1L9E1B|e7 L\$E1L gF K$HLD)D,$EM|Mt$MMI9TL9)MAu@ w`@IcLHt$JMI9y E1M9LLHML E L9 B|})DE1M5LHDT$(L\$ E1EAqL iE AALT$ D$(IB|eL9~ f IAIAI)M=UM9 %O<$IAE&AAMLAD AfAGAɐfE^IIDE,G+,CD-tH EE1AqAAIcAE1Mt$ML9;AU wH=? HcHE13H|$'E1LHK4$0HHձHXH[]A\A]A^A_AuIʐfAW@A#H= :A=#MI/B|]#MIB|] IuM~L9TJM~L9BT}8L9%!IIBLUMAfAED Dt؀mw ]nIII A>1LHT$ L$DD$( |$(L$L = PA9T$ E1\iLl$L\$ GtG9tOLHD$ L A= AD9*AL\$ r A+IWIsHD$fBD]D$L < fApvfAsUEMfAntAfSfBDUSIrLHE1L < fApvfAs2L*fAnvH HL$FD9uFTefAXdfAzIGIM)|E E,t HHH9LHD$(AqLT$ _ 1L\$ DL$(AHAnzEaAvD$AopDED$$M LHE1L ; vMHIHHB|mduHuM~ B|mDHL$H|$@FF9IcHHD$( L ; HML<$MIHH\$@Ll$ Ll$(Lt$(II9~;LIH9~C||tLE LL$8AIANIMTHH|$8HLLL<$Ll$ LgLt$(I9H|$8HH$H $L d: H)MDdLHE1L 2: %LHDT$@L\$(HL$ 苡 HL$ L\$(DT$@DLuH9~ fAEAPvAofA8As@Ap ApAD8T6HLDT$@L\$(HL$ 1ApDT$@L\$(Ht$ L n9 DirHODlEIE1IA@$qIL93It$TILH IIL9AO IWHD$fBD IsfBD D$L 8 L\$E1H|$gLd$HI$LFH>H\$_L2~+3pH59 HcHÃ~CAIA?uH@IDщDtlt1ҸDЉ{@1҉n[LD1҉>)0$׉ ߉҉AAAAAAED))sWi]1҃ƒK?߉4k'҉AA҉@UHH57 SHQHsHHHUHCZ[]DUHHG  HH9wW  @tH0u<7H]#HHt,w\HP ։у @t@hHH]Äe@L@HOfA(L }H5p I9F1ŋ,tHHYATH;weHt$HGHAH H9HH/tDA\HV1A\^cAUIATIUS1HI9]~@IELH,HEHkHmHtH[]A\A]DH1[]A\A]ff.AWAVAUATUSHHHp&HkH{0IIHRH{8IH<H{@HH&H{HHD$HH{PIHH{XHHC3C3C3C3C$HL1L1L1H1H3D$L1H1HH[]A\A]A^A_fATIUHQHH9Ft0H1HHt+HLuHHZ]A\HVHu1fATSHHTH HQqTHqL$…I$H=M\$MT$ID$ID$LAID$ MHfInM MfI:"AD$MPHt-HH<@H<ID$H.I\$ HL[A\H=8IHTf.AVAUIATIUSHt H;=L(HHHxHHI|$ HthHEHu/1LA0HIT$HhHHP[]A\A]A^I|$(Ht HE Hu^1LA0HuuHmuH01HEH52 H861HH=V s1I|$0 HtHE(HtAK|HtJDII9bAWAVAUATUHSHHHGHXHHdLl$MHxL=HwHL9]LgM{LGM;D$aML$OILGIMH:L]I{ HOLM9;LgMHwI;t$oIT$HHHwHIFHLEIx(LOMM9XLgMWLWM;T$RM\$KILWHIFHLMI|HOHL9?LgMGHWI;T$MD$IHHWHIHH9t)LMIHIHHmL}I8A&Ld=M1HLHA1HH-II>H/ HtGI~H/aHt3I~H/HtInMIH/{fDHt$11HOI AHI>H/)I~AH/fDfDHt$Ht$HHE1NHGI<$H_I$HLE1HDHt$11HIXfDHGI,$toZ HGI,$OHwE1VI>AH/E1UHGH}HtH/t]H}HtH/tUHEHޗH@H9uiHuH}Hu8LEE~AE]]LELNIAM I0LNHEH]USHHHHRHB`HtCHt9HH5#H6sHHtHHH[]诰HHtH HRH5, 1H9XZ1[]fATUSHHHHH HHMHHH9HE Į@LQIH|U AH LMЉω I@@=H0E@C@,Ix0IIHrHKHDHHHL[]A\HttfDLřM'IH[]A\@@MP0LH@x@Hu0LM9qMLHM)M9MOHILHs%@HtA2@1@MIHyLHHIT*HT)H)H)HHHΉD<<E4HuHIMPH#AAT*T)낃uS@@HuH".@@IPHy1f,JHH9ugA|*f|)*@g@LMHQE@tU@M`H3E1GIL9upE1HHIxHAUATIHUHH HHHHHtDL/MtLHuML;-WHt*IuLLH ]A\A]H1LL-HoH5H}H9 HHHH訽HmHHL;-]LiIRE1L?HHT$R1jjH HHtML1-AWAVAUATIUSHHhH$H H H$MA|$  S AD$ LCIl$LD$ A͉ωAΉ|$t$9c L9Z @ L{0L|$ W@tML$0L$LL$9L$vA@ @[H L$$ I9INHHY|IH"H<$H|$ H)H|$@HHD$HULUE1LT$(L|$ME1HH\$HMHHD$0Ll$L\$0IEUAL\$(DHH$AL\$8E1II fDB:(fBL(LHNl-L9}LH\$HMMHt$ H|$H)HfHHI 9 MT$KIFID$L$9L$ HhL[]A\A]A^A_ECA As HL$A M9MNI|$HA Ld$E,$IHt1E11L9|$  H,$H $Hu IL9|$ tHT$F;,uLHHH\$IE1DE1IJ<@:/MkM9B:lMkM9B:liMkM9B:lQMkM9B:l9MkM9B:l!MkM9~wB:l MkM9~cB:lMkM9~OB:lMk M9~;B:l Mk M9~'B:l Mk M9~B:,+IM9LHMhLL;\$ wHt$ H|$L)L HH H *I|$HH:fD1L=L9{ ML$HIID$MItgItUItCIt1ItIt IWHQI4?H49HM?L9HI?H9HI?H9HI4?H49HM?L9HL9~I?H9IT?HT9It?Ht9M\?L\9ID? HD9 IT?(HT9(It?0Ht90M\?8L\98H@L9r"E1H H9KIt$HHIl$MLHT$0L)LL$( IHxI LL$(HT$0ID$NM]IM9L9<$H,$S <wL{ @)Ls0H,$A L9LNI|$IH E11HH\$MHIM9}rC,H O<tuImL9GD,EL&C<tHIM9~%G ,EdH=B<t&IM9|M9uH$MH$ID$IImL9| &HI9~E,EAH5B<tMu L9HK<,L)n IHH MFIHH;$It<! <H= A? LL$8HI MJL]LLLD$XLL$8LL$8LD$X I(ILd$PL94$LL4$M!IHVHpHHFHD$HH9PII^HMIOHH $uIaHLIm HL H+ HLHT$8LL$0HD$(LD$(I(LL$0HT$8 THH9SU ML9E.EL C<HL9uHLH+LsHLt$ PHHL<$A M9MNI{HNLd$E,$IH1E1E1L9t$ H,$L$IuIL9t$ tLL$fG;,quLL)MK<IHH ID$L H|$(HHyIMtrHt$ Hl$L)J|IHII I|$NL&H/1H8[]A\A]A^A_@H;iLt$ Hl$(HL$LH葡5I}HL$HL5H\$HHueHT$ Ht$(LLBH8HUHL[1]A\A]A^A_B輙HIm&I?H5 7H.Ht$(H;t$ 4M5H1 Hy&LMHt$(LHH~H\$H|$ ILL$(H<,IHLd$(IuE1H|$OM]MHmu ff.fATUHSHHQHPH Ht$ HHHucH LWHL$(MB8AJDHH\$ I1LH1HH@I9 HP[]A\fDLD$(ssHH]LC8uHt$ 1HfDL_Mc8AJ'HHt$ 1H1H跏HP[]A\H| H| HHrHHAHqHII9^HHthHtVHtDHt2Ht HtLKAMHNOIN$O$IJ<K<IJ4K4IJKIN O II9NONdOdJ|K|JtKtJD KD NL(OL(N\0O\0Nd8Od8I@I9wHt$ 1HnB L$(UH?Ht$ 1HIH?Ht$ 13H?Ht$ 1HDAVIAUIATIUHSH HH\ H H HI,$Ht]HM HHt$HH HߔH;D$} Iu1HLH []A\A]A^I|$Hw# Ht$脷HHt'H脔H;D$ HHL;11HYHRLE1L$HLHT$R1jjH IHtH IHUfHHO|OO:SHHHJHT$PHt$PHL$@HD$8HT$(1LD$HHD$0H\$@H\$HHD$UfindHD$]HD$uD$}Ƅ$D$eH|$@H9u[LD$HI9uiHt$(HT$0HL$8H~tj~  } yxHAHHt7HĘ[]}Ht$0ytLD$HI9tHt$8LyuHĘ1[]H aHWH56 1H9謌[ DAUIH5t6ATIUH HT$`7H;H~ HV |$Ll$tILHT$H覹IHm M L藂I,$a H ]A\A]Ht$1ɺH.IfAVIAUIATIUHSH H H= H H HI,$Ht]HM HHt$3HH HH;D$ Iu1HLAH []A\A]A^I|$Hw Ht$ԆHH H H;D$G HHL1AUATIUH`H^ HGHIHt=HwHtH`LH ]A\A]wL%@xM0 I$H`L]A\A] Hl$1HL$H襐Z Ht$ HL$H H|$L HIbAWAVIAUIATUHH`HIL|$LLT$E1L |LCL9t ErL9LQHHxE0Dt:E1HAu.tQHHDŽtAfDL|$L|$u|$asciHus_asciiH9t$_|$lati!Hlatin_1H9T$$H5^N L譮 H5RN L薮L|$1ALAHL] L}HHLLHIHLPAHmuHL>H`]A\A]A^A_L9iHx_L9YHvf|$ iH`LLH]A\A]A^A_1of|$ n1|$ H`LH]A\A]A^A_|$ t@|$tc|$fXL$_L$ LL$ 8u(AyH`LLH1]A\A]A^A_51u6Ay6wAylH`LLHE1]1A\A]A^A_:3CAy28Ay-H`LLHE1]1A\A]A^A_{LL%IJ1H5 I<$ۆImH41SLL$HGH@XHH8H9u$HE111Ht$Nt HD$H1fHE111Ht$t HD$H1AWAVAUATUSHhHt$PHT$ HL$0LD$XH@HGI,HWIILHH?HT$@L$IHMH ~LLHHH?J:HH)LLhI9H<谢HHHLhHXH]H qH]E1HEISZ/DH\$8ICDMjJE1MMIMkI 1I0A$ wHD$|$@)jAWAVAUATIUSHHH/E ƒH9utiMH}H}H=>H9} t(LHHH1H[]A\A]A^A_pfDUHHG`HXH} XH}XH}(XH}0XH}8XH]EDAWAVAUATUSHHHPHO?G HH$ @LWL]fLO0HDŽ$L$Id)$L$$HDŽ$DŽ$L$Ƅ$)$)$AIIHL$E1L$D$x{tHUHLDL$L$Hl$pIL$+L-~$H$H$<%HJH$LL$P%D$THD$XLl$`HD$H(4L$IH$HmL$B IL$AωL$PA AwfL; AIcLT$T0LOT$TL$It9B IDaL$PL$A @* qЃ  .H$HD$PÃ߃L*hH$H$L$Ƅ$L9LvHl$pL$MHīHHqDd$PAxVAcvCAL$H!u(L$DME8f.AaL}L;=C L;= AsB Hl$HHEHl$HDd$dE#} A D$TH\$XLeHt I9Hc|$`H$HH\iHmH$ L$IL$H$L$L9$,|$xH^$H[]A\A]A^A_@Ac LUIN H}E ƒ Y@H0uH|$X|$`H$HgH V|$x1@fDAGAXHEYLM2 AHEID$TT$`H0AAH9]bH|$XVMEAX;A@H @LcIADAD{H|$Xu |$`] 1HT$HHt$PHD$d;vHl$HHiH$L$H$M|%MwHJL$IH$|%IHJH$HH$tr|%MWHJL$IH$tI|%taHJIH$L$It$<%t=HIH$L$IuH$Ƅ$HIH$H$H$HwL$IL$H$L$L9:L iH5J H$I9RUHȘE)L-HQH5 1I}d1H$@H$H-oH5 H}_bcADEB ^IDQL$PL$A[L%P Oc4MAifHtD&Eet DtfEt1HLL1ILHKHHD1E]lAlDIHփ uE11L1HE1Mj1oHf.AWAVAUIATUSHAH|$(HT$H|$XHD$HHD$@IHHl$p1IHHMHH$MDŽ$ggLL% LY- H\$PHT$(H\$PH9s`HJHL$(D A\A;$BH$$H\$xL@uRL$D HT$(H\$PH9wM[H|$H H|$@ H Hĸ[]A\A]A^A_ÃL$fD C?LL$XHL)HHt$hH9LBLD$(zGu A>M9uIH$D$H\$xHPAH$\9$H$HL$xLGL$@490|$H9tD $LT$HD$HtHzH LI2H9 EHDHAOIH9뀺ff.AUATUHHHSH(Hu7HH}L%A1LHLsH([]A\A]HYHRE1LHHT$R1jj^H H'HtL MtE1HtLhH5I}H9hL߁ƒmL%fDAVAUATUSHH`F F =}HHH;=bH{H9:H;==yH;=}H;=+~8H|$5H~0HH}tjLd$L興H>Hk0LSLEFLDL$L;S MZL[ArHc|$H k H`[]A\A]A^DE1E1H}H;=WH;=b~GH;=5}H;=P^H;=~{8E @H}LsH{ L9*M^AZL[E&E Le i@oH0LkL;k IUHSEeHLH k H`[]A\A]A^H{0HOHEHt$L$LLD$AAH`L9MVAzLSE&HCE&HyVHHH=H(H`_IHL4IHHLuI,$uHLKHΦLsH谦LkH蒦SHk:L9)MNAALKE&HWLKH9qLk\HLsImuL wKH;HxHGHXHHHqu&Ht!H~@HtH9G~LGIH;xt1f.AVAUIHBATUSHG(HH9I}TH HsHHH!L$MI9D$uALs0H=I9u!HSIt$L_uu[L]A\A]A^LLHAօuM$$MtnI9l$u%HC0LTL9u_HSIt$LutM$$Mt9L5*I9l$u"HC0L9uIHSIt$LtvM$$MuE1eLLHЅRLLLHЅ3ff.H>xSAWAVIAUMATIUHSVHW(H} H}IHEHHXL!U8H HMLxHHML@MtLMNT IE]ELuL}M$IM,$L*I$L}x6fI*H]Hx@fH*^1/|wCZ[]A\A]A^A_LAfHI I*XHڃfHH H*XH茥1SHHHHVH;V taHzH~ HSH;S LJLK*LSL;S HIRHHSALCL;C tCMXHL[AH[H|$H舢HL$tHCHpHs{HHL$ZtLKMQLSH\$HA뜾HHL$*HL$dL[HHIsHsA;IHHL$HL$ HCL@LC(HATUSHJHHt>HB HIH)H:H9rHs!@uHHt DD @uFLc[]A\LLHD7HyHHD1H)HH)LHHʋDD7DD1DT7fDT1H)HtH{HLff.ATAɉUH8HpHIBIHtHH8L]A\HIff.fHDL$ LL$ =HIPHHrI@HpZff.@AWMAVAAUIATIUHSLARHtH%0HH HLMIDLrHILZH[]A\A]A^A_DAWH3AVAUATUSHHLw HHGLLI9LGMHwI;pIMHM,HHwH{IEL9}ufHnIfI:"HMHCH}lH}L} HEHELm H/6I/t`H}tcHL[]A\A]A^A_HGI(t,E1AIHtHH{H9]LE1oLoH=pHEHULI[fInH HfH:"UISafUHHGHHpHXHJHHtHHH]鎶HHt$譪Ht$H1H]H?tXAVIAUIATIUS1DHI9$v)ID$H,HtLHLAՅu HmHt1[]A\A]A^1ff.@PH~F1ZfATSHWFGHG_H jH9O>HOIHt=x yAdLξtO$%O3w*HHHuEILL]Is11H[]A\A]A^A_fD$<H$H5" )D$@)D$P\$lcDGH52Dd$hL V2B4G,+t$ tH|$pAƒXAEt nEHEEIcHL$%HH~x E H]ƒ Kq@`LM0A9-HD$E1McE1L)H\$$n<|$xLl$(Ll$@LDT$$XÃHD$HuLD$1LzLl$MI9m1H0IHfH@@LL@fo yLH@ID$(IDŽ$AL$0UI|$t@HL]A\A]HwI11LD$LtkHt$L:II,$uLFEL%MtI$1H HڅIHuIEMvI,$uLDE1_HH= UtHuLD$1ff.HHGMG @tHw =H0H>Hw@AW1AVIֺAUHIATUSHIvHH$Ld$0HLHHH;1HCHr)#H{1LCLG)IL$L$H|$0L\$@L$MII]Ht3M} MIH$LHLL|$HuCLIH$tHOH|$8tLOHL[]A\A]A^A_IH1HD$ ML)rHLl$HD$LX Hl$LLd$MHLLt$ IM)M~2H$HLL HtLLHHIIILLLd$L|$Hl$L!H$LHLL<$D0DѿL $HH1LL$H)H$NqHL|$LX Ld$Hl$L,$DMH$LM+LLIHt HLLL)LpIIM)MLLLd$L<$Hl$L[M9INLD$L$HH|$LE0L<$DALT$H H1HD$E*ppIHL $H@ HHT$HH,$LL)HD(HHxHH\$HtHDH)HH,$IL4$H|$LHLL\$AL|$$8IHTHL\$H)HMKII9ML|$1L\$L|$I4oH!LT$HD$Lh LIH\$Ld$Ld$Hl$LMLL)HL|$Ld$LLHl$4$HLHL$ HL$ HtHI9HLLL)LpLHIL{H5>IH9'L6QHHRHR%H+II3L$L$H|$0L\$@L $MI]HMD(Hx IMI]L9}LCHH)HIL9BLH|$1ILD$L\$HmIHsME L\$Lp LT$L$LD$O IILLL1MsIAL9@At HLH@pLLH$H|$ HLLL\$L|$YHHHLl$H)HM)HI9]LHt$1ItmHLL$L|$Lh Ld$Ld$ Hl$ ILH\$H\$HD$Ht$H)MH$LHHt$(Ht$(HHLDLL9HK,0LHIIH$H|$ LHLLD$L|$膺HHD$H1-lIHLH Ht$HHD$LHT$ Hl$ILHl$HLd$IILHHLH$LHH)HH<LLLHIHL|$Ld$Hl$ LLLH=IR X,E1HeE1MH4$MHMLMHLL)A:LM[@x 1L9};AT HE2DqLLHLIqLd$Hl$bE1MH4$MHMLMDH8H9GAVAUATUHSHH_ HKHHu(Ls HM~@HE1Lc8Mt$I|$@uaH{0LWA@IHM9uH}HuLGHH>AI LGHeHE[]A\A]A^f.LHMH;=:uI|$zfM~HHtHs@IjLm(I]HtLCA@IALM(MiMtM]A@ILM(L-M$MtIT$@upHL9LM(@HHHH;5:H{>MHMuKL;9H{;HHHH;9I|$g~H=:I9L%LCMHML;I90I} HH9%[HsLAЅL 8M9L$HH6HsI9A%FM]ML9u\A$%TIT$IHHu!Lf8L9_IH9ЅH{0LHAH LAg@AWAVE1AUL-wATUH-xSHI|DtIDDEHL MMGLLD$HD$HfLxHMQIWLHT$HL$H2LyHMIwLHt$H|$HLsMMOLLL$YLT$MMzL?MM_LL\$%LD$MMxL MIGLHD$HT$HtiLzHMtXIOLHL$Ht$Ht=H~H|$HLL$Mt"MyLMtLMMuHH4HD[]A\A]A^A_ff.ATLg.L-HuLA\L`ff.ATHg2UHSHH9Gu HHsHHUHLcHMLgtRL;HHH~8H}u1HH9H<DHHEH] LHVNHtGH(41[]A\L% HLt HsH:)H 1ŃDATUSHFyHVH_IHHH)H9HHHHHLL,HmuDH90SHXHHt H[CHHu]ff.@H1B0ff.UH;ww-HG HWH)H~wHOuH@,1HG H]ÉH|$6H|$wHOHG tfu f,AHG 1뱉,fSHH HT$Ht$H|$HtBHH5`;HHt+H@tHwHHxHOH9u1HT$Ht$H|$tH [ff.AWL=F AVAUATUSHH(H.Hl$Ld$HXLl$HD$HJDdHLLHtvH/H9T$tHt$HFtF lj @v@~0_uHF18_tAH>zHD$L= ALH>DHLLHt{HY.H9T$tLD$IptA@ lj @@RMX0A;_wLLLD$H-XpH([]A\A]A^A_f kATUSHD`HHCHH9t$H{HtHCH/u+H=)jD[]A\ff.@HWHHHHH~NHH|HH9LkE1Ƀv AwLCA:DHL1ff.HHHHff.AT1SHQ0HH; (Iu,HHHPHAHH H HAId$ID$H5rID$HIt$H5rID$ HLZ[A\HOLOHA(L@@(uHuHQ0LALY0LHLAHz Hzff.fH d @ATHH4$Ht>HT$HH5=hhHt6HE1HQHHHDA\HH5$/hAU1HSHHH5 HILD$t/H$Ht$HӃtH*HH[]Ht1f.UHH Hi(H9FuOHVHtEHE HL$HPHnHtH|$tH(HH ]H'HHHt$_HH(Ht$ff.AUATIUH Ht$HL-HoHT$LHHHHHH@t]HEHT$LH&HmHt.H(1H ]A\A]HT$H5kf̓HHQHEHt$1ɺH.fAWIAVIAUATUHLgH=HpHLHHYHH=HHLyIH H^(I9D$u9Hx'I9T$0u+LLv IMt:HmthHL]A\A]A^A_I$LLLI,$IuH (H9t'LHLIHmuf.ATIUHSHH&tHsL[H]A\[1]A\ff.HH5&H9GqLGHcL9u HL "H= H @ H5T HEI91&1fU1HSHHH5 HILD$4HUHXHHNLHHHLLI@LM9tM9tyHtpI@HL9tI9t^HtUILM9tM9tDHt;I@LM9tM9t)HyHtHDHL9tI9t HsHLL9t5H5>I9-HHtLL9t I9t LH$Ht$L9u 1Hx H.&HH[]HӅySHHHvH;&x Hc[@ATHUSH H IH@HfLHHt6HHmxotI,$tZHr#HH[]A\I,$tHuH"HLG#HH:r$L#UATIUHSHHwBHu[H]A\ZI$H;$tHB[H]A\1ҹHH= u[1]A\lDAUATAUHSHG YHW @HE0AHL %8A<9uKEH1 A< uHHH[]A\A]C\HZH9| DDC<u7HHtnDPC<u;EtHH9|L %1HZH9|D$CH5JH9"HSHHS(:xfAVAUATUHSLnHHwMLuII~@HLHHHC(L@@(u0Mu@HS0HLAHHmuHH[]A\A]A^HS0LHLAHIT$ I|$HS0HLAHHWLFHtLJAAIDL5H @ 11H5 I>fSHHHt.HCH;G}| HtHC[HCH/t1[ 1UHH~H5H9E8Hǃ?]rfAT11H53UHy\HeIH5/I,$H?HCH}HlHH0 HmtH]A\HHD$EHD$ff.AWAVAUATIHUH0HVHB`Ht?Ht5.HH-HLRHmH0]A\A]A^A_H;It$(HL$ HT$HD$HD$ LD$(HD$(I|$ Ht$(IHDH|$(HtHD$(H/Ht$LIHH|$HtHD$H/t}Ht$ LIHH|$ HtHD$ H/I|$LLLHHHH HR11H5 H9"yfDHHH;x(}HWHPHx Hx1f.HH1IHgHATIHUHSHoHH9HH)H 7IHtdIt$H@IT$HuXH LHHfHn1HHHH0H9uIItJ IHIh[L]A\H~L 1H HLRHLPIHteLZLXIHtSLbL`I$Ht@HJ HH HHt.LR(ALP(IHtN$N$II$L9uHLH9oOE1<[1]A\1fHOATISHHHWHwH*.HPuI$HL[A\ff.ATISHHHGtCDG ELWLD_ AADA t]A@tQHG0H[A\1LHL$L$6L$HL$IPII$HuHGHHGHfAWAVIAUIATUHSHHHHHL&HdM~MIH<H9H[L)HH2HD$H|$IH/HILl$@1LHH}H4?H<lHHx'H$H;Lt$hfvHL$LHT$Ht$MHD$h)$IHD\$UHEMLD$M9MNHHt$D$fAnfInHDŽ$H9Lcf:"LT$HHOLf֌$HuXILfH:"LMHL$PL|$XI$Ld$`HL$@$LPIXH&MLH)H|$hIH|$`Ht H/H$HH$fHDŽ$$]HL[]A\A]A^A_HE1Ll$@1LHH}L ?I<^f.L-IEH|$h6LZ")3H$f$PH=H5 H?H$Ll$hHDŽ$M H|$hE1!LuuTIHdMvI~H9NH>Lu&IHHImHHFIH-H5\ H}rf.AWAVAUAATIUHSHXHHHGHHIH)HD$HG HsHH9HLKKLIIN HLHHnHLLHIHLuE1Lfo]MLcDk@A<$LsfLk L5l AALcE1Ml$A<$'LkwjA $H=j LcIADILL#H{IvHI HJ"H $L6k IcLDIHXL[]A\A]A^A_M LCHsLk ~[0A@fH:"[(LvILsLk I9MILLLuM)IG$J IQHIEAM@HL#0K@HC L$LsA<$LcA|$ tLT$M)I9]El$AO$Lcjf.JT2HC8HPHHQHMhL{(IMA~u0IE8MUfI:"Mu MFLHLULHH)LIHGHHHHHAU@LuHL#MeHCLcS@H{8D\$LgLGLL#H{IvHIHD\$ILLC8LSL#IvH{LLUHIMEd$MA^HL9}HHI9u LHLSNHCDLsHD$LL$E1El$L)I9LuAT$ It$HD\$3HHLL$D\$N, IMMuIE YIMuH9D!BH91A;u84LqLPMuLLMU L9E&E;e8HHIMIE H9 A;M8INIBIMIE H9lAFA;E8INIBIMIE H9DE~E;}8INIBIMIE H9AvA;u8tmINIBIMIE H9EfE;e8tIINIBIMIE H9ANA;M8t%INIBIMIE I9E1I9}LHMmL)LmHGfLHHLuL LK[@HBEZ@HO$MLbDLSE1L;T$ A2M|$D$@H|$@HT$HHD$81A?(IWAIcHFDAD\$0LL$(LT$ t$葏t$LT$ La LL$(D\$0tE1|$TA;wtI0t$f.M?MIILLS8Nl2MjHM@ALL#H{IvHIMEd$KtHsDLK8M[L{(MoK(LSMf:E*OLSE*EEBLsA,A?LLLuM)IG*HLLHHMbHLHF DK@HCEt DEDEHEAg@oLMLf:Ls8{(MM LN<L+M9LLHLLLLSH;Ut z UILcyI%HHPH<HI9gLHID=I9JLIHL9.L;u0DoMfE:E}(fMoD\$L[HHsL]H e~IHyHD\$LH~S0fH:"S(IHCHC HSDJALHLsL)MLuHGZHM J>ER@IHLL#L$HC LcDS@ML{8~k0fH:"k(HCMOLHK AyHEIH9| AI;GIHIH)H Iu8LLFNHHIE8LzLuL)LMLpHGEHLHHA}@L#Me8HCMd${@I LcLCHL$E1A|$L)H9/LE+HC LsE.C<DoIMfE:Dk(6LLs8M9IvM&LCLHVID$LEL)HC H99oI~f:K(HHGLMHHLcMMIE[@MeMLuA]@Lf.E1H;U&ILcA}@t JLuLAHL$8D$H# I$DL9t$E>E;zfN<M9bLHIIoAHLHfDE1H{8LNHS(HAHI)L*Lk(MkN$L)HZ@MGM?HS(H2L4L)H!LL:MLs LK8HsIM1HuM~c0HKIMfH:"c(HC HkHHC MtHCMH4HsMtE1H{AD$E1LIL+UI9 HH)H}L)HGuHLHHL HB LcMB@HILbLuPLL$LkE1L;l$A}D\$yA9D$D\$|IILL$LY fMnfM:"DC LsEd$ML+EM9jLHM)LuL)HGtHLHHL HB !LL$ LCE1L;D$A8D\$LD$踶I|$D\$Ht$Ed$LNX LL$ HNK|fLnfL:"DK8El$E1ML9eHJTJ HAH9@A>H5H9aHCE1H;D$D)D8( HHHCET$E1ML9HJ|J HAH9@AHH9LkE1L;l$AEw HpDAw L=[GE1A9eIHLkET$E1ML9?HJtN,I9HMLd$ IIHl$LM9 I\$E1H;\$ ;LL$0D\$(A}D$9D$D\$(A LCIMD$LGV LkE1L;l$A} {ILk)AL$E1HH9VHLTL,M9M2M)Ld$ MIHl$LM97 I\$E1H;\$ ;LL$0D\$(ճA}D$dz;D$D\$(A LKILcU ML$LL$LkE1L;l$AuA|$D\$A~D\$LL$L U kIIfInfI:"{ LL$LkE1L;l$7AuA|$D\$}D\$LL$ LCE1L;D$A0I|$D\$LD$_D\$#LkE1L;l$AMw H5 E1A9L$IIfMnfM:"D[8HSE1H;T$k2w L=AA47I|$D\$ E1LL$HT$ D\$ .LL$Ed$MAK|LL$fMnLS fL:"DcAt$HH9ELI|IH9AHAHI LccLkE1L;l$EUE;T$IIfInfI:"C$LkE1L;l$R1H9U@E1r8H;Uc: UHELmHD$I9L9 DzD\$0ALL$(DHT$ D|$HT$ LL$(LvR D\$0H;T$D:D\$(LL$ DD|$ӻLL$ D$L/R D\$(ukDn LL$ D\$(L R uND LL$ D\$(LQ u1D|$_LL$ LQ @ƅD\$( @ƉD$D3l$E1E2LmL}M9qL9DjD\$ LL$HT$EHT$LGYLL$D\$ fAA_@A AEL9Q L9D:D\$LL$ALL$D\$H0LQ DVfAA_A AE9LmL}M9L9 DjD\$0LL$(DHT$ Dl$4HT$ LL$(D$D\$0LP <L9D:D\$(ALL$ DD|$LL$ D\$(LCP 1D9l$@6H}LUL9H9DzAzH5AAA_A EL9:@zhL=dDC@_@ A1LmL}M9oL9D\$(DZLL$ HT$D\$DL$HT$LYO H8D\$(F,OfAA_LL$ AE AL9D:D\$LL$ALL$D\$H0LN VfA_ ʃ;H}LUL9H9DzAzHVAAA_@A AL9zH5DB_AD DD9bA;wr A;wtI t$IAG|$HIHHD$@HA#3EIIuAW9r A;wD\$LLL$0LT$(t$T$ D\$ t$LM LT$(LL$0A9D\$L_A;GPH9D!E;e8NHHIMIE L9t$A6Iz D\$ LL$LT$LT$LL$D\$ NIMHJ HH)HH0u} HM}(HN L)HLIGfLLs8[@IHHMfLuMMIA]@LI IEMegHE1H9E:LE1H9EHHD\$ HT$HT$ǶLcEHT$LL$D\$ HHI#N,#D\$LL$,LL$D\$LK LcE1Ml$A<$'LkNA$HqL Hc4H: _HHIMIE L92L;uhD$AD$MdLcGLHD\$LL$ĵLcELL$D\$LILK C1RLHD\$LL$xLcEsLL$D\$LHIbK YHHD\$LL$*LcE%LL$D\$HI\J SI1E1aDHT$ LL$(L)J D\$0DHT$ LL$(LJ D\$0xD|$_LL$(AD\$0A ALI T$HT$ HZHGff.H!HH9WuHfDHWHt!HFOHt%vHx2Hx)19HFHtv11Hy11ff.fHG HPhHt Hz1HWHHHHHAVL@AUATUSH\߽v2߽ v ߽vwL qmIDDDDDDDE49AL9LIcHL)HALpHIwEL+0HHLHH[]A\A]A^ÐH mHDDDDDDDD4H9~E1HIIuaE1HcHH*AEAMcLDA?DPLHMyA?HHmIu|wf.AWIAVIAUATUHcSHHHwI~HF`LG`HLcN$H9uAHD$ML-0LLHAL9t{H[]A\A]A^A_M]OLT$M9t?MtSH|$uL-HD$f.*L-MtDL-ImIH|$t(Ll$LLHAH;yTH(IwH~`Ht"H,/L9AH;l$AEu HiMvH[L%3L;=INHSI<$uH5N 1p1MH5.O 1MGS1ff.AW 1AVAUIATUSHhI]H|$`H4$H|$ HD$8H@Hn/LJIEHt$HHAxH;:HD$@H~D$H<$H,HOHXH,HڿHHL$yy|$YImL5+L,$IEHD$HIEH|$@Ht H/H|$8Ht H/HhL[]A\A]A^A_L|$8L5l+L|$(L$LL$A ClfHD$8Lt$@M0DMLLIHD$8IHMtI.tpHD$8LT$@MPMDIALLFHD$8IHgM\I.RLEDLxfDLLLt$Ht$HHD$8I%I/HD$8HHL$(1LBL迊Lt$8HD$8@LLLT$xL\$HHD$8II/HD$8MHL$(1LLǽLDLt$8HD$8Hl$HT$HL$ڽHD$HHxH$+ImmELHt$.Ht$LL\$L\$E_iHL$(1LLLt$BL肉L|$8HD$8MDLL=HD$8IH[Ht$MN?HL$(1LLLT$Һ)LL|$8HD$8MD{LLL\$HHD$8IMVGImL$M#Ld$IM# L=HLH4$IG`P(IAHHzHT$@D$Lt$@I~uA~t:H $MHyMoMM;n LT$HML$BH:'L53'HT$HHzH$sL5KI顺߻T;лλff.AWIAVIAUATUHSH8HLg(IWHB`HttHtjL-LIuHHHH9]M.Ht$(Ll$(1A,H8[]A\A]A^A_H;H\$ Ll$(LHL$HLOH}HL$LHIML9tI~H5H9twunLFIv5H=q1L1IH4HLHI,$(LD$ D$ M~M Mv(LL$MtHt$(H;t$ I M}0Mu1H|$Hy&IuHL$(HHHQH|$HT$ HHt$(H\$(/HWHH9HItL)IL]H|$HHuM9|IH|$(H9L)HDE1Ht$(H;t$ /Ht$ L5LCH\$(LD$ HD$I9E1HHT$ MLHM9L\$(E1G<IG<L\$M9|1HVH) HI4HHHډH?XHHHډH?XHHHډH?XHHHډH?XHHHډH?XHHHډH?XH9DHHӉH?PHHډH?XXHHӉH?PP HHډH?X XHHӉH?PPHHډH?XXHHӉH?PPHHډH?H XH9-J|HL9\$"IM^L9L|$0Dl$Ht$~v<t u>DÅyH|$?CD>IM|$+0C>IB\=뤻 fDAWMAVIAUIATI_UHSLH覧HuHLLHH[]A\A]A^A_I|$HHدHH1LA@_t%HLtP<_u݃0@ w Iރ0< vxH=ѳ11LLH5+ H?(HH[]A\A]A^A_LH9u@_tH)LH|$HH|$HxfDATHISH(H9sHTHHH9vL4Au1Ht$lH9\$u5f.Bzt H([A\D$薋HD$H=޲LH54+ 1H?:1HZff.fAWAVIAUATUSHHG gAʼnA AA@îLgHڍH{0LI9HHIFat%AEHHD[]A\A]A^A_I9wEff.AWAVIAUIATIUSH(ԨHfff9L|$"LLD$ D$L;d$tjE &HT$MtI9t\"t~IUH([]A\A]A^A_I9ή:Ů"uf(fTf/nrMtLL臚H H5) 1H9m%HT$f(fT »f/ hM_馮fD|$D$fDAWAVAUATUSHLwG(Ho MfHHH}LH}LԾHSHC HmMI7NM]KKtJ,L IIH H}H9Nt2J\ HJ\H/YHH[]A\A]A^A_LfHI$LeH/MeMOlML$I}O\HWIUH}I;StMtINtH/uWMCIEILEH/'Il$MtGI4M\H|HVII;StLMIKIHHLH/=HsC(1L2HtHC E1M9OTIztMjIENlIH}MIxHb|ff.f|$l$fDAWIAVAUATUSHHD$x<+N<- D$ILӃ0(I9IADhЃ w IAMI)ۃ.ABMjM1DpA L AEMUDxA AEMUPЃ AEMUHЃ w}AEMUhЃ wlAEMUDHA wYAEMUDpA wFAEMUDxA w3AEMUPЃ w"AE MU HЃ wABIhЃ vMM)MIMu EIʚ;Iʚ;ADDڃDDD)E1ɃEEA)NMtMMDGMcAăM9MOB<;0QAE)D9AODl$$E1E1E1fDH9,$HG\HOHHD,Gl]A9DfH*A9AND$xA |$t4|$)HT$xD)B&H^T$xE1E11E1E1|$DT$xSLD$wLoLgH_LW$HĈ[]A\A]A^A_L0L9HAL)IE EUEk I9,$LOHHF<3GD8A9HE1EjA+ AA-wEjMbLA0y IE1A0A wEk IEE/LH)H  AAEtAL9u I9MhLfLcI*CYXD$xA,T$DAЉT$PA)Ext5D)+D$AAtIcL5\$xA^\$xD$A( t$D4$Dd$t$0D$ A1D9;CHHR|$ Dh@L{ A HIE9AW 0ŌHHAD$GLWAADT$Y l$xE1L3tIcAY,ADt$E)!A I02HHqCt=A9HDL$0E1۹H\$HDd$ EAEEHAID\$(L$4}IHLceHxHuHT$lJ t$H|$xH|$X趀IH@D$TٌIH\$lDL$4A)ً\$(DSAE9DAN9OӅ~A)A))Ӌt$(LDL$@DT$8tIHLH]LIb MDT$8DL$@ EDLDL$8趌DL$8HI |$0:E~LD芌IHLL軎IH X@LHD\$ D9\$ Ht$pLρHD$tLHHD$8fD$@贁DL$p|$tAL$A+MfH~ELT$8LD$@A)AEMAEI EDH I fMnfLnL\$xDE^fE/DY5*fE(DT$|D%=|$t =fInH fHnDYDXD|$xD\$|L$ A9L$L|$AD98A,f*D\-fA/MMMEfDWIHIItl$x|$-ff.d$x+%门MzI8fEE1E11E1E1*AMH\$HMMDd$ E|$DܩDYD$xDD$xMfHD$x1E1ntD=fE(BMbE1IMjI֩D=eD5lCMH\$HMME܅VIHT$xL,|$-t$A%E)E 4DL$PA9DD$PA)EDtHL5It$xAY4t$xAA4DL$xA1L5̃AiAtHcEY ιAHH#T$xat$|vIAuA~;LLD$ ?LT$ HILHÍLD$ lD;d$|$LT$tD|$PH|$Xt$LLD${LT$HH%PT$0ÇLT$HHD\$PLT$ DHD$AD\$tt$HL$HIHD$ |$Pt$?HD$(AB|$tHL$ LT$H|$A|2t$L\$HL$ LD$(AAE1Ɖ…~:HLD$(L\$D$ DL$ۆL\$LD$(HHDL$T$ B4 ~(LLD$HL$袆HL$LD$HIHLL\$HL$LD$ H|$L\$HL$ y1Ll$MHl$HHA9<1Ҿ DHHDUHDT$(9,$nD LH|$8DL$4LH|$8)T$4tLd$ Hl$Ll$Ll$L$$=H|$3|$4L$:HDmoMDL$4\$(6LqIH.t$4LDL$8运DL$8HIltDL$xHl$|P|$xAYH/IHE1 1H({LFDL1H I3`L-6LIuڬAąI^H@LʼnAą%HKIuL1H 1` ff.AWHAVIAUATUHSHHW Ht$AAA @үLg0AA qHAHAAHA y(HH)HLPAAL>a^aA>;11A A -wA(I IAA<#u7HD$AA<0u!0A=HDKHD$L|$HHKLLHcЃHLD$I9tuAC<,C<_wLD$AC<@,;@.AEHD$H)HխuAA,k(DcE[H[]A\A]A^A_À;KE<HD;HHD$H)H^{HHS1HD$H)HCILHK HLLD$LcmM"HAڭHIK I)HD$M_HCHD$GHH)H3{IC_LD$I9kIC,LD$L9=Dk(AxADvTAMIHLrI LuCH AH;DH5" 1cf1BE4A%*頫A_uC`LH5 1I;f1fAWAVAUATIUHSHG L6H $AAA @fH_0I9A.B<3赝HcHy"E11L $LuI1HD[]A\A]A^A_IM9B<3Ht$AiHt$HHxHk IAHM9~AB<3Ht$.Ht$HcHuH H)HHH9|.Hk IAHM9@E116A+LLH5%1AI8dLuff.H t0HL$HE1E1j<ZY{HD$HE11Ht$1uVff.AWAVAUATUSH8T$ HL$ HHGI|HOAMLͻIHILHH?HT$H|$ AMAwMt-xLLHL$(LD$LD$HL$(EOHAI?G @֬H0MO MLjf.ˬ H5HDDDDDDDI9I}GDE1IIEI)MAvREAAAv UM~A? GIA? 9IA? +IA? IA? IA? IM9uMGA8 MIA? Ax MxAx MxAx MxAx MxAx MxMxM9yA? unAL$MMʁUM9LA8CIL|$ M9(Md$MH-< Ld$E/EDAAHt$N|$(L\$A<$(MD$E $JcDHfA|$DC t\fE;l$tIHt$DL$(E# 0uI$E;l$rE;l$vI tMiET$D\$(I$ILT$IG#sEd$IN$')AT$A9r E;l$LDT$,迋L$,9A;D$)顥UHH1SHH:]tHHtH[]WHt1Hx~HD$H:zHD$ff.GQfD f(fTf.?ATUSHH|$ ;fEҿfD/rD$ ׃E11D IIIHfA.zXYHH!DRHL!H fA/H,HfH*H\L9fA.zbYHH!DRHL!H fA/H,HfH*H\L9GfA.z YHH!DRHL!H fA/H,HfEL*HA\L9fA.zYHH!AHL!H fA/_H,HhfEL*HA\L9v钦Eu`л=A<A)IDHcHII=D)M!HL HH9HGH[]A\D҉f(A\H,L1RHIfHAL H*XBA=AAmf(A\H,L1`fW!~HIfHAL H*X@fD(E\I,L1oHHfEHH L*EX_fD(E\I,L1IHfEII M*EX1f.vf/H4/HFÐHHXHHGff.AVHAUATIUHSH0HD$ HD$HD$H9u H3L-q HT$LH1RHL$ QLL$0LD$88ZYtH~H|$ L5HL9]H51H6lHHHqHgH|$L9tHuWAH|$(]eIHu1H0[]A\A]A^1LA$0HܦLpHhHX Lh(H@0LI0lIHbHL yH5I9߂1L-^p HLQgL9HH3kHHt_H|$L9tLH3kHHRHt~H=VyH5H?W1H1HQHt~H|$L9tH3+kHtLxH5I:1H|$L9tH~1OAVAUATIUHSHHHt HӅI|$ Ht HӅI|$(Ht HӅI|$0Ht HӅumI|$8HI|$PHIT$ M$hHrPHJXHcBH~HALl8MxI>Ht HӅuIIsI|$Hu 1[]A\A]A^Mt$@M9t$HvI>Ht HӅuIHӅh阤ff.ATIUSH0p?HHH[I$HפIL$011H9})TA HtuI$H@,HuHt- Hc[I$HA$1[]A\I$&H/yD:DHDNF DQHD^B<@yHDFF DIHDVFDYHtl~D:DAHtYDNF DQHtED^B<@yHt1DFF DIH tA FB<B<IL9uff.ATIUHSHHmH~I$[H1]A\rHcwfH=`5 9@AUATUSHHHHHVHHǦHHHH-vHKHHyHwIHAH{HHHH%H{HID$HHhHH{HID$ ~vHHCHץH{HID$(~QHHHH{HID$0~,AHLHHKDIL;kH|HL[]A\A]ff.@AVAUATUHSLfMtJHIu_LF1MuHu[H]A\A]A^LYHHyE1[L]A\A]A^HuHu[]H0A\A]A^LuIHtE1M9}JtHXuH踩HKDI@ATIUSHpHH;="utrHHLH{PxaHl$ HL$HT$Ht$IYHt7HT$HsPHKXDD$H9I|$HNH9HOEuwRT$u1Hp[]A\HHL sL9Ou.Hu)H;Wu#HHH|$ tHHD$)HD$H)H<0Hk|$tf.AVAUATUSLoLg MI<$HI$M~_1L5HUH|HOHL9uZLGMtHwI;p}gMLHHwI|IMLH/t=HI9uI|$[L]A\A]A^DHt'I|IDH/uqfHGI(tUI,$0E1[]LA\A]A^LsIHt1L9}HEH|LwAHtIDHLqI,$uLE1qKH=%rMl$Il$LAMZfInM I+fI:"AD$Ij ff.ATIUHSHHUHuH|PHi[]A\wuI4$HtHHHHy=@GfWCw>]ff.117N1LfAVATISH HnH|$HH4$H9AL$L$L4$I~H9AVT$YT$L%fI~MID$-HI\$H^HkJtI$Mt$H L[A\A^DHPW_Ht$H|$yGLd$f.]IHk?DHVHt$H#x T$L$$aH9fUSHHH?HGt=HEf.vEzt 1H[] CI1MtHHkkHHH(HHGHOHQHw4HtHtf*GH(fH(Ëwf*Ht$f.vzH|$H H(.H=oH5IH?ruff.@AUATIUHSHHHUHIT$HMHZfI|$L,IL$ H9|HH9I\$HL[]A\A]HHHHHIHL9E1HIDH46HID$I\$Il$ HHH9vzLmH5ykI}H9DT7L~HHH3RH+HHtoI\$HtGHyHH9OI|$HL,H9IE1HVLL@kH5H E1I:qsATHcHIUH RSHH HoHIMM9~ |$tIHu M9 LI)H<HL$ILD$6LL$HI5M9IMfA I9fA3tH \H5ߧE1H9 dUH5ȧH[H;c:ff.AUATUSAPHοHGH;_HuHIZL[]A\A]HHuH;Z[u!YH[]A\A])wH:t^[]A\A]H;^uNLm11L^IHI9~H|1QLHOH=MAD Hu6HEIHtJHHzImI6L])HZHPH;H51E1"/HZH;.2HE1fHG0HHtfLG HW(LHHHL\HE1ɹ4?HHHHHthHtBHtLRHMIM1IM[LHzHHHH1H5M[HI1LRHLHL1HM[HI1LRHLHL1H5M[HI1HzHIII1IM[LM1HzHHHH1H5M[HI1LRHLHL1HM[HI1L9@LRHzLHL1LR(H5M[HL1III1LHIM[L1LLR8HM[HL1MIH1HzHM1IM[ILII1HzXIM[L1LIII1L1LRhIM[LLHL1LRxL1HM[HMHIM1IM[H1LI1L9HVI)Au IUoM1L^L)ڃuKIA8#IiMrL1IHIH I1I1Ii H6HI/!I.ImLYH$HIHH5% HJIHHHHyL`H@M~ T$ I$IHs H=XI9|$LJHH-H.HmtH[]A\A]A^A_H$HH$XH$Ճ {b@fff.@[b@fff.@PjH[ZHZff.fATHt2HH5HD$IHdHHLA\Lg.L~7Ht,L)LH[aHD$IHtH|$hLd$H=a'IHtHHHHHt HH\1Zff.AT`IUHHH;zTtH]A\XLH`]H Q A\8ff.fHGATIUHHVH~xuHHtTHBHHHHHH?H4 HH)III)MD)HH]A\uHwHpH]A\L RH5 I9[1HSHHrSHHT$Ht$L%T$Ht$AUATUSHHLoLHIHH_Mt4G=wGHL.HN$I$HL[]A\A]L%HH[L]A\A]H IHtH{HxMtHHsHxDHL[]A\A]Hx#HHWHB`HtGH@@Ht>H5H9uHxH;VuHHDfDPHRH51H RH9f&1ZfAVATL%5SGfT[fI~MtTID$-H HSI\$HCu?HPJI$Mt$L[A\A^ÿCIHuHff.HxHUH9Gu HHf.SHHH;Hv[DAT IUHHIH;PtH]A\XLH ]H  A\ 5ff.fHGtXHVtKUH HL$HT$3x?UH|$Hl$fHnfH:"H@H ]HLPH1ff.AVATISH HQH|$HH4$H9L4$AD$I~D$H9AVL%,T$XT$fI~MID$-HI\$HAHNJyI$Mt$H L[A\A^DH`:QHt$H|$x{L4$I~H9KH,:;Ht$HWL$$xL$XL$L%LfI~M,@IH)H1Ld$FATHHUSHHHHHHHHuiL%bSH{H|H5H)`HHL;%.Su2111HQIHmuHQHL[]A\LgLH11#IHiHAPALX1HD$PjjPH HH=ff.fAVAUATIUHSHHH2H]HfD(fA(DD$;WDL$fE(D\fDT1WfD.@QzHĠ[]A\A]A^HM,$@L;-RfD(t1LD$">L$HI~VP)D$fTf.H=CUH=AL$Y^t$ljfff9PD$HL$$HT$ LD$(D2?IPMH\$(L)HsHd~Lt$0dM|$$DL$ MLH H HDHw A)1AH]‰Àf9?:P1LKD$"PD$}";HM9LI6[HĠL[]A\A]A^Y THĠf([]A\A]A^C;COAYUX"L$H~T-pPLGMH5E1I:UPuH QGIEyqATAUHtu/gHH1DHpHm H]A\à t̃t ff.ATIUHH H;GtH]A\XLH]H } A\+ff.fAVATISH H-IH|$HH4$H9AL$IL$I~H9AVT$f.>Pz\$L%Q^fI~Mt[IT$-?H0I\$HC8H EqI$Mt$H L[A\A^fD.8IHu}Hy1GHt$HT$L$$4HH1IHt$H|$qLd$yL4$HHH3HH5 E1H8 NI@AVATSH@H;JH|$(Ht$ IHGHH9AL$IL$8I~H9A^\$0ff.zTt$8f.3f.~%>Of(DyHfTfTfA.f(}fA.KfEfA.zfEfD/-EOf.zT\$t$:L$D$IWA<$f.HA@AE@Uf.HAAD@L5ӹD$MIv-H5I^H5DL$AHWCDCEIENH@L[A\A^fD(fE: fD.fD(f(fDW=M AG\$t$fM~D|$8<d$f.%N\$f(z\$t${9L$fInIUE$|$ED?f.TGAEʄf.EGDʄf.=gMfWMfDH.eHt$0H|$ )\$0FfDf4IHX3-Lf.ztf(f(2Ik Ef(\$t$DT$fD\$fA/wf.LztfEfA(/2IH/-u/Ht$8H|$(\Lt$(Lt$ \HAD$Lt$ D$8HWLM L;%?H I9u111IHtL[]A\AIHuHgIHt2E1LeQHtH=<H?-tCI$H5<H>>9AVATISH H-@H|$HH4$H9AL$IL$I~H9AVT$\$L%a\fI~Mt[ID$-OH@I\$HS/H<J I$Mt$H L[A\A^fD>/IHuH(u^Ht$H|$Ld$xL4$-H\(*Ht$HT$L$$uHMAD$L4$D$"fDAWAVAUAEATUSHH@-I@fI~AH HcHӉփT$ \$$t$ JN‰Àf9L 1LL$@HT$0DLD$8HL$4fIn#/H@LcL$0LMHH\$8H)tDuLCMCMArUMyIIQMD$ DjLNAHD$(ALH|LD$HNIH|$4LL$|$ I M{L)I2OL9LLHLL$D@LD$IHLM)Jt.HzL@J48I)~.u |$$Dt$ Et.LD$L~D1LMPEDH5 HcLHnJHHL[]A\A]A^A_@IcN4AfuKMAMN|$ MgLd$(M9LD$ E11L)fAgu2I|$ |$$IL9}1DAeI-L@|ML+\$(IA0LMHA.IsuDH<HHLL$>LL$H4L9`M9MLE11LH+L$(0HHH0LHWAVMqD$ E11LH+L$(H5LL\$։ӃT$ \$ t$$J‰Àf9{{L-hLl$AAeLKLT$AgEuAAgHHD$H=H|$H AfHL$K|$$HDTHHLLL$O=LL$H4Lɸ0HH)LL)H_.HH AANuD$4JIH!|$4|$ Iu@Iu.HD$LH0YIE1AT$H{1A9AE3D.fD(EXfA/wYD\fD/vxIHAy0tLL$D|$@E1AH|$lA l$l kDE1H|$LD$LD$IA89AD|$@A|$@fD\$  EFD$AE1|$D$ 0Ll$(Dt$*D9H1Ҿ h HH_ LHI0AEDUEu}Ll$HME1QALc_A#Oރ|$ KfW1fA/xD\$PHL$(AHL$D\$@XLDCHt$ H AAH%IcWHxIwH Hd IHHLl$$> HHY,$ME1LH߉,$ED4$iHl$Hl$H}0EHt$0H= 2H|$9HLL$MMIAH9LD$A H1Ҿ l$@HHһ|$L1Ҿ IHm|$DL$ AA~|$ Dt$PHD$(MHE1AHD$Dt$@dE1t$P߼t$4$DAGAHD$D| D$)E *E2A  D)AfffAI*AA*Y)fI~fI~I EAI M fIn\n)Yn)Xn)Xf/D,xD$AA3cHL$DT$HHHJfI~fA~f~D$hE1E1LL;D$(A0AL|$XD$@IOAG1HL$,H|$(I9D$@LD$1D$ [$\$ DD$@HEEAAB$DA1LIEDl$ D^Dl$ @D)AAAE 9M9AHAqII9{M9$EKArIIA9AL%HMI)III ML$(L Ha'ID$T$DDT$DT$T$DL1Ҿ@IHfHH Ll$XD$@I]AE1ME1H\$H+T$HD$DDT$DT$D$DT$HT$DDT$xDT$T$DHH5HH)HHH RLC(LL e&LKhXLt$fA/FfA.D|$@G($^4HH$뗃<$|$~zA|$ft$@DY5 &*D~fDt$ DYDX5%fM~fM~I DDd$A@I L At HcAAY$AGfD\$ (T$HL$D3L$DT$HHI鋶@tIcAEYAfE(AAD^%1%Dd$ :ILI"ILIIIH̶USH)HHcHHt^H(H,H@H[]ûCHL'IEJ<2HtfnH@f:"f@뱉LC HL H.MIHIL)HLH IL 떐E1ttDètHAfu At7uAuAu AAAff.fHcOLGfnf:"fGeH5HLHWDH(HºHGtoHwHtX Ht3Ht(Ht$Ax4HD$H(11 1ҋGHHD$tH/um1ҋGHHHtHHHtEHtHtHt$AH|$OH|$H/k@AV fI~ATSfH~gHH5gIHI\$LMt$[A\A^fATLcHcUHSHWDgHLHӉWH AOHHHˉOH Aw HHHw H At}$HHH}$H AtcDM(LILDM(H AtGDU,LILDU,H At+E1FD0LIFD0ILASH A9HHu H[]A\D9e ~IcA\D`}HHD$HxHcEHuH HHD$fHSHtLL?%L xLP[HH HH)HHH &Hp(H5WH=8 L$XHxL@[ÿ(b.Hu[ff.AWAVAUATUHSH)GDgAu AEl$D9IHHx~Hc1HHHHLcEHuNADDA L^E)ADDM9VDLVD ЉGFM9D^DH^ ADD ؉GFI9vgDV DHVADD ЉG F I9vF^DLVL_D ؉GFM9s$A2DIID ACABM9rMHUI)III9AN MBBHc}EgL-M\IlL]HL[]A\A]A^A_Atqu AEl$A9Z6OD9|ED96D9(EHc}EgoL9rIoѼATUHSHcFHDgA)eHWH4LD5H 2A899/A}IHD`HcuLXH}HcKELcSIL HtH+KH)AHH L9KULc H)H)HAPH L9K U Lc$H)H)HAP H L9K$U$Lc(H)H)HAP$H L9K(U(Lc,H)H)HAP(H L9v~K,U,Lc0H)H)HAP,H L9vYK0U0Lc4H)H)HAP0H L9v4A4BT%H)B#H)C HIH J#H9wfIHk1I)IIH9ICILH9LBLMI9wEP[L]A\H)HGIA$I AI9wqII)IK H9DYA@LIMPA9D9DHHHfIHLE1fWHoL)HAT$H I9k7H)A4HHH L7M9?HA:1IHI@L9sEYABIIA9ff.HcVG)u3HHE1H HtFLF9LtINL9rÐAWAVAUATUSHHLoHGH;8AIMH;LA I/teHu[LAIHtMEuaH{H11HH#H0HmHH~HL[]A\A]A^A_E1LHD$ HD$HHt H`HPZH\ff.H=SHHH{H5[ff.fUtu%HH`HHHbH]HH5ƥH8n1]f.ATIUHHH;:tH]A\XLH]H A\]ff.fHGHuHHff.AT1I脏2I$LA\ÐHGHVHOIILHIu-LNMIMHIuGvL9u,HcH1HL$x!HD$HÃ~)AHcHD$HHÐf1f.GEfHIHT$0HL$8LD$@LL$Ht7)D$P)L$`)T$p)$)$)$)$)$HT$ IA1HT$L1H$$D$0HD$|H@HAVAUATIUSH@HcHILIkD$[LD$4HD$(=jI|$L5 #h@H~LL8IT$H<'HHHLHmuRHHsI;\$|]LD$4x:L^!LH@[]A\A]A^H=< HI9\$N霺HH̺HGtBHWHt5HuGHùHt$E1( HD$yHc1H=H5́ H?HAT11UHGrAHHHHHbHIwHL]A\ff.AUATUSHH H41IHHH4L-Ht4HLMtIct$cILMdI $HIt/HEHuHHSHHHEDHL[]A\A]I[LHD$uHD$Hu鄼AWAVIAUATUSHH8DGEk~VMc~A9|HDLLcIB,:19k $@{IHHHHcD$L,L9s+MH1D$I)IIJD$HIFNL9IcLC HS$L$Hs,LDHLK0L[HT$M9Ht$Ls(L{LL$ HBLt$M0HDkD LMLD)H M9DkDYLMILDiH L;$DK DiLMILDIH L;D$DK$DY LMILDI H L;D$Dk(DILMILDiH L;D$vjDk,DYLL$ LMLYILDiH M9v?H|$(MA}E IIHLHHA{H M9wH|$(f9HI9M'A]tAl$H8L[]A\A]A^A_fDAAAMIEtDŃtGH8uu̻p1IHtH@HI9'f铻AWAVAUATUHSLcNwD9tEqLoH1McLeIOMAExDD$A9AMLE11A7IHILIщHI H)HwH M9sE:Et:LcMsD)uWJ,MT-LED9EvLrAE A$> AD DMtI?H-HHEH HBH+D$hH LHALd$HBLl$hHD$PML)M)H 8m  HHD$P}HAIIIL9LD$D4 IHFDAE E(Aw[AwpL9Lt$F42 AA IWE$AiA AAE ALpDLVE1H)HjAH9L9?ķIEIL9ZL|$FIHBL:D D(AAHHBH+D$hH  LHAAL9H|$D: AA ISE$DAA AA A\1|LMAL9H|$D:BAA IVE$AdA AAE AH)H9s L:MtL9)0Mu"IM-Qff.@@f ff.@AWHHAVHAUATUSLHH$HD$HHD$ HD$HD$0Ht$(HlD!Eu HLD$0L9EHl$PH c AL=` HLNL)1HDŽ$HHIHD$xHHtHxHt$PF @LT$(HD$0MII)I$Dl$`H|$XMBHT$pESAMƋ0I)IA9 HH@tL9MIIItnItQIt4It09HH@t09HH@t09HH@t09HH@t09jHH@t09SHH@t09<HH@tL909LjLXBt/A3LL9HH@t09IUIC@tAs9IUIC @tAs 9IUIC@tAs9IUIC@tAs9IUIC@tAs9jIUIC@tL9.HD$0HT$pIM9t?HL+L$HL H|$ uH|$kH胀HĘ[]A\A]A^A_HuAM0I)IA9HH@tI9\MIIItaItBIt#I09kHH@t09RHH@t099HH@t09 HH@t09HH@t09HH@tI909LjLXBt/A3LL9HH@t09IUIC@tAs9r|IUIC @tAs 9reIUIC@tAs9rNIUIC@tAs9r7IUIC@tAs9r IUIC@tI92EtHD$0(HT$pLL$0ZHKHD$0,<*<AAE!09rHH@tHAHD$0HVD!NHD$LZE10IS92D(ALAfBt_HIAL9vHD$0HT$pLT$LZE10IS9D(ALAu fBt_HIAL9vLT$BtBttHAHD$0HtH;L5MIL=LL$EtHD$0IHT$pL+L$HH mMQLL$@Ht$ LT$8PUH|$@WLD$0APHT$XRLHD$hPH|$0LL$XLD$xH0@H贮H|$ |H|$|1E1L+L$HL+T$HH rE1!LL$0L+L$HH MQFff.@AUATIUHSAR胊H;tZ[]A\A]H(HUIL$HZhLihHXH{HHtAYL[H]A\A]2 H{Hu<@AUATIUSQLoHGtHGHHPHIT$ I$hHrPHJXHcBH~HAHl8Hx%fDH;Ht HH/tHHsMDzZ1[]A\A]ff.@H(AWIAVAUATUHSHXH~H5H9.cÅLAălH=5L-nHT$8LH H|$8tnH}LIHH(L=M˷H|$8M9t0111H|$8IH/uHXL[]A\A]A^A_H/uArHUH8:H5mHIHFIH"H5mH[IHIH;IH%LLD$yH|$H5mLt$II.ʹME1MYI~OIH|HM1HHHI9 LxMuL}1I"HT$@H5?wHwH|$@HLuBHMHLMIxIIH5wLD$衱LT$HI:H5!H9LXA=HII/HuuL=I H-HE1IMLLLLT$ImL\$IXI,$:I+#I/ HmlDHkITI~(LQIVH5 1I;ImpI,$LE1LT$LT$HiLT$HHHD$11LH5vLT$H|$LT$IH/MH5|I9ıIu`HEHH LK tIHtIHH I9,IWM4I9I/uLLT$LT$I*LUL= H5P 1IRI?WMLHIMLLRMw111HHI,$IuLMIO醱HLT$zLT$HIHuo11H5tHLT$XLT$HIiHLT$*I.LT$Hu LLT$H.3111H|$@IH/uHD$LT$M111HMI.IuLMIu^IUH!M}MU IIImuLLT$@LT$M_A MJA LT$蝭LD$HIIxH5gLLD$I,$HT$I6M HuHT$H1LI/IHD$ɱH(M鉱H=HR1E1H5Ч H?iLT$~LT$HIMGH|$H1H|$LD$H9\$MOHT$HLT$ IHHHD$HL$LT$ YHT$HHHLLT$(HL$ HT$ LT$(D$H*ĬH|$HH/|$LD$M;GӬHPI~~5L1LLT$JLT$HI*/IHI.;3鶭$@UHHGt6 HsHtfHNt;~ (HH]hLHP1H52n I8,H1]H=HQH5n 1H?ATUHQL`L(Ht HHLZ]A\AWAVAUATUSHH|$H|$(HD$HD$HQHl$@1IHIԺHHD$pHt$heITL=( HT$ L-N L5N H\$HL$ H9&IHHH\$IDIAA\H9ADA;t$TfHD$`|$PLT$HL@LD$`EH9M@LKHLL$DLA\L9ADA;t$THD$`|$PLT$HL@HLD$`LEH\$E A\H9ADA;t$TLILD$`E :H9VH|$A_Ѐ w`ED8AH΄tHt$EAD9D$TDHH $BH\$H $s_ED8AULT$`|$PAHT$HDL$TMBLD$`B\A9IrF\Ht$` LL$`D\$PHT$HIqAuHt$`H\$F AHt$`H\$FMA_BtHt$IH)HL$`LM)HL$hHt$LLD$0PUHD$PHT$(RHġ LL$PAQL\$`ASLL$PLD$X萛H05H<H|$lH|$l1gMtH-HxHEHBLD$`A4釬閬@AVAUATUHSHHHwLMHF`L9uRHάH5H9pL%dLt$E1LH5ZeHHl$L9ttH[]A\A]A^IQ`HtH {H9JuHH9Hu$L辛sL%ALt$Lt$LH5eHH\$vH{H9}tI,$EuL%I$L\@AVAUATUHSHHHwLMHF`L9uQHʬH5H90L%ULt$E1LH5 dHHl$L9trH[]A\A]A^IQ`HtH |H9 uHZH9u$L豚ϫL%ALt$Lt$LH5cHH\$iH{H9}tI,$EuL%I$L^AV1AUATUSHHHH@o1HGIHtpH5hjHu:LHH= ڸIHiI,$t [L]A\A]A^LILHsH= 1IL蔸If.Hg|f.zt H2D$7D$Ht1HDUSHHH/H}H}uHH}H[]HtEHc賿HHmu郸@HAWAVAUATUSHH=Ӆ H8HL$ HT$(HD$(LD$HD$HD$ H|$(DK w D@AAAAAD9 HSLT$HOI9 HT$ILD$ MM)MI9A A@H0@ @@6Lo0D9Au9J<LLIZHD9H8[]A\A]A^A_EOAu!MLLJ<IJHAJCL*HHIAuONl(L9}LHhD[]A\A]A^A_DJL-D8t'CL*II|MIALDIL9|H|$t,B|-@8~uH|$At B<>B8<9tL9|$uII?MmIL9|$ZHL3HII?=H=w0LHE1ܢHA!AA HH5 AH8ff.fAWIAVIAUATUSH(H^H-HD$H9tH5H9eIWIFHH9|I~1cH$HH Ld$H\$I9OyL%H\$IF HHI~(H9H/LSHt L9L_I9kHoHSL9tHulL_ H9|PHo HSHtL9uQL_0H9|5Ho0HHtL9u9L_@H9I+HL9tHuIH9}H$H([]A\A]A^A_HMkHLH\$L\$LNHH8H<$LHILH&HHxH;\tqH(LL[]A\A]A^A_H<$LH蚫Iv(I~ LH} Ht$LLnH.LHͦ!uIW鑵ATIUHSHGHP`HtFHHu!H^XLH覞H9t'[]A\H;H9uH+u靶H$[LH H]A\$@AWAVAUIATUHSHT$HWHtH)IHAD+t$HD5?D$ H9H<)IHH=.L`HxLqEHELJlIL$DmAA!EoIIILHM~C\Mt$tsLVIw HHt#AwDnAvHL[]A\A]A^A_AILMcIL,O<If.MtGLIl$EtM9pH`MwL[IHtC|HmuUDD$ L$!A Eo}!AIDE DDL$ AL$E!D ADU AA!EW ID]$DDl$ AL$E!E EW E$!AG$IU(DDD$ HL$A!D ADE$!ADHL9IIHT$LHGI.IuL&MٴLI,$I>L1LHIwE_DD)DoH+L=+LrLLIA{X7ff.HHwHt H(H=$1ff.fAT10IHt11ID$HLA\ÐUSHH~HLVH LIHS8HtRfH/CHHtFH;-t=H H9Mu4HEH{Hk_Hu1Hs H[]fKH21HH"HHH(ukHC1靷f.AWAVAUIATUHSHHHD$HHMeL|$MI]Im Mt H9H)MyUH L譚HtcL)HhHuH8HHLI]4IHL[]A\A]A^A_I9KI9l$uI}8uImI$Ht1ƶAVAUATUSHHPHH8IHLHl$HHCHKL,$L$(L;aH9Hs JH9HL Hs^@HtA}@9@LcL;c fLc LKHHHP[]A\A]A^DMMHyLHL MT-LT H)H)HHHLHHCHKHs H9A^AUAt-t TED-fDD CLYa"UHOHHWHAHH H HAHgH8HGH}HtHEH/uH}(HuH}0HuH]L@AHE(H/uRATIUHSHHHD$HHtcI<$Ht$IԻHCHt$HHSHK H)Hx?H9|:H~HtCH<H{H| MH[]A\HGHt8HSHK H)1HHIHuH~1H9puH{8uHsH$ff.HAUATUHSHHL-/L9t9HG`HtHHHt.HIHtkHXL9ugHL[]A\A]HEIHLHH[]A\A]gD$|D$HE1LH轿HMLC1H=7HxHIH?eI,$AD$uLD$XD$H[]A\A]HoHHrHH+f.Uz6H[]A\A]鞨HuL1HKHVI8H5ZI,$f.AWAVIAUATUSHHD$0HD$(HHD$8H I~Ll$@L]IkF{LD$tHD$hHT$0HL$8HD$8HT$L|$(HL$DLd$0Hl$(I$HEuH5J LL>LLHH*HLUH+ H߉D$ t$ H5j LHHHHLH+;H߉D$ R|$ I,$HD$0HmHD$(HT$Ht$E1LLQ}LD$t79LLHĈ[]A\A]A^A_LHĈH=T []A\A]A^A_(afAVAUATUHSHHHwLMHF`L9tIQ`HtH H9tUHH5H9L%8Lt$E1LH5.OHHl$L9t=H[]A\A]A^HпH9tKLt$LH5OHH\$H{H9}tI,$ EuL%I$LLZvL%ALt$Sff.AWAVAUATUSHHHG:HVI&HOHvIIIHILHILHH1H\$HHPI II~ 1IICDDDDDDMM)M9IM9CDIk1҃v wL-\Ct1ADHHȃv wA|5HcH)H=H=IL9LMIYHW7HL)HHD$HH)IL9^I4LD$(H~L\$ Ht$,HHTH|$L\$ LT$(~JHx1LT$(L\$ HD$NHH1MM1IAt_It,I%A|HH H?ATHELIL AHA?EdHI9A|HH AHA?AELADHL H?AA|AT HL ʉH%?AAD AD$HL H?A|$HI9wLT$E1BDHIHULHT$8HHmIuH2M-H|$8AHEDH/u LL]LHIHˋTHqLkTAAKAA BAA9AA0AGl HDUH)AMcML9ILE 6DtAAAEtAAfAE!DuD\I*HHmuHL$L$J,#Hf(DH|$yfWHH[]A\A]A^A_aHLD$ AHII)HT$LHD$MHHHL$LL$MIt$LD$ N1MAIIItsItNIt)IEdHI ĉD!IDdHETHI ‰D!IDTHEdHI ĉD!IDdHETHI ‰D!IDTHEdHI ĉD!IDdHETHI ‰D!IDTHEdHL I!IHDTEdL I!IHDTEdL I!IHDTEd L I!IHDT EdL I!IHDTEdL I!IHDTE$L I!IHDTEdI ĉD!IDdHH'A E1IE1C|AEMY HfDDI*XABHAHA?E`L=IHHL[]A\A]A^A_ËIGlfMSI*M$CLfIFH*HJ^A1 ETHI ‰D!IDTHAOH}AH&HAEEDEOA6*)L$Hu&-D5L$f.L H5bE1I9H|$xmfYHIfG\I*XL5H5/z E1I>tSYHfA|H*X$Kff.@AU1ATUHSHHHL%tI4$HEI4$1HzHs(HtOHs HåIHuH{HI,$IuLiHm2HL[]A\A]Hm&HH5_aE1H8LH{(H螴HH>ٶͶAW1AVIֺAUHIATUSHIvHH$Ld$0HLHH H;1Hg2CHH{1L<CL׭UIQL$L$Lt$0L\$@L$MII]Ht8MM(MzI)H$LHLLL$ELD$HuCL+*IH$tHuH|$8tLeHL[]A\A]A^A_IH1LD$MHD$L)HH HxLT$LL$tbH@(HT$LMLd$IHl$HLMIM)M~;H$HLLDHt#LLHHIIIHLLLd$Lt$Hl$LL$LHLL $E;D>DH$HH1HT$H)H$IH"HxLL$H$Mr(Ld$LMIHl$DML$+LLIHt HLLL)LxIIM)MLLL4$Ld$Hl$L,L{H5IH9LwHHPH蓫H+IaI1L$L$Lt$0L\$@L $MNI]HMNM}I]L9}LCHH)HIL9|L1Lt$ILD$L$HiIHI}L$LD$LT$,IE(I~GMN(O<IILLLE1MkIWM9B HLIJLLM9IL<$HLLt$LD$E?LL$D,HH$lL\$H1E+IHHxH$LL$LT$H@(HHLL)HH,$D(HHxHLHtHDH)誂Ht D(HxH,$ITH$LLHL\$Lt$ LL$@HHHLl$H)HLLl$HL)H9HH|$1H4HHHxLD$Lt$L\$LT$ Lh(Ht$IH\$LMLd$MHl$ LHt$H)M~hH$LHHt$(9@Ht$(HHtFLLLL9,HK,9LHIIL5YIIHLt$Ld$Hl$ LLH$LHLLt$ LD$LL$?HHD$PH1yIHHxL\$HT$LL$LT$ lH@(HHHLLLLd$Hl$MLIHHHLH$LHH) ?HH<LLLHLHLI&HE1H$LHLL\$Lt$LL$$>IHOHLD$H)HMXII9RMLt$LT$1LD$Lt$I4LT$6HHmHxHt$HL$LL$Lh(H|$MLMLd$IIHl$LHH)M~I4$HHHL$ MHL$ Ht,IH9HLHH)HhLLIHLt$Ld$LHl$SE*L1ISE)L9}O<H@>E DNHE1MMHMLK/HHHL)Ld$Hl$E1MMHILLȹLH= 訯#ff.HHwHt H([H=$fHAWAVAUIH=[ ATUSHHHHl$0HL$(HD$(LD$ HHD$ P%Ld$0IT$HH H91HL藖ϺLD$0HD$@H|$ H9H\$ HLL$(MKT L)HiII)HAAHxELLHXL:HHAHIL D8HAHAIL A8uHXHtzAHAIL D8HtZAHAIL D8uHXHt:HD$LhM4ALHALLHH A8IDIsHD$LE1E1G: *tZCL*IIAuIIM9}1MIITHMtHHĈH[]A\A]A^A_HXHD$1N<*AA8t.HD$H9CL*IIAtIHXHH9IlHr`HȸH1L٪HH=D$E1LD$HII9IOIE1E1EF8 u IM9IL9uHH9HHMHxNH|$ >蘐Ht1H=H5W 1H?{1_IxLL$(HD$ 1HD$(E1AWAVAUIATUSH(I)VHHHMEH*L@L`AgD7DTJ\HDHIOHH A8IOAIL A8uL`IOHH A8ItsOAIL A8ItTOHH A8It6D4$HPLIICL3AIL A8LDHsD4$L<$L1E1D:HLD:1IDD8|IDD8|HD$It8HT$L<$HD$HD$8uHHD$I9HT$HD$L<$L9D$upEIL9$t4LLIIAuHHI9-EHLEH(L[]A\A]A^A_M酵L`+LIIAtLIL`KL`aL`vHD$DIHD$1DLADH 7MHIL D8LDHuMNtE8uMFL$4Ll$(Lt$8M~1AIIIttItNIt*IC|AII D!IGLICDHH Ɖ!HCtIGDAÉIM D!IG\IGT‰HL !HCTIC\AljII D!IG|IC|AII D!IGLIG\HL I!IHGDCTH I!IHGTG|L H!HHC\GL L H!HHC| CDH ƉI!IHG\GDL H!HHCTGTL I!IHGA 3M:@t&LHLd$Hl$0HHHD$0IHH|$H|$ 8I?HLD$8UHD$ HH\$LD$8H|$(I}LT$I9yIELl$(I]LHt$ MOHL$(I}MN4LL$LD$8LFHqLD$@Ht$HL9M)1IILt$PNt1LH)toLL$H|$L\$ EMOHLHD$0ILH)I}L)MCH?AHApHt$(A?HDVL9H\$XH\$Ll$Ll$0L|$0ADIHHIIHMLMMM)I)IIDID%?I?A@NAAWHHIILIL)H)LJAHAA?HA?EPD^L9QH\$XLl$L|$0Lt$PJ<H|$H|$@H|$HLT$1M L9L$8Hl$ Ld$(HEI$I/Im<H|$ 褫H|$(I藫LD$LD$AWALLڝfMFIL|$ bHLD$SLD$HHD$({7L_GI/HD$h]LHD$nHD$eL\$(I[H\$0HT$ HZLHD$6HD$8A4Lt$@LD$HIHMH)LAHA?H?A<E HLڜ11off.ATIUHSHGHP`HtFHHu!HLHYH9t'[]A\HH9uH+uWHt[LH^T H]A\t:@H8H1˷ff.AU1IATUSHHRHxHl$ HHI}Hw1HsCH-m1HOHt$0H|$ 辣HT$0HHH=; 1/IH|$(tHHxL[]A\A]I}H;=KtLGAHt$ehHHHD$rH;D$HT$]E1Ht$+hIHsHL$IuE1HAHdff.fAWAVAUAATUHSH( t$ HE  LeH@tLe0HmH]HH9H41ϓHD$HLp LH:E111E1L P9H=YAIAE+5DXA~AFEutE1HHH9t[ATEtDPA~A=IM Ѓv@LHH?ED^EuAt|$ u Ap+HAeDXA~vbA뗅t$HK8H)ʉIA?B<@~Et-HL)H|$z~HD$H([]A\A]A^A_AFEukL^L$t'EA)DIA?GDH4$E1L^L$߃AwPL$-LIL$1H4$E1AEuAtA|$ p9wIDIAuH(11[]A\A]A^A_}AIA AM Ѓv-MHIA?GDVf+-E1H%AA lf.AWAVAUATUSHH|$8Ht$HT$(HL$H|$hHD$HHD$@HHT$ILt$p1L1E1IH$E1DŽ$LD$PD$HD$ LD$8L;D$PA(AEIp+DHt$8;$*L$H$L)HD$L\$xAG$ ILD$8E1L$L;D$PrH|$u AH|$H\$HLd$@tELl$L+D$hMEHH|$@LHĸ[]A\A]A^A_fAfG$KIL$E1D]߃A@HAIAUL LD$8w,AL] L$A HDHAHH!Ã|$(YDLXuD$D]ZuЃ AA+Et)IpH Q4AIpH d4H|$t -u ILD$8D$E1ML+|$hHt$8L|$`H9t$PvAP-у߃AL$D$1E1ALD$ 2HD]zC,9L+D$hH @M LD$`Ht$8H+t$hHt$XHt$HRH*l$HtHHQHHHD$t$Ae L KUJ|$uAw EtyHttHt$H K HK Ht$XHt$HPAVHl$HULL$XAQLT$xARL$ASH|$XL$L$?H0?LD$8L;D$PH\$HI+LLD$8Tt$LLD$0uTLD$0AU1ATIHRUSHHhHl$HH_H;1Hi.CHvIH{H;= hHw2Ht$!^IHHmhH;D$IuhH|$Ht$ LD$LHL$Ht$D$装HT$IHtHH=0 15IH|$tH"HhL[]A\A]H[H59H{H9WxHWLD$AH|$Ht$ MEQ8fUSHHLCMtkH{HtHGHtWH[]LLHHtsHvHCHm?H{HuH{HtHCH/u胏1*dHuLH{HHCH/_QUH{HtHCH/u01SHH:ct衐ff.@HGHt~HHGHGHHGH1AWAVAUATUSHLLg(MHHI<$LIHtw1L9}@HE LsNlMtL7KHt3IDHHE0HI|$$HL[]A\A]A^A_HmupHEI,$uLE1I$1L9}LU L[L\$OtMLJIHt[I|MlH/#HcbHuHE0HU HJDIm,LHD$聍HD$Hmt<bHu2Lm0HE HT$IEHDI.oL9bHEI,$0#Lm0IEL9qI?L9MkIt$IM)IM L9WEA0A6pAL- AD AII>HfI9IMH5I9%R}HOL <YL9HH)06oDG,fHA*XHyD|;;L="AulH;$EtfWgH;-yHH8[]A\A]A^A_ÙIAHH)fMJIM)XfHzIIM)I1E1SIHlL)A3|LHHILgMHѺ2II)E"A0A6mnEG$fHA*XYH9~ L9|MI)I9HH)DAA)A0EA6mH5EfF$.E!A*XDt/Dtef*XIAM9u1H[]A\A]LH|$H|$DATUSHHHw(HG8HttH{ HtzuTHs(H{ HHs Hs HӑHHHs(H¿1VHmH[]A\H{G2HHtgH{H;=\wtE1H1fHnLc0H{(fH:"C(LHs(H+HEHHm+1xAWAVAUATUSHLG0LwLo MgHw(mHMI}I}HHx[L MO$I)I$ML9uTL[Ht3OdK<I$H9u6HHtII M$H9uHsE0E1fDLHHkI$H9H9I{xu1[C{yC{H|$H5z H|{ H5= HHU}{yP11pHHt2H5 HD$8i\|H|$8H5mP\c{yC{$u"{ H5I Hu}{ U}C<$DSAH|$(11fLn1LfL:"D) $MoLGL at$4HA1[H|$[fDo$Dt$`DT$hfDo\$`fDod$pE$Ed$HL[]A\A]A^A_1|$@A1mD$@(D;$6Ht$HD[H|$DDSD[zD$DD$uCC@{@ATUHQ4;L`LhHt HHLZ]A\ATH5 "nI,LA\@hDAWHGIAVL5{{ AUfInIATfH:"IUSH8~H>HD$ HD$()$|H1Hl$,5HD$(Hu1|IwH-EfEH5 LHcczH5 Lc>zH5Ո LcYyIM~I^H)A-xAJxDH= RH]xx:u4AxH\HL9wHtH=]HHH H7HD[]A\A]A^A_Aff.fATHHILA\f.AWE1AVAUATIUHSQL/M9E1ZL[]A\A]A^A_HE=N4L-RH{yLHHLL+-tIA<tAWH AVfHnfHnAUATIH=5UfH:"HSHfH:"HL.) $I9xHiyI9HHHINzLIHxH}J4-IHxH4H 0L9xL91LHELuHL[]A\A]A^A_fu1QH0IHx1ZATUHQdHH9xL$LHt HHLZ]A\ff.QuH=HHx11]bHHtH5 Nt1ZøZf.AUIATIUH0HHLHKL-XA}x|$$9xT$L$ D$x H5VxL Z@DEx LSA|$t|$u/1[LIxH1LH0L]A\A]Ë|$z`wAT1US1QaHyTHwH=HL%7zGH"xI4$Ht|1aHx~Hw8wM$$H=^LZFwdw{H8[]A\wSHWHUfo[Cfo [fo\ǃHCX[fDHHL[1HHfo[H5[H)L \fvɁhHHrLB LǂǂL`@ATIH H$HD$HL$HD$H LA\ff.ATIUHSHH H8<$hvHS`HLTH L[]A\fAUIATIUSHHxHu<$AvHUxKv1LHxL[]A\A]AWAVAUATUSH8H|$HvH|$@IH|$ |$@}L|$`1LLb\$`Lt$hLl$p}vL$Ll-LLL:\$`HT$hHD$ps|LL-\$`HT$hHD$pR|L-TA}{LLA} {LLL$LLIE ${LLO$z{H-uHL$H)H $ AAAuDRDցzDBEAA^ALL$(A? AHDIqHT$EHt$(EG\Mtff.fSHHP-HCPH,HHǃ,H{pHǃ,HCpH{`HH{xHHǃ|,HHǃe,H HǃN,H(Hǃ 7,H0Hǃ( ,H8Hǃ0 ,H{@Hǃ8+HC@H{H+HCHH+HHǃ+HHHǃ+HPHǃH+HXHǃPt+HHǃX]+Hǃ[AUIIfoNATIIIUISHHHIDbAl$?q HAHOHMI)Ipju?hpHHOpqATIUHSH1H He)<$qHu#H;^(1LH+H L[]A\H9HHqff.fAUATIUSHH>HtqHH$HGHD$IH3q1#HEH<8H qIDHH$H9]Lfo$1A$H[]A\A]L1ff.AW1IAVAUATUSHhH|$H$HD$`HD$hH|$1($%}A??|Iw`H|$`Ht$H|$0{E1 AXLmJL$0DLL$PDŽ$XtHt$Li{L DL$H$HLIxb($zLH(HLL>$eLLL$ AtAGALJMWpAXHD$pHD$xHDŽ$HDŽ$HDŽ$HDŽ$L$tH<$uAL?I{ HeI`vtMwhI>?ftt6IGpH=AX$rIpH<$HD$pLt$XD$ HD$(IwhI`LD$XtTcqmtx L v AOcMAIPuHEH:5IPH[ |$ pL5DIHI_`MuIP I.HDŽ$I6HDŽ$H9EoIWhH)LH$LHL$HqIHwIPH=n t$5HHpL$I> $IH|$SfDo$EG`H$AH $k L$H$LHt$ ,$L$H$$ A HDŽ$HDŽ$tL$LLHH$$ LD$xHL$pLLH$sEEsL$LLHH$$ MLHLLD$8< $sH|$8L1E1fDo$EH|$(HT$HD$@LT$8H<$H|$ Ht$8D$@$HT$HH$fo$H$$fo$)$)$rH|$LM$H$H$$?EwEMwxH5 o L5Hb|H5,o L5H}A Ay1H5NHuH58o L4HtAG AH5cNHkH5;o L4HkA$y1AH5Ӥ+NHhkH53o Lc4HkLkAA8y1AH5MHLjH5%o L%4HtIPu]H5Vo L4HHrIWPLHLH ` D$H$H$$E jIHH):IHH(HvqLLH H D$H$H$$D$H$fo$H$$fo$)$)$EiIuH9H H'sA`t8LH$D$H$H$$E#iA EW sEyAG A$yAG$AyAGIGI@}{LH=Mw@AL*5{LLH$D$ExIHu'IWHH pk LHD$EaIyH HpIuH eHyAH5QTKH3kH <IIu#ILH#D$EPnI11EIH7kH5AH2oH5 L11pL*GH h HRj HEILHD$EoIW`H&IuFILH$H [j D$H$H$$EfAgHT$`LT$h1HH$L$ LH=1HA/EXhH|$111H|$0HT$D$H4$LLL$D\$$H$Hl$L$H$fDo$D$fDo$DeDmHD$Hh[]A\A]A^A_IHמD!#IH͞D #IHŞD"IHD"Ht$(DHD$p"|$pqH4$DHDŽ$"$qHt$ DHDŽ$m"$qAH5s?HHrAH5i&HHrIuHILHLOH VSD$H$H$$E sAy,AH5"GIHGrAGIGH$1HT$PLLLHD$PH $L$H$$]sH|$PH:uHncIH d LHH$lD$E^sIH$9sIH f LH0D$E_sLH \d LHD$ALJ@ AALJALJAA~~ =ffAևAAI9FIGhH5c J11H$L$E1H$L$Ht$ qL8HT$pHHt$(I $fo$fo$L$H$$)$)$UcD$ FALJ6AG)AALJ H8H$H5t 1L3L@L H=q =LH=n =L$ H=jb =:L1H5` o@:L1H MH5_ R@L\H=Z 9=11H$L$E1L$L$LL$ H&7H5` HH<&feeegUipfFXtGVtWNtO v rfATIUHSHHVHsxH H<$hrHE LHC1U(S H L[]A\ff.@AVAUE1ATIUHSHH IL9+1LH L[]A\A]A^HSHLJ HU=<$qIff.fATIUSH0HHl$HqH=$1LH0L[]A\ff.ATUSH0L'H1HHMqH1&H0[]A\DAUIATIUSAQ~u1LIEZL[]A\A]HHLo"H~q@AUATIU1SHHHLl$ H9zq1LHHL[]A\A]fDAUATIUSHH(H-IHqH=1LH(L[]A\A]SHHHHqH[ÐAWHGI H I AVfHnfHnHAUfH:"fH:"ATUH-H SfHnHfH:"HH|$H=H fHn)$fH:")L$ )T$@)\$0qH$1 HLl$pL1!HL5,HI6gqIvH$NhqIvH$5OqIvH$6qIv H$qIv(H$qL|$PHHLod$XDd$P)$$EpI~pHHL1ol$XL1Dd$P),$5$t$ht$E]pDDD$ELL0&L$:L'IHu LMlHl$HHHD$@HlHH==HD$HH`lL=HLHD$PH/lHLzHD$XHkHH=]HD$`HkHHl$ HT$pLHt$xLDt$ oD$(EuHfDH|$H)$ H|$P H|$X H|$` H|$@ fo $Dt$ LL$(foT$ fo\$0A$A\$HĈ[]A\A]A^A_@AWH w L  AVL 7 LP fHnAUfInfInHATIH| fInUfHnH-:fH:"SHH5 fH:"fHnfH:"fH:"fH:"fH:"HHQI<$H|$PH=X fHn) $fH:")T$ )\$0)d$@)$)t$`)|$punL$ 1@LMt$ /L\ HjLL$ /t_L$I$HuL$1@LI,$LHtL$0HLL$ tLH$ ` 1H@!LH6 uL$QHwX HLt D$QEtH5(T HIHmsHH$HHX HL D$QEgtH5S HGIHlL$A@1HQ1@LBIt$(H:LLIsLHW L $QlL $q1H=HH$ qLHsH $HLHHL$+ $Q<$H|$74$}lHH"S L$Q\lHHS L$Q;lH npC(H[DC(E31@L{(Hs[rLZrHV LL_D$0DT$EorLL$@1H$LPH<$IT$(Hi1L@}LL`mH$HV LH|$ $L$lL H5Q LHlL$HLLD$@HD$XH|$XƄHD$0$Ht$0H|$@H$HkH<$LHD$0LT$0lH4$H|$ LLT$0D$H|$0D\$ |$lC,{,^D{,EB{(h{,hI|$]H{8E1HkHL{HHD$:LoA?/tLt$HjLLIH<$Ot>HD$ L\$ MIJ<IHFjHs8L= HjLLLLHL$LkLd$0H|MH|$ :LA<$/IfHLH|$fHD$ 8/fE$MELLLd$0PLLEH4$L9Mt$I|$u!{(H{0f)ID$H;eI|$u!{,H{dID$HdH|$P1HD$PHHQ[]A\A]A^A_L$0H$LLD$EcLL6b?o/defgeJj(mfDUHSHHQH=oH HH1Z[]ff.AWAVAUI1ATIԺUSHMHDoL|$HǺHLHHA)oHD[]A\A]A^A_SHA1AHHHt$t HvozoHD$H[ff.@AWAVAUATEUHSHHHt$HT$ HL$(DD$HA-oAQD$D$<E1Ld$8HD$L|$HE1|$&11L3HnIIL9BL# oL$8MtLLL|3HnII)LLL\3HII)IL9t4BD#jnD$8Mu11L3Ht`ILT$MtL\$A1MHH[]A\A]A^A_I|$LmQHD$H|$mmmf.AUATUHSH(HT8t,=D# n=7#SnH(H[]A\A] H([]A\A]|ff.SHHHtAu1E1E1Pw3Ã?HAɀAODg낸AE1D(AwEuBAAAAA?A A?AˀAʀw>ADWHDOD_ERnD#AAnHA?DWHAɀD_ODOfHH1nD$%=HĘff.fATI1UQHVnHLH{HADZ]A\fDATUHQdnADZ]A\ff.USHHtu9t]9t 1H[]Ã=t|7n1|$|$xWƒn9t1ymHL$|$mHL$|$ЉrmPnATIE1ALHHT$fnLd$HLA\f.=Wnff.AUIATIUHHH7n8H+nLtLHLL]A\A]DAUMATIUHSH1H8H|$|$nHtHHt$HHnH;}1LH+H8L[]A\A]UH-SHQHuH nHn nZ[]ff.fSH H{[} ff.fUHSHRGt HhKt1H=e@Ɖ7DAt L yEDAt LzEt H t H 1t L}A8DAt LE DAt HDt1H=DAtE1LJEAE DAt1H5:E‰t1L @A9DAtE1HFEAD{clH5tElOlL[L[ X[]f=1ATIu1 ~lH=11Ҿ)l1LLA\ff.@AWAVAUAATUSHH<$T$ Hmt`=ImD|$ H,$MIAAEu@DLHLD$LD$HolI)HM1Hĸ[]A\A]A^A_LD$DLHHHHD$HD$LD$뤐ATIUSH0H~HF0n1LH0L[]A\f.AT11H=SQ\#n IHnHxHHHǀ H1H) HI$ID$AD$`d&HrHADŽ$I$8H{A'Hs0H$nLC It$HH{(Hs0M$uLc(Lc H{IDŽ$h IDŽ$ LZ[A\ fAUAATUSHQIHbH-H`XI\$ID$AD$ fAD$$ID$(AD$0ADŽ$IDŽ$fIT$pIDŽ$I$IDŽ$I$ADŽ$IDŽ$IDŽ$IDŽ$ADŽ$IDŽ$IDŽ$AD$8AD$HAD$XAD$hAD$xA$EulH}%Hh HsHHh I$I$It$HtL&LcH}ZL[]A\A]H9NH`LHPff.Ht8UHo SHHRHuHH7mǃX[]HHHPQf.HlÐAULPATIUHSHHpQ>mLhHXL[]A\A]Lff.S?mH1H m[( PGZÐSH(x[H+HXHH8PH`Hl[ÐS1HHPl1H{lH{ zlH{x]lHCC[H5@ff.@ATHsHpvIfHnfHnH yvfHnH5vfHnH=fHnHfH:"fH:"fH:"fHnfH:"L)$L WvfHnfo)$LYvfHnfLn)$LpfDofo)$HCvfDoHQvfI:"fI:"fI:"fM:"fDofo)$fL:"fDofo)$fL:"fDofo)$H vfDofoD)$H5fDofoD) $H=LufL:"D)$L uLvfL:"D)$pLHfL:"D)$`HfM:"fM:"D)$PfI:"fI:"fH:"D)$@fH:"H H5D)$0fDoH=9Lb)$ L {fDofo)$LfDofH:")$fH:"fH:"fM:")$fM:"fM:"fo)$LafDofo)$HqfDofo)$HtfDofoD)$H tfDofoD)$H5OfDoH=tD)$LtL TfM:"LffL:"fL:"D)$fL:"fL:"fH:"D)$pfI:"fI:"fI:"D)$`L,HMfoD)$PfDoHrtH UD)$@fDofDoH5[)$0H=lfI:"fH:")$ fH:"fL:"fL:")$fL:"Ltfo)$fDofDofo)$L tfDofo)$LfDofo)$LsfDoHD)$H&H GfM:"D)$H5PH=sfM:"D)$fM:"fM:"fL:"D)$fH:"fH:"fH:"D)$fH:"fofoD)$pLL /foD)$`fDoL6LWD)$PfDofDoHIs)$@HN)$0fI:"fI:")$ fI:"fM:"fL:"fL:"H sfDo)$fDoH=LfDo)$fDofDofo)$fofofo)$H5L7fL:"D)$L HLafL:"D)$LrHfL:"D)$HfM:"fM:"D)$fI:"fI:"fH:"D)$fH:"D)t$pH D)$fH:"D)|$`)L$P)T$@)\$0)d$ H=)D$XeH=DoH=0oH=foH= *oH=nH=mnH=qunH=H0Ht Htff.ATUHH=SHIHt&fH@ Hh@(HuI\$LL[]A\Hff.SHH=1HtHHX[ff.@UHOHHWHAHH H HAHgHGHtH}tH} tH]鞻ff.AT11UH=C HEHT$H1DHL$H$H=IHL]A\ff.@AWAVAUATUSARL=I0Ht 1HxtZH[]A\A]A^A_!tX[]A\A]A^A_DHfHnH9uLFHPHOIL IHHPLNH1AI LNfDATH=IH=efHnHZ`fHnfHnfH:"H H`H5fo5FfHnLA`fHnH=fH:"fH:"fH:"fI:")L$0)T$ )\$)$$)D$@)t$PHv11jHlHH!wHH/H=6E1L\$PvA HIHD$`HI I9uH=/]LpvH=T߱6vH=˱u1LH`LA\vQH=ȉ#HvH=HuvH=HZÐAVAUAATL%UH-w@SAEL9e5vLH2IcHMHH ut yAHaH=@H-3H@H@H;H H=L;H}uH5ǵH= ;x2rLEAuǀ []A\A]A^uuAVAUATUSHL/MuHHHvHfoH,QH dLNHW0LӇL $E1HOXL/HHGG H=(L8HI;LHsLHDž@ H9IMIJ6HuH3333333IT$L)H9tHk('IHtHLH]LH^tHE{LLH1tH[]A\A]A^I[f.H)II11L@HHIrLM9t)HvLHL@L@@Hp HHk(LH9|HfDAVHcIAUIATIUAPvH3tHH5GLHȦtHmFtL=IHsHH5_GL菦%tI.tLIHsHH5GLWsImAsZD]A\A]A^fATIUHHH(;HD$HsH|$SHt$HLsH|$H/sH(]A\ff.AUHWHATfHnfHnIUH fHnH5ZSfHnHfH:"fH:"fH:"fH:"H)L$)T$ )\$0)$ 8u#H=Z75sH=H/HE;u"H=:蹬 sLMI9u"H=9莬rLMI7u#H=87crL-IEH5u"H=L57rHH H4u"H=a3 \rHeH3H(2u#H=v11rH=H/HE<0u"H=/赫rLnMIQ.u"H=-芫qLMIf,u#H=+_qL-IEHz*u"H=)3qHH H(u"H='XqHyH3H&u#H=&ݪ-qH=~H/HE$u"H=&$豪qLMI"u"H=;"膪pLwMI!u#H=P [pL-IEHu"H=d/pHHH H+u"H=yTpH%H3H`u#H=٩)pH=H/HEu"H=譩oLMIu"H=肩oL[MIu#H= WoL-IEHu"H= +{oHTH Hu"H=UPoHH3Hu#H=jը%oH=H/HEPu"H= 詨nLMIe u"H= ~nLMI u#H= SnL-\IEHu"H='wnHH Hu"H=QLnH H3Hu#H=fѧ!nH=*H/HE,u"H=z襧mLvMIAu"H=zmL[MIVu#H=OmL-hIEHju"H=#smHlH Hu"H=HmHH3Hu#H=ͦmH=NH/HEu"H=衦lL2MIu"H=+vlL'MIu#H=@KlL-IEHu"H=TolHH Hu"H=iDlHH3H0u#H=~ɥlH=H/HEDu"H=蝥kLMIYu"H=rkL MInu#H=GkL-IEHu"H=kkHH Hu"H=@kHH3Hu#H=ŤkH=vH/HEu"H=虤jLMIu"H=#njLMI u#H=XCjL-4IEHu"H=lgjHHH H3u"H=]HH5s?L莈Im\]vHH]HH5GLXH+[\H=zuH5eH=~z xT`HuELd$IV8H5MLcH|$1L\$(M#HD$HĈ[]A\A]A^A_o\{[e\q[[\g[\L\X[fAVAUATUSHH^Lk(L'^LcHMl^L5I.HubLIHw^H{8H\Hs@HtLu]^Hs0HtLW^I^M[L]A\A]A^þ.HHt@^IF HH]HK81HATISQHH:,^I|$u$H+I$I\$HHID$LZ[A\ff.t ]fUHFH]HHHm]H]ÐAUIATQH=蜯H]fI@@(1LLID$H]LjLZA\A]ÐAUATUSAPH]IHHIHHH5 }HXz]LH5|H>`]L%H5|HL?]LH5k|H%]HLH5.|Ņ ]HH9CuHI}0I]0}Z[]A\A]L%HAff.AUIATIUH<H\HLHLrHm\H]A\A]ff.fSHHH;=\H{H\H5z蒝H\HPw\H[fAUIATIUSHQIC0p\LLHHH\H3HLk\HmS\H H;u1Z[]A\A]DAUIATIHUID$H@HHF\KHH?\LLHHAD]A\A]ff.fAUATUSQ P tcLPH1MeI9~I|HtHHZ[]A\A]ÁHu u1HH-7LH{HkHHCHEJL9uH=Vi{fHuH/uRfATIHUHnHH]HH5yL]Hm]H]A\DHG`0fSHHH;=]HC[DHAUIATIUH8F详HH]HH5ILx]HH58L臁^]Hm]1LL]A\A]ff.@HASH8辁9tHH:諁9uH=H˖HtX[9]ff.ATIHUQH]HLH|HmIuHXLZ]A\ATL%xSPpHILIH7H }/15LZ[A\ff.fHaH7H7AT4PL%JL Qq1RLHs7MH 0nЖXLZA\HqHqH$ H7ATH=:貿HcbyI9ID$z4ID$ kSID$( HID$0HHID$87ID$@(5ID$H ID$P践ID$XID$`ID$h?HaLA\ATH=ҾHaIHHID$H-@HID$ 赝ID$(覝ID$0̜HaLA\ff.fHATIHUQqHgHLH HmAuHDZ]A\HGIILHLL!IL9uLHhIH4It0L!ff.@AT11UHQH=V9HhIHtHxH<bhLZ]A\ff.AT10HahI%ID$HDhLA\ÐFfDATUHH=#qSHHjHc\IHcPID$HcTID$ HcXID$(1`ID$0@1lID$8@1HID$@@z1ID$H@cHcdID$PRHcLID$XAHchID$`0ID$hiHcID$pHcID$x貉HcI$I$HHc8I$HfiL[]A\fATUH-FjHH=OjuH5Hv\iHvHHH=v3莉HOiHEH=e3uHiHE Ld$LqPhLHc蔸HhHE(HH]A\h@UHiH5H`iH5HAEh]ff.fAUATUSH(<7OiHIAՉ蜛H96iHL$HT$EAHt$L/iH|$Ht$?H|$I貦H(L[]A\A]@ATUHV iY]A\CfDAUIATIHUH蹠HhjHLHHLHmQjH]A\A]AWIAVIAUIATUHHH=OqH H}H;=)jHgIHJjHLL-,jLH誀:jI|$8u1I|$ HHDHHi賗ID$ HtLL1gHHtoH=pLHHmgiH]A\A]A^A_lHepH~iID$ H/h^\i>iRiff.SHHH;=fiHC[DATUSHiH~HHiHIHXHjH}@t4H}@HsH9w~I$L[]A\H5knyi1HE@HuiQHOxiH;wiHH4H>Ho1Zff.fHOHH AHHILkID (ÿHiff.fAWAVAUATUSQHHXL=0LHZ~iL5mL~iL%Lv~iH=-IHjiH٣H*H52HHvAiHH5.Hrv#iH H5HTviH5H5.H6vhHH5x.HvhH1H5_.HuhH[H5MHuhH H5BvHuohH'H5ЉHuQhHiH5-Hu3hHüH5-HduhHMH5y<HFugH_H5-H(ugLH5-HugHoH5=#HtgHQH5a-HtgHH5M-HtegHH55HtGgHH5\oHxt)gLH5DH^tgH'H5ZqH@tfHIH5\H"tfH H5,HtfHռH5uHsfHH5 HsyfHH5U,Hs[fHüH56HHs=fH]H55HnsfH/H5pmHPsfHH5H2seLH5+Hse1X@螀H5+HHHreH+eZL[]A\A]A^A_AUH'dHATfHnfHnIUH yfH:"HSfH:"H()L$)$襟HJeHH5+HHHPrKeH5HHH5*/r*eH=иH5*HHr eLH5*HIqdL ֶH5*HIqdLžH5*HIqdL,H5*HIqdL-H5*HIUhqcdHH5EHHGqBdH H5S*HH&q!dHOH5F*HHqdH L-HI}69HH5*HIUpcH3L->HI}9HH5,HIUpcH=H5)HHzpucLH5)HIYpTcL H5)HI8p3cLɼH5)HIpcL(H5)HIobHH5r)HHobHH5c)HHobH H5Q)HHobH H5<)HHrombH5HHH5&)QoLbL-RH5+HIU/o*bH=H5(HHo bL/H5(HInaL ~H5(HInaLH5(HInaLTH5(HInaH3H5(HHindaHrH5~(HHHnCaHH5s(HH'n"aH H5a(HHnaH5wHHH5J(m`L-fH5B(HIUm`H=|H5.(HHm`LH5(HIm|`L ڴH5 (HI`m[`LH5'HI?m:`LpH5'HIm`HoH5Q(HHl_HޱH5'HHl_HH5'HHl_H H5w'HHl_H5HHH5j'ylt_L-"H5]'HIUWlR_H=H5J'HH6l1_LH57'HIl_L VH5$'HIk^L-H5'HIk^L$H5&HIk^HH5&HHk^HҳH5&HHpkk^HH5&HHOkJ^H H5&HH.k)^H5HHH5& k^L-NH5&HIUj]H=H5&HHj]LH5&HIj]L ʷH5y&HIj]LH5j&HIgjb]LȷH5[&HIFjA]HH5M&HH%j ]HH5=&HHj\H-H5,&HHi\H ̵H5&HHi\LH(L[]A\A]fATISHQH~P=H(H\1LLZ[A\fATI1UHH\HHH=%Hm\\HHp\HH=%Hm\N\1HH;\HH=9L$\HmW\1LHL]A\fUHHHQHXHJHyHHN\HHH]ihfAWH= AVAUATUSQ脳Hb\I1HHE\H8IHD\H6LpH$H5 H;M}1IL5 H;LI]1LIGHH8M}1LH HCH9qI]1LH=IGH?UIU1HC H<a[HHuLmH}uHEHH}uH=6UFuHEH)[HUHEH5#LHexNHUH5#LHeZHUH5#LHexZL[]A\A]A^A_ZZZff.ATAUHRHIlZXDH]A\f1H8DH HXHZHBHp ff.ATIHUHH;HZHHu*H{IHLLH1]A\PHHD$蓌IH9ZH8Ht$fAUIATIUHHHH;= ZHrZL蜒HH3ZHLUeUZHmZH]A\A]ATHH5|I\LA\fDAVHG IH =AUHIfHnATfHnfHnH=!UfHnL<HSfHnH!L !fHnL%!fH:"fH:"fH:"fH:"LH`fI:"fI:"d)L$P)T$@)\$0)d$ )l$)$耕vY|ZL|IHCZHEXH}PH55HDH0HYH;HHYYHH= eY1ILLH%H5!riHYH(XHmX1LH`L[]A\A]A^UH6HYHHHmYH]ÐAVAUATIUSHYHxH ZXHHcwHHYHH9EkYYL+HHtALHhIHWYHmuH=I,$Y[]A\A]A^(Yff.fATSQHt(HXHL HuII4$HuE1LZ[A\@ATH@H|$HH|$ 1H$HD$HD$(D$ԺHD$8IHt)H?H|$8IH/ulH|$(H?YH@LA\@1uSH~8H_HbH5$'HHI[HFHbHV H)H9bHH~ff.HHH@t#?HGx&HH9rIL#uHH9rH9ufATHdIH~8LvdLA\HBHLHH:I(fAUATUHcIHtKHL-q輍LHInbHu)~H,f6LLHHfL]A\A]UHH]Hff.AUHIATUHH9FHHetI1~HeMtI|$H;=geL]A\A]LpbIHeHLH膎|eI,$uefHISHXH`HtH@([HS[HBPAUIHHATQIHeH(eLIH|eLZA\A]f.HE1E11jjjjjH8PLc\$ LcT$Mpe1HMcjjt$Ht$HASt$HjARPWHXfUHGHHx8tHD=HtHH1]H鞏HH?]AWAVAUATUSHhHgHHNIH9C2HvH~Ht$LBI|$IILLD$IHHD$@LT$E11H I9LM ~D$fH:")D$MH}HMHyHHH|$ 腊H|$ HID$ H9HT$8H5L迧H|$8HvfoL$Ht$@L)L$@輕H|$8IH/u試ML~HsH{P1s0E1E1Ljjjj范H0HHHI9hLT$HL$Ht$@LLHl$HLT$@Ll$P%HL$HHtLXAt HH9At}HTLTLTLTI9mHmHhH[]A\A]A^A_M\ISM>E1HH=eJHQH9vLK<wIHL-HL]IHHLLaIT$L酌H/ZI$D$ LH5*LHD$质HL$t驋HT$8HLLL$(LT$ L\$sLL$(ފH|$8HD$H LT$ HP1Ht$@LL$ LT$ H|$8LD$LL$ IH/uHD$(:L\$(LL$ LD$MjMSAMu3HL\$ LD$9L\$ HIxLD$1H9NIqLLLL$LD$(HL\$ mLL$Ht$ H.LT$(H HLL$ LT$}LL$ LT$H I.VLLL$+cLL$HI)uL5HwwH@1H7+ff.AWE1AVE1AUATIU1SHHWH9}UI\HCAIL @8MDIsLD$HE1E1B:<t?BLIIMAu]M\M9}EHLEHL[]A\A]A^A_1N<DD E8t0L9tDBLIIMAIIM9{HI9MԿEMA8AHE1H_mL,3E1LH)؃HtcHtPHt=Ht*HtH@8+H@8+H@8+H@8+H@8+H@8+t{HI9umMLcLA8,$tXH@8+tOI\$A8l$tCI\$A8l$t7I\$A8l$t+I\$A8l$tI\$A8l$tI\$I9a@8+uIM9OHI9=UHH<3I A:IL9wI @8+tHDELADHLLHHH D8LDHuMN3E8tsMtBL3IIAIxDHHDIKHxH)ImEHHDtIH;I)GMBTC8t Mu4M)Iu#DUL43H~ IE:tL9rBL3IIAuI)FIL9t$Mff.HHFH~ 2Hu 1HOHcxAUATIUSWHF~ oL-ԉ1LXsu(IUHcHH4Hu1YHc[]A\A]鬆IMH|ff.AUIH5gATUSWLW~HҾHHH IH_HH~IH/HHHH3HHrtHCHIHHxH5<H9tdru[LH[HSHPHHHLHHmZL[]A\A]Hmt)I$HmܽYL[L]A\A]yhͽ|ff.@ATIUHPYLHH]A\fH=7AWAVAUATUtFII1HIjHHt&H=7HTHmIuH|Mu1H]A\A]A^A_I8u]I tLLHHtHlHHtIw >ZuLHFŽqdt陽IGHtHHvHLL/nHmu銽f.AWAVAUATUSHqH=fHF}L5LFfH-8 HFOL= LiF8H= L- uH5LzbH=}ȉIH@H譏]E谒YHHƼH5L0=L`kH5{*HHoH|$HHH >H|$H H5;H HH2 =LLH5tHx <2LH5tLHV<LH5LHT o<HChH=I3dH HʻpHL[]A\A]A^A_鮻驻fHʚ;HHHt*fH*D$L$^ L$D$fH*T$ATUHHH~H;=[eH轁IHt0H^Hu#HLBHcH]A\e1ATUHSHHsH{8IHyH[HHu01[]A\H} u耕HE HHCHK81HNj tʃt%/HS|$@ڸ 1LH`L[]A\A]A^fU1HHl$H71HP1H9H]AVAUAATUH1SHH ILN@cDLHAuOHuH D[]A\A]A^HIH1Ht$HHSGjffH*D$YHH*L$XCfDAVA_pAֺA_pAUHATUHSHHL&I H9ݸIiʚ;LFE1ILL)H9߸LH}HD[]A\A]A^ff.@AUAATIUSHH(HH?۸Hu"LDHBAH(D[]A\A]H'Ht$HHHSiffH*D$YH*L$XCfAWAVAUIHATUSHH(HnH_H}HH5HI4`I,$HHCIH9HH5H4I.dHH{CIHHH5HM4߷I/>HH;CIHHH5H 4I,$ָHHBIHxHH5+H3^I.HHBIH8HH5H3I/~H9tcHu:H=&1et(H~&X[]7FH&HuYH=m&H HhTvATHUQH-yLX1XHt#H uHHLH1RHm8X]A\fff.ATH=gCIHt"EAD$ ID$ID$H-LA\fAU1ATUHHH5kSH(ILD$H$0H\$HSHH H yH9 $HLd$Ll$H;LLH<$u H;-t1H0IHtcH|$H4$fH@ @(HxHtcHL HpLLLILT$MuhLT$Mu^I@(MH0MuGLH(L[]A\A]LD$MnIH;-0tL H@uMH0Mu0LMA(fInfI:"J0AH(MZ0MtMC(MB0MA(ff.UHHHLD$1HMH5Z /H]ÐQ̹HwHZDQ*THǹH=#HйH9{-#HzKZff.@VSHHY5SHHHHHT$HDH{Ht$R-uC 1@8H[ff.AUH GrHIATfHnIUfH:"HSH8HD$ D$HD$)D$SHL$LLHEH1LL$LD$HLHt$HuFDd$H}Et%HxE1H9uAH8D[]A\A]H9t鏹H9HHEպH?yAHS㥛 H9~)fDHcHiʚ;DAWAVAUE1ATUHSHQHfHzA11HI[fAąuMuA.ZD[]A\A]A^A_qTHLIfLASOLML,fDtLuHy HHHHD7HHÅtHyHH)HAHHHyHH)HHHHHHIIIIIHH9|uHHHH@tI@HxI@fATAUHHHGHH`Ht HcHHuHDH]A\/Ht$H;"oHt$tH]A\H(Off.@S HHyHHsC H[AUIATQHF~ BLuIHtxL%pI$LZA\A]'fAVAUATIUHnHLVHHIBMH>LmIUA} [IuDL5rIt$HuHH+ID$LLL蕡H]A\A]A^"ATHFI9~ nLxHt%HxH7fn@A\f8f~Hcn;JfQH2HGZ@HH=l@ATUH1Q0Hfo vfH@ I@H@@ID$(IDŽ$AL$0HtHLruLZ]A\I,$LE1off.AVHBAUATIUSHHH&L.HHnHaH;-FqtIHU ;LFOHHHr'HCHH tlI9M1LH5MIH=9RRxiI}PH LHLYIMtDI.L%pI$MHL[]A\A]A^eHHHkjE1H5nH\$LIHHsHt$H5Q胀IHtHClLIHL5bIH<$FL%oLsL9jM9LDGHEIHVHMd鍽@UIH΃u4E~}HYHH @:0tdHH9wH]Åcu^LE~M]#u7DL]+HHHtHH)]H)]ÉL]WIH]]ffDSIHHH47H8t.HH9rH[Lz+HHHtHH)[H)[Ð~ fAWAVAUATUSQH= nnHHID H5LH<^H4hHgH-oH5}H=lLH 1HX2HCHHHHL9!H jH5LHH!߼L-%gL)ȼIELH5^VL L=okLw)ILH55VL vH-lHB)]HEHH5TLs L-uH=REIH6H-jH}uH= EHEH L-zhI}uH="_EIEHL=#dI?uH=t9EIHL5dI>uH=VEIHH-9lH}uH=uHDHEH^L-rcI}uH=DIEH2L={dI?uH=DIHL5iI>uH=|DIHH-acH}uH=TVDHEHL-BkI}uH=/DIEHL=fI?uH= DIH\L5aI>uH=GCIH2H-IdH}uH=)CHEHL-iI}uH=>CIEHL=gI?uH=qCIHL5gI>uH=ALCIHH-eH}uH=&CHEHZL-iI}uH=FBIEH.L=hI?uH=\BIHL5gI>uH=9IBIHH-hH}uH=>ABHEHL-*dI}uH=\ gBIEHL=;dI?uH=ABIHt\L5 cI>u11SnIHt9H-TeH}u11D^HEHZL[]A\A]A^A_е˵Ƶ鼵鷵鲵魵騵飵鞵陵锵鏵銵酵逵{vqlgb]XSAUIATIHU]_HWHLLHô7]A\A]DIHIHHHH9HHBHtL L9HNH9|rL^L HBM9tMuiHN H9|PL^ HBM9tMuNHN0H9|5L^0HBM9tMu3HN@H9|HHHtL9uHH9}HH1IHII ÐATIUHSa;8t*HxHHt LՅuH{Ht [LH]A\1[]A\ff.ATUSHHuL%!Mt)I$L[]A\HH9CHH=b.IHtHX@H,H@HHH@H@@ H@8H@0PID$(HD(gf.AUMATIUHH;^ϴ]A\A]f.SHHH=^H/H{HvH[鵔DSHHcHCHH9t5HHHs0HH9uH0LC(HSMu3LS0Mu$fC(Hu[H/uAaHC[MB(LK0MH0UH1H1H=(H"H(!]UH7'H?HEH]H@ff.UHHu(H}Ht } u+H]`C7H}QfDATH=2DbHH5ZHI0LA\ff.@AWH=" AVAUATUSQaHI3tIHlH[L M=H2OHHHHH)Hc5YIHHkH-7HHYHHLL*Hu$!4HHLLqI/HmӲII,$HMILH5LvI.1H5Lc/`H5LG/DH5L+/(H5L/ H5dL.H5_L.ԱH5KL.H5:L.H5&L.1H5Lj.gH5LN.KH5L2./H5L.H5L-H5L-۰H5L-H5L-H5}L-H5hLn-k@H5ULR-OH5AL6-3H5}_L-1H5L- H5L,AH5L,Ư1H5L,H5L,H5Lx,uH5L\,YH5L@,=H5L$,!H5vL, H5dL+@H5PL+ͮH5=L+H5-L+H5L|+y1H5 Lc+`@H5LG+DAH5L++(BH5L+ CH5L*DH5L*ԭEH5L*FH5L*GH5L*HH5nLg*dIH5\LK*HJH5ML/*,KH5:L*LH5*L)MH5L)جNH5L)H5L)H5L)H5Lk)hH5LO)LH5L3)0@H5L)H5L(H5}L(ܫH5kL(H5ZL(H5LL(1H5?Lr(oH55LV(SH5/L:(7H5%L(H5L(H5L'H5 L'ǪH5L'1H5L'H5Ly'vH5L]'ZH5LA'>H5L%'"H5L 'H5qL&H5aL&ΩH5SL&H5>L&1H5-L&}H5Ld&aH5LH&EH5L,&)H5L& H5L%1H5L%بH5L%H5L%1H5L%H5Ln%kH5LR%OH5nL6%3H5^L%@H5ML$H5EL$ߧH56L$çH5(L$H5L$H5 Lr$oH5LV$S1H5L=$:H5L!$H5L$H5L#H5L#ʦH5L#H5L#H5~Ly#vH5tL]#ZH5dLA#>?H5WL%#"@H5IL #LH5;L"PH5.L"ΥTH5L"\H5L"`H5L}"zdH5La"^pH5LE"BtH5L)"&xH5L " |H5L!H5L!LH:H='LH~H=DLHiH=!iHLH5LHH7H=u dH=JH *H=H  YHHL SLLH=H=.H='MMPpMMXHnHL%L8H=L8HLHwXHhHlL5H=_L5XHAULL=H=L=WHHHH5\LHH5mNLHʚ;IHHˡ1]IHL5HH%1HHp HHHL EvHmrI^IHuLH5LL4H-LH5MHZH[]A\A]A^A_ /ff.@AWIAVIֺAUIH ATUSHAPg@raHVHILIcvHHH I7HL| Hm$II9uYL[L]LA\A]A^A_6fDH6H?CDAWAVAUATE1USHHHOHHD$H L9ILHL,7MuH3333333I|$H+|$H9Hk([HHzHLL55H,[HLHt$0L;Ht$(LKH LH5?LHD$1LL~L|$D$04HL$8D$@BLD$HD$P8LL$XD$`@LT$hD$pAL\$xDŽ$HH$DŽ$GL$DŽ$HDŽ$D$ @E,IHH|$HSI/IHW Mt"I{LHL${ZFMHĸL[]A\A]A^A_HD$YAWAVIAUE1ATUHSHHG HWHuH=KLAIH'L}M.L)HtLxELI$I$PHԞH]I$`HI\$MIvtILH3͞M$M$M$PfInM$I$fI:"M$@ML$PL5AD$`f8%MH]IT$pM$HI$AL$ 4P3HЃvHs8HIDD$l$`Lt$XLT$puL%HM'I$L\E6L+|$HHt$(H %L|$@IL|$8PAUHD$(PH|$8WLHT$XRH LD$hAPLL$8LD$@EH0t#LH|$([H|$ Q1l$`Lt$Xbl韚Rff.fQH=WtHCH5GH8? 1ZH=H(HuUv>YHt+P ։у @t@HxH/]]@L@HfA(]fDUHOHHWHAHH H HAHgHGH9H] UHSHAPHHFHt|HMHt~HH)H9HuHtWL[E1JLHJLIM9H}N1H9~(LLIMLHH;CwHHZ[]H5BH9suHHff.@SHH1H AH5H=RHCH[ff.AWAVIAUATUHHSH(HH\HJAH;LeH5@I|$H9C*Å4LSIHH-ImIܟILmIUA} IH5LxADžAMbL1:HHHp ADLL7H(H[]A\A]A^A_LyIPHA1LHD$PjjP@H HH#H}ÅA H5LExHmH1@bff.fAUATUHRHHIIQHH5LLH1]A\A]HHL$8LD$@LL$Ht7)D$P)L$`)T$p)$)$)$)$)$HL$ H$$HL$HD$0HD$Q1HQH@AH9GLGHtHHwLE1ZÐAU1ATUSQNHL-;I1ۉI|Ht4HHHLE6IHm\ZL[]A\A]fAUATIHUHSHQ/ޢHuH;5E@H;5[CHCHXuH;5AL-OuL-HH=;IMHHS1H7L Z[]A\A]ff.AVAUATIH=USHHH>dIŅ֢H=|HHtiH5]%HHmIMo1LLI.C 1LHL[]A\A]A^钢fDATUQGHHHZHmIuH=LZ]A\fAVIAUIATIUSDHHLALLHHmIuH5=[L]A\A]A^fUH9wr9HGH+G H~,wHWHO u@, HG 1H]Ãu%f,JH|$誰H|$yM,AUH=ATQJ>H*HI1H5L H5L H5L H5L H5L H5Ly =L-H5ΊL6.w H5XLH2 LH5h+LQHu LZA\A]'ff.AWAVAUATUH1SHxOL|$0HLHHiHHt$`HLl$& L7=Lt$XLHD$/Ht$`MIH͠L|$ LH\$Ls LkLL9}ID$Mt$ H9BI\$@AD$(Ml$0Il$8H []A\A]A^HHHhHIt$(Hӕ"fE1AL$EuH? H5DH\8A}bIMA@,MAM A@AD\$ DU1D $AAADME DUZHD$YL D$ LD$AxEMA1H1HHH(a W鿙f.ATHHWH;G HB`HtHHu3Hu~HsHRH5&E1H81HLA\IHHpH;5 tHVH=H1H H? toH|$rIHt7LL$Lf1H*MQI;IJ ]tE1Pff.HѺ3UHGWHMHUHAHH H HAHeH} HE$H}(HtHE(H/u HuH]L@AAT11SQAăۙAADZ[A\Ðkff.USV)H{H HYHc[]ff.AUATUSHH~HLVHIBMHIH/LoH5 I}H9''LIHHI,$IЙIHCH5HHHEH{HkiH5 LkxHHs eHCPH=cH9{TL L9MAEDC,1CH[]A\A]A `.fDSH1HHH01HtH;,H9u H(>H[ff.X@UHHxMHH8HH}xGHE8HmH}hHVhHEhH&HUxHEpHBHHHHHHHHt}HH trHH@tgHHt\HHtPHH tDHH t8HH t,HH t HH tHH@tHuHɾHHEH#I1ItH]ÉD$ D$ HAT1USHH01HHt4HFHHH2HmItMLc0L[]A\IHf1ɺ1 ff.AWAAVAUATUSHHDgL$ Hu]E1DLDILIS tLHH? ʈSMxXHL[]A\A]A^A_H~HH5$H9FuHIHim|$ sH5H>H[]A\A]A^A_XAUIATUSHQnHt.HHIHBHm*ZL[]A\A]IDATII$LA\H(HuHT$H0~H|$:H|$H/KH(H;H5܎H:<IQHAxH8H5Ǝ 1ZAVAUATIUHSHH HD$HH~I<$Ht${Ll$.IŗH{8{,tBH{:It111LbH|$HH/uHH;-gȖLMAϖMH|$IE1HEI~H~L~HCpH{hH(H{h1{ HD$HCpHCPE1HtH+C@IM9L10HD$HHh M)E1{$tHoHH(HCPM~KHHHL!Ht0Jt5H6HLHII)IHCPfC@M~DLSxL9SP}:H2HtdLXItAHs@J|5Hs8L9LLk@Ld$LCxLHIIHPHu#H|$LtH|$E1;}PMHs@HHs8LM)Ls@HmHt|H(cH|$HH|$IE1HHLE1H{@H)IH{8HiHD$IHHk@E1H|$E11E1zHr HHH1Ҩt DDtD fD Ht DDHC@II)\髒yfDff.AUATUSHIqA|$1I}A|$Ht$H[LAH\$@HHH9H?HHH)H9HH1Ll$1HD$HLD$H9HA|$It( H)HtH0HHD$H9h~H|$HHD$HĨ[]A\A]û mfDAWAVAAUIATUHSHH9HF6IHLDHLIċD$ LH?|$ u^HL[]A\A]A^A_Ät_DH11H01-ff.fATUSHH HD$+Hh17HHCp{(HCpH{hH1HH01蟼H{h1H tHCpHHmH ]H{11H1UH{8IHt 贻HC8H|$H HCpH{h H L[]A\HHփHHeH(*LL%I$ѓgUHnH HH0>HHHHmcH]f~HH1H01_ff.@ATH57HHT$IH|$A,xHDA\fATH1H55UH1H8H=AlIE@t&H'}u%HxH8L]A\EJ\f.ATIUH(QxH1LH01}HT$Ht$H|$HHLH56HT$Ht$H|$A E HHmHMHH(]A\fATUHHH|$Ht$HT$HuHH]A\HFHXHHUXHHM`HuhfHHEhHT$8HT$HL$0HL$Ht$(Ht$EXnLd$MH|$H/wHL$(HT$0HHt$8nLd$0Ht$LHL$(LHHt$8 6HL$HT$HHt$ff.@ATUSDgE'GcDH(HH1[]A\ÐUHG(s $HMHUHAHH H HAHeHHEEؒH}HtHEH/uH}8Hu8H}hHt HEhHHHuH]L@AjHE8AWAVAUATUHHSHHIHZHHIHH}Ht$Lm:SH}HWHt$IH(H/H;D$HLEMIxL5SL$L9LnH<$D$ it$ $LHL} MIL9_LOLƃ}AH^$fo D$,Hl$)L$0D$($EGAH5LLcEt4H5LH5ЁLAwL藵|Ld$(LLD$ LHH5XcHHEBT0ELH$H|$ I藢Hm0HĈL[]A\A]A^A_LyII_PHA1L8HD$HPjjH HH1L}(MIt$ L9LmuLmt$ Aut$ t$ HH@H]0H{L9t$ LАHt$ yt$ HQ$L5H|$(A$A1A<$IHHLDHIHHiLHT$(IDHͶHIB6霏鏏ff.AVAUIU1SHHLwL9}GH|H9uIDH[]A]A^HGtHHT$HT$H1f.AWAVAUATIUS1HLOHcI Ht 9A\$ IHt8sHcI,$H,$HA+\$ HcwIH:IcT$ MD$1Lt$M<9~/IL%7AL$0H[]A\A]A^A_Ã!:HID$HuID$HID$AE1IH$HD9~KDA|A$Ƒp@11L4MHOA9ND9DNfnfA:"fAD$$ ;wHH|@hˑAHrDH4$z$HEff.fHH1HLD$H H| tH|$H1DAUATIUSQH{HGHHHĒHE1KHHHMH} E HU@ j@YH}01AHI,$AZD[]A\A]ff.UHHGH;@t>HHt\H:tVwHHI1H1HmH]G(LGA@HHw8L]H HP1H5RH9Z1fDATUHQdHHp HIgLZ]A\UHHH5]/ff.@QH=psHtOHwL@Hp@H@HAH@(HyfHnI H7fI:"@HqZff.fAVAUATUQD%ɞEtAZD]A\A]A^H-cH˪x1L5VIHߐHH5DLŐLH5yDLImH=o11HHHHb11QH5HDCH=yxHqH"H5iH CH=yIH:HH5:HBH=`yHHH5 HBH=HAH=xNHHH5HAH=xHHH5H@H=exHHH5H]@H=?xHrHkH5H&@H=xH;HH={wH_HH5Hc>H=GwH(HQH5hH>H=!wxHH"H59H=H=SIHHH5 Hf=H=vHHH5ۜH=H=vHLHH5H<H=uvHHfH5}H<H=LvHޛH7H5NH:<H=!v^HHH5H<H=u/HpHH5H;H=uH9HH5H};H=uHH{H5HF;H=uH˚HLH5cH;H=usHHH5411H=8uLHeHH5 11H=u%H6HH511H=tHHH=11HHܙHHH5,:'iH5H9H=tHH:H5H9H=htaHRH H5RH^9H=Ct2HHH5#H9H=tHHH5H8H=sHH~H5ŘH8H=sHvHOH5HR8H=yvH?H H5gH8H=ssGHHH58H7H=HsHїHH5 H7H="sHHH5ڗHF7H=rHcHdH5H7H=rH,H5H5|H6H=r\HHH5MH6H=r-HHH5Hb6H=arHHH5H6H=5H=qBHHH53H4H=qHtHH5H4H=qH=HH5ՕHa4H=[qHH_H5H"4H=6qHϔH0H5wH3H=ivWHHH5HH3H=p(HaHH5He3H=pH*HH=p11HHHH}11*lH5ۓH=vp11HHHB11ϘHH)H5H=;p11XHqHH11茘H]HH5UH=o11H&HH11IHHH5H=o11 HےHHy11HǕH`H5ϒH=oo11 HHH611×H|HH5H=5o11L HEHH11耗H1HH=T11H HHH11aH5ڑH1H=n HHtH5H0H=n H|HEH5|H0H=`nl HEHH=Jn11HI HHH11 H5H=An11 HHH11BH+HH5H=m11 HԒHHr11HHYH=11H HUHH311 "H51H=m11Q HʒHH11腕H֓HH5H=cm11 HHH11BHHH5H=l11 H4HHr11H@HYH5hH=l11 HHH/11輔HHH5%H=l11E HHH11yHHH5H=l11 HSHH116H_HH5H=k11 HHHf11HHMH5\H=k11| HHH#11谓HɑH H5H=Uk119 HrHH11mH~HH5֍H=k11H'HH11*H3HH5H=j11H܏HHZ11HHAH5PH=j11pHHH11褒HHH5 H=dj11-HFHH11aHRHH=1j11HHHH11B H5H=i11HLHHZ11HXHAH5HH=i11pHHH11褑H HH5H=|i11-HHH11aHHH5‹H=>i11HkHH11HwHxH=i11HHdHHR11AH5@H=h11pHYHH11褐HeHH5H=h11-HHH11aHHH5H=Oh11HÍHH11HώHxH5wH=h11HxHHN11ۏHH5H54H=g11dH-HH 11蘏H9HH5H=g11!HHH11UHHH5H=Qg11HHH11HHlH5kH=g11HLHHB11ώHXH)H5(H=f11XHHH11茎H HH5H=f11HHH11IHŒHH=oH'HHHHu11"dH=f11HH@HH>H5h'%H5H('H=eLHHH=1LH&H!HHH11uH=lHZ&HHsHHH5&.pH=DeH%HH$HHB111H= eH%H\HUHH11H=dH5%HHHH11qH=d11HH_HH11:|H5;H$H=`dHHMA8ff.AUATUHSQHH_ {$@9xIHthoLh8@8oKHS(HHC AD$XHtMHKHIT$`HLI$HS@s$LLIl$HEHEZL[]A\A]H1Hcff.S4H=HcHLKX\HcHLcHpH@MHu-Ã=uՃ/uи0ø.fATUHSHjAIcHHDPuA_tD[]A\HcjH;HcHDOff.fU1SHRH;H;CQX[]QHWHpHZfUHSVEHxxHHtHH{xHY[]3鼄ff.ATIUS褏HxHHH1Ht,DA H 4@tHH9uDHL|HIxL[]A\fAVAUATUSH G   @tfLg0HoHu^A,$JytHHc[]A\A]A^B{u@u։1sLgHE1HtcL9~vu#G4,Dxu Dt$IӃʆG4l҃tFA,$]DuDuHHH[]A\A]A^HtHA,$鑆AWAVAUATIUSHxfot~HD$`H|$HD$(HD$@DŽ$`HD$XD$HZD$E1IcHHk0Il$ HM1HD$0H1E1E1Ƀ't " LqH $LDL$T$ /H9YL $|$ LPD\$EA9Iv AQ9EEu\LL$蠤L$H11LLܬAHH l$1@t ELt$0MHl$@HH_HAE9l$~ \$uGHt$H|$@LHx[]A\A]A^A_ÅH|$LLHHUL\$Ht$(I;VjqAL$AT$P1LD$ EL$,A0ED$(H|$8%ZYHy1E1E1DBHOA3w>LxOcMAHEHAD uAEHt$~錆Aq98ETMqA91LPAD9AL H?uEt&LLƬH+EHL$(dAS1LE11LLL$@AQLL$4+uA^HXHLt$8MUHAHAD$Lt$01بt EHt$0Hl$@WE1ATLL$(KDH{AXAYH|$(%aH}1H|$(HsH|$(H|$HH1Hl$@1H|$L1H $HHl$@H<$`Hl$@vDAUATIUHH Hu:HtHLH]A\A] 11HT$HT$HHEu霆Ht,HT$ܾHHH}QHT$H}I4$HT$fHT$HIHuH}HHNHvzH9tuIE1IIBoCD IM9uII@t NO\Hu H9uTHEHEzJ(rM $DB,HL]A\A]1H ILHH9uHudHT$qHEHT$HEKhAVAUIATAUSHHf= ~if=#k2H[ LH{IHEt1HHL%IUHL1[]A\A]A^gff=QHD$Ls LI~HH{1LHLIUHt$HggIHL[]A\A]A^ËSH[ 1HLs`LIH"H{hLID$HH1LL-tE1E1D9~IcALk0LC IxaMtIv1?HD$HHh E1D9c~2IcHAHk0Hs LvLVLH.HhEH|$1HwH jH|$HH/uGH9H|$H\$Ht$I}!d IUH|$1 fILK LIyhIY`HD$HH׈E[1HLF鴈H=jHD$HHI}cIUH|$1{eI閈鑈_Zff.@ATIUS$HLHHH?HH 1H52HCHH(1[]A\f.HS8uH H;Ht 诏HH٭:uHŧH;Ht 舏H[ff.@fHnHfH:"HψH׾)$ƂHtfo $H@SfnfnHfA:"f:"LϾHflH)$~Htfo$HXP8H[ÅtBQ \MH=!HRH(91Z1SfAnfnfHnfA:"fH:"ӾHH f:"L$0H|$8)T$fl)$ɁHtfo\$fo$$XX`8H [fATUHHH$L$H$ײHLDŽ$(ϐH$HH]A\AVIAUIATAUHSHHc HAuHv1LbDe[]A\A]A^DfAu}HvL@@H^Df1HtQH;+}LHtLDLRHDfDfHvLD&pfHIHAH=B>LH $H8>HEL1Q 1!f.AVH=bAUATUS'HU= 0IvL-70H5L蘛sLH5qLH 0^L/贌1HgH/HHH5=HX_VgH/HHH5Z=H$_AH5F=Ly1H52=LxH5 =LxH5=LxfH5=HСH.HGL-0H0Mu3HcL.HHLLGHILLHIAtHAEHtHHcHtH HLHJH5B.HLHrLF0L;/.u4L.H=/0IL$0H/PH5?H5<LwLH5<Lw0H5;LewH5;LIwH5;L-wH5;LwH5;LvH5;Lv H5q;LvlH5];LvP H5H;Lv4H54;Liv H5;LMvH5 ;L1vH5:Lv H5:Lu H5:LuH5:LupH5:LuTH5:Lu8H5}:LmuH5g:LQuH5R:L5uH5yLuH5#:LtH5:LtH59LttH59LtXH59Lt<H59Lqt H59LUtH59L9tH59Lt蠧H5q9LHcsAH5[9LHcs1H5H9LsuyH5<9LsuaH539LsuIL-Þ1H=#9IuH)HHt!H5 9H[YxwH[L]A\A]A^H(fAnfnfHnfA:"H|$0f:"fH:"fl0)T$)$xHtfo\$fo$$X` H(ff.H1Ht H$HĨHAWAVAUIATUH.SHHH-HXH$mIHbHu H H)HIH%HD$HH5 HZIH~H<$Ht HX~LLL)IH~HH5H赞LEAuH1 IH~H=IL1IT$H5N:DILH|$1LHL[]A\A]A^A_HD$HEI~AVAUIATIUSFI4$HcVH'~I1۽A9]~0HcLHk0Iu HH}؃HI|[L]A\A]A^}1DUfAnfnSfA:"f:"flH}HH|$00)$PvHtfo$HhXP H[]ff.AVH' H5AUfHnIH ATfHnfHnH=UfHnfHnfHnSH- HL*H5fH:"fH:"fH:"fH:"fH:"H`fI:"H=%)L$@)T$P)\$0)d$ )l$)$mH|H苂HIH}HH55H5Um}I,$U}L5&HL@Hu9H=RIH}HLHT|I,$|L54HLHt H;<uAZA[IH|HH==3膱LH=~~I/d|HޠH8^StL3VLLx>_AXHH|HH=2HH=~~Hm{H EH9RtH5PL2VLxL>ZYHHk{H5UNHHHt'H4HHt ^H?JH+ {HH= azHH=?}Z}qzHmRz11E1fHnfH:")$wLILIfo $E}AEAMHĨL[]A\A]A^A_AWAVAUIATUHSHH{Hv $fH~8HHHW|HC KSDH\D@XPuH{ E1HHO0HLHZYIH|HS HH IH{HLK H4Iy8DF@D~DHD$H{LS 1HHHD$IR0{IT$It$uMCAWLl$DKUPH|$(gH H[]A\A]A^A_HƐIHA{LHNHC Hx8Er@EzDPH{HS 1HHH$H{zukMLDKAW11AVUH|$ gH aHKIHzH8HK HHHy8Dr@DzDHzHs 1HH$HHezDKuMLAW11AVAQDKH|$ nfH DAWAVAUATIUSHHXHT$VHL$LD$ LL$(Hv l{1M){f>P~\AI4$IcMIHh{I4$HcyMH$HO{{~xD$,1ME1D$(AMcK,@HHk f}Pu9}LU |$(mzLL0HzMcAKDAD9sMH\$LKA4$Lt$E~,AWHT$H|$ EN(DC_ZYHX[]A\A]A^A_11E1EfA|fA#AR0fSf5yH * Lп209uxuyHH@ uf8,yHxLLT$0HyLD$0HLHD$@LLD$8yHl$0Hl$8E1H\$8H\$@Hl$HL9l$([L\$0LH\$0H\$8Is H`ʊHHyIH|$0іHkyHcT$(H4$HDBD$(sH<$LLI9HtHL*xHuHN y0fSf91f5A@Ap|$,wLIr0LT$0HHxL\$0D@(DH,AKASVA7ō_AXHxIr0LAĉHH{xI1ΕH4$D$,IHcD$(D@LLDD$(o1HLݯH7xLT$HL$ AR(ifnfnfA:"J,l$0f:"Afl@ ff.VH=h;RxHt H=H;Y ff.AHEtH1HT$Ht$ۚH111˚ff.ATSQIHt.H@u!L*I,$HVxLIѓLZ[A\fAWIAVAUIHATUSHlIuHcIHt~MW IfA:1AOfAz0:DtA9}R1IcHk0LHplHL pHt"LcÃKDEOAAE9~ MW E1HL[]A\A]A^A_EZAkAIcHk0IJ f9 AD1D4A9}McLLT$Ik0Ir oHtHcLT$IDH} 19olHcH|$Hk0Hw ~RLFoHXHcH|$IDfnfnHLf:"f:"Hfl)$hHtfo$P8Hf.SfAnfHnfHnfH:"fH:"H0fnT$Hf:"D$@f:"T$PflHWvH|$XHL)D$ )L$)$ hHt'fo$$fol$fot$ HX(`hp8H0[fAWAVAAUIATUHSH8HF HT$ZIIW HHz8IHtIO HHHQ014WI_ HHs`LIH;Iw 1ɿf3W1LcMk0IfA::luHcHL\$ Hk0HD$HL$HHHH0I_ {LD$HFuHn H0D$u11E19~QLk0HM F fAfA#AfAfAfAHE1HD$8|$EIuIc\DIHEHD$0HD$HD$(D$@IE11HD$ DMME1HD$DMD$ D$DA9HcM] Hk0Lf tf hUD9}HcHk0fA<;|$@YtHL_HH~tD$9D$ _IcAI\UA9U|LcMk0MU fA: HtEMUFfED9sHcUHk0L>D9;f LT$HHD$HsEMT$HD9}HcM] Lk0fC< uUHcA9wLk0MfA9:VHk0A+f- fEMf/f#u;ELHHk0I4 -HD$ HJsUA9UEMEf:rfU'A6Lt$LL$0LD$8HL$@HT$(H|$HZYHX[]A\A]A^A_EM/LHL$HHcHk0LÀHrLcD$DLT$D$@HL$HEXKDD\$DIuHcdAHD$HarHD$0HD$(W9kqLcMk0F<fA fAuWLcIk0E1H9}9f#pf fAH0711E1jE111^_f hqf:YqLcIuMcL@HD$0H@HD$IuLf@HD$(H4^qE1D9}HcLk0K4f>:PpLD$(HL$0LLƒqEM$HcT$ H|$8DBH\DD$ Dd$E1NHc|$Iu?HD$8HOpLD$(HL$0LLFƒpEMIuHc?HD$H|pLcMk0M] fA; oUEMk2p-pIpop:pff.@AW1AVAUIATUSHHXiHD$HqH5L;`HD$ HpHHHp1L%G pLULIoH|$8HoHt$=yH|$8LD$H/nunI(uSpI,$uL豇\\HHHT$H5LuHL$HH\$HHoH|$ 6H6L511H=. HHoHH5L CHS t>HփdE11HHk0Hf>JtHMHLL[]A\A]~E1뵃~5fz02Hr0u)HPdIH`Hs Cfz`2Hr`tE1HE1f> vE1l~wH~ f02Hw0cHcHHO` `ff.HH5EH`HH9P_HÐSHH `H FEHt HX[DATIUHHt7HtFH1@eHH_HLrHmt H]A\1HD$ jnD$ 1HqkH@SfAnfnfHnfA:"fH:"H f:"L$0flH_H_Ӆ_H|$80)D$)$_DHtfo$fod$XX` H [~ff.UfAnfnSfA:"f:"flH_HH|$00)$CHtfo$HhXP H[]ff.AUATUSH1Hl|Hm_HhIHuHL[]A\A]H$Ll$H1LHHV;tHD$HpH>_H;5nHt$tLcy^H(fAnfnfHnfA:"H|$0f:"fH:"flH)T$)$BHtfo\$fo$$X`8H(ff.AVAUATIUHHH?Lu1LbHH1HH=RIH^LHbImIp^M.^LL]Hm<^I,$^H]A\A]A^1iHEHf]]ATfAnfnUfA:"SHf:"L$0flHT^^HH[^IH|$8H)$AHtfo$L`hHXP8H[]A\ff.@UfAnfnSfA:"f:"flHH^2^HH|$00)$AHtfo$HhXP H[]DUHHH;=i^H]EDfHnHHfH:")$@Htfo $HHfDAWHAVAUATUHo@SHLo(HGLwL9HA IH1LLfHLHB Hj(HB0BLL= H;HtL9tIH/uiHML9uAHĈ1[]A\A]A^A_ù 1HMfHj(HB HB0JLa*IwHHhDLGMtHGI(uLhUSHQHoH;-/ht H;-d\HCZ[]AWAVAAUIATUHSHHxH/iHiL$HD$HXH=HqHt$cH=L|$ 1L}|HD$PHW1xwHD$`IH\HEL$HHHl$ LD$h?HD$0H`\M8]DE MDEMLl$8Au LT$EXH4$DHDt$@HD$H@P\HT$0HHqHD$(Hp\H=MH5E11HL.zHsL6V\1LtSLINH|$(HtJHH|$0Ht;gH|$ H|$PH/ufH|$`H/ufHxL[]A\A]A^A_C[uHsL2[jH{D4U[D$DH[1LcHZHI9}JtL#m[H=CHHZH=]cCHtHZH=(BCH[HZkZZZff.AVAUIATIUHSHHLwL;5dt L;5aZHs(H{ HL$LtHD$HHHIUHMH[]A\A]A^ff.@USQH[HoH;-1cHZHCH8[Z[]ff.AWAVAUATUHSHH(SIH[HweI$vH(L[]A\A]A^A_LsMtI>tLE1pL HA1E1IcM2[IH9}M|EG8EuA?tAADD9|IDT$HtLDD$ LDD$t$L uLs뵅ZM_D$IH݉t$L\$DD$HD$HcT$HWZH8H9|"E8HDT$LDD$LsE|$VLL$ILH98tHH5H5HZL LLHZL H5HnZL H5HPZL H5H2ZL fH5HZL HtxH5HYL .t^H5HYL XH5HYL t&H55HYnXA $L D$pXfSHHH;=Q`XH{HtH52HuH^H5H8;g1[HPtH[@USHuH芺H[]XuHg@@كuFH_1LcHXL M9},J|HtT$ H4$%XH4$T$ fAVAUAATIU1SHlI H|HtDLίYHcHYHH9|Mu#HAllHX[D]A\A]A^Aff.@H[HHHH8AVAAUIATE1USH/HIc1HH9HkE1IcHHuH9}'HLHtHyDLvAH{HHkE1McE1HM9Hk E1McE1HupM9Hk(HH[01Lc1HuI9|[]A\A]A^HJ|HtDLN1/LMuL]HDLBYJ|HtDLA=JDHtHxDLtgAH}DL!qYHEsHtHtH~DLGYA;9Y4Y/Y*YAWIAVAUIATIUHH_Ht$LXHYH25XH|$YMYMuL%Q`rHHtqLH5uHxLLH5Hx6LHt$H MIHtHpHLtI/yXHmuH]H1]A\A]A^A_ff.AWAVMAUATAUSH8|$Ht$LL$USX|$u YjHl_H LAH57@LDD1HT$(RRRH|$(H5kH HHXH5?H3IHL!IHXHH5?LKX1H5S?L1jIHWH$I.XX|$fXL5[FXLt$I/*XImXH|$H!IHWH|$pH!IHWL<PMHAVHeH5|>1t$ APMH|$(jLMH IILMM+WImuL[I/WM,WH=DH-HD@ IHVHH5=LImVImUVH8L[]A\A]A^A_WHuPZDSW#ÅxE[ff.AWL~AVAUATUSHHhHnHsL]IInM/M IoHtH;-\n1MIMgMIFMwMtH5}\I9E1IBMG L\$MWL6YIxLD$LT$L9OZLGB$YH{@HYH{xHXHHXHHrXH{HHXHH'WHǃHǃHChHǃH AIH%VL1H5|1BWHHXHD$YH|$AH/XA,WD)HC(HaHpVHC(H(WL*HHFWHWHD$11H5}{\H|$HC(H/ WH{(HLWAVhHHHH5\VHHU1 $T$LI$H߈LcHHC fSXTLk LIEEhHHHTL'hHHHy AąTHmoTImH;-TAH;-EWAEu H;-Wu>HT$ H5?zLXOTH|$ HtLRL9_SHL1H5{1JUHD$(HH TH|$(H/SSH5[C_LHT$(C]H6@1AŅSH|$([Dk^HCp SCHhD[]A\A]A^A_H=#{%IHvSHUSHHt$(_#HHSH-H;D$(WSH{(HHHC(HSI~Ht$L$SLHt$("IHSH9-H;D$(SL$Ht$L(RLbIM\$L$LA1PLxHHD$8PjjTH IHSL$P$D$M(HT$IH9=RH =-RL V$eQH5VL%V21HCH=vyQ$IHR$E1D$LVI8)u I)tUH{(PtQoQ ReQSAUATUHHttcH]A\A]HHtHE1JT:tIL9EHt$4Ht$IHHHL]A\A]HHt$Ht$HIt&Hr3ImHt$IuLSHt$E1ff.@11W*QS< uS1Z< SW1SZf.ATUSHLg@Hu)HG@fGZG\HCPL1[]A\HHlHC@H{SUC[CZ}C\tH `S@`SHx0H{PH5ItDAUSHHuHH[A]ZSuXHHtT$ H4$ժ0SH4$T$ H{HtT$ H4$诪H4$T$ t2H{Hu땃R~sRff.AU1I1ATIH5uUSHHH OHRHHuHmRRu|H{8HRLL5HC8HH}R{ZtNK[H=O1H5(HURH{8HtHC8H/BRHC81H[]A\A]1ff.GRHPH1H01ff.@SE1HIcHtTH;H9}LTA:uA1[RHt1HcHtH H9}H|LGILD11fHgUSQHt)HHHQHkZ[]HRH8$eQsQff.ATIHUHBH_QHMt'HLH501WHm!QH]A\111HHfDAUIATUHPSHQ_IHiQH1H@t^ID$ HPQcID$HPID$ID$8LCMHPIEM,$I\$@HXHQDi A*GlmEl$H=*@H=EAD$LZH53E1E1HL[uID$ID$w%H=ELcIAHuLÿLTPAL$HD9}P1FLHHZP13LIH@PI|$1HHHmuHMImuLM PZL[]A\A]Hm1%HUH9bHtL@wOHcHuPH]1LcHOLM9JtL4OH=t*HHN ONOAT1I1UHH5[]A\HpHtLuzYHrHtLٶukYHLŶubYL$u4YW"YY@USHH2YH1HcH;}HTHrHuH[]H|$KH|$uXff.fXHCH1H01Off.@HT@ATUHSHH6HHsHtHHsHulHCHuHs(AHu.D[]A\HMH0HĽCXHUJH HMH6H螽XHMIH@H$uXTWW@ATUSHWIH1HcH;}#HtIL$LH6)t ո[]A\fDU1H0HH^)H='HWH=HWH1D8H0]ff.ATIH=OOCHgWH(W1LLA\f.ATUHSHuHv&W[]A\WuIHvHt LWHsHtH!WHsHtHɳuWWATH=CHU\@H5HIm6\ H5LQ\`H5L5[H5L[H5L[H5L[H5}L[1H5mLu[1H5]L\[1H5MLzC[H59L^'[H5%LB [H5L&ZH5L ZH5LZH5LZ@H5LZH5LcZH5L~GZH5Lb+Z@H5rLFZ8H5^L*Y H5JLYH56LYH5"LYH5LYH5LgYH5LKYH5Lf/YH5LJYH5L.XH5LXH5LXH5yLX H5iLXH5[LkXH5ILOXH59Lj3XH5*LNXH5L2W H5LW1H5L WH5L WH5L WH5L rWH5L VWH5Lq :WH5LU WH5lL9 WH5YL V H5FL VLA\IIHtH1HH9VH=6LL%:f.HHH}VHtV;UHHH;H9FuHVHt HH]HHt$,Ht$HHuH]H(HHHEVff.ATIUHSHHHt HՅuHH V1[]A\f.ATIUHSH HHt HӅH}(Ht LӅH}0Ht LӅH}8HutH}@Ht LӅukH}xHurHHu[HHueH}HHt LӅu8HHt LӅu#H1HtLH[]A\LӅt[]A\LӅtLӅtLӅtDH(HHHt1ff.HHHHTff.SHBHHHHTHH;u H[$!H|$ITHsH|$H[_ff.@SHGTHH=7HtHH:L@HpH@HHAHXHyfHnI H7fI:"@Hq[UHOHHWHAHH H HAHgHGHH]SHHH;=6UH=8HtHH#:L@HpH@HHAHXHyfHnI H7fI:"@Hq[UHOHHWHAHH H HAHgHGH)H]AWAAVIAUIATUSHpH(DD$ &H6UHxHHLHHHǀhH)1pHD}H{EHEHUIELx(LmLIHTLE1'H$L94$~@LHVHJ8dtULidRHsLHvLRH5\L?0RaUL RHk?yff.ATSHQH=:0IHtHCLHID$HI\$CLZ[A\ff.@AWAVAUATL% U1SHQHcHt^HH9}ALlAMw+Ic4LI}~QI}1Z[]A\A]A^A_ø1MuE1IcMQML9I}W QI} FPI}5tPI}#PI} mPI}WYI}QI}0 QMLIyxPA1~P@UH7H}H]eDUSH,UHXHH(UHC8HHx ,HmTH[]f.AVAUIATUHSH1HEIILHLHfWHuHxLI3LAE=HH6WH#HHmuH0HH9Wy11HH AE[]A\A]A^fAPiHt HY1ZAWAVAUATUHDw,EugHG8IAHIHxHHHtLHLHmHtHx2HDL]A\A]A^A_WHHD$*/HT$AHD]A\A]A^A_ff.HLRL L11'E\H1L HHAADHLL)LHyщfAWIAVIAUIATI)IUSHHI0L9LiLH[]A\A]A^A_LVIO\MtA;uIM9HMFLItZHL9|LY0HHZHPINHHtHH~HHzL9|HLMZHmuH-L꾜L-IFLHtuZIVLHt\YHff.UHHH}H} H}(H]O-ff.@AWAVIAUATAUSHH(L$DD$HtlH.HD$E1E1I9}(NDA8tNLLdYIIH|$uwLDLH([]A\A]A^A_1Mt't$LLLD$YHD$LD$IpL3XHD$E1{MuHT$t$L7|t$LLXHD$ff.UfHnSfH:"HHXH-n(H)$H} ^HHHtfo $H@ HX(HH[]fATUSHHHurH.H8,#H-M-HHP IHujH&H:uH .H9t ,HEIHL[]A\CHHjCHmWhrHsH;53)WH;5-HyH=yHDI,$WLR+HE1I8/zff.@HGHtL@HMt HcPhyE1LHH Hq0|"HuM@IfDAWHHHAVAUATUSHH=(-HWIH*+HXWID$`HL[]A\A]A^A_f.QHHHH=,HtH@`H@h@pZff.ff.QHYYH(HZHH&H9GeY6fDH-G  AWAAVAUDjATMcIUSHG HNJff.@USHRo(H8HC@HhHx>HPH5YH<+)H{@HHC8cLHK8HqhHt H6HC8X[]DAVIAUL,ATN$UHSH2LHH?HLH}Hu []A\A]A^I^LLH[]A\A]A^Zf.ATUHSLghMt0LHHuI|$HtI$LHtIH}HtHEH/KH}HtHEH/fKH}HtHEH/H} HtHE H/uH}(HtHE(H/uH}0HtHE0H/uH}@HtHE@H/uH}8HtHE8H/uH}HHtHEHH/J[H]A\gCfHJHH9GJHJDHHHBL HLIHHMuLVMZL^HwHVHWI:H>ff.@SHH]JLGIXhHJH{(|JHFJHC(H1[QZHtHZff.@HG(HJff.AWAVIAUIATIUHSHHFPLxHtRMuSLHIJLH6JLHH[]A\A]A^A_Lnp1L9}aIL$PHLLLL $nL$Hu8D$ uXH~8L$oH<$XJHcоH9JHLfHI)JH~@LL$nH<$fUHSQHaHHEHxQH1HhJZ[]AWIHAVAUATUHSH8HL"HtLm1L9D$HD$Lc1Lt$ L9}5HL9H|$HL臩IH|$IHH|$|$ MuDHT$ LLoH8[]A\A]A^A_HTH:HB1HcHrIH}H9}L\LIs]IL3IHDIE1M9}NLMIOTILLͻ II.uLHT$ LLL@@)E1E1sM4H|$H|$?11E1M9|jHHa1H۾L+MHqH|$LԧIHHD$H|$E1CNdI<$HIt$L蓧HH1ITD$HT$L&GH|$(LfLHL$fGHD$HL$H|$(4HLfL3xGHD$1ҾfLQGLLHLH)5GHHھLGLLHLH)^FHSff.fAUATIUHHLnL;-6 t L;-FH aHcHLEM9D$u9ML$0ItLU0ItM9uHHL]A\A]#L]M9\$|HAHH]A\A]LHSIHeFHI,$=FJF@H]@A\A]HuI9t$~HHL]A\A]H5LT$ dT$ H5! LIT$ H> H@ff.fAWJAVAUIATUHSH8HF(H~ LfL~L$ HD$H^H|$H5N8L$$LH HD$HqE1IH^EIt$HH^EI4$LHGEIt$H@It$LHaMD$(MBH=HT$H5LH+IVH0I.uL DD$$T$ LLHhD} DH.HHuH5HHDMl$MlI}HE8I $E1HxPHAMd$LpX1MHp`E1McH"DHI9}JtHhFDAH]LM8HHMiIEuHCHT$LHHImH+E1E1H|$u#M9|zH8LH[]A\A]A^A_LT$ME1HT$McH2I9} H|$JtHd0CAHICLT$MZAC D$$HUBIS1HVHH6LHBIPHI0LHzBLHT$I.LT$IuLHD$( LL$(LT$LT$(MQBLHLL$蝴L\$vBI+HT$(t:HxtkHL$ZI4$L8 UL1LHT$ HT$H=KHlHAH AAAf.AUATIUHSH(LnL;- HD$t L;-uqID$Ll$H\$H9EHu(H} LH蕦t+HL$LHQH1uAuH H H7 HH([]A\A]H5y L1xH5LaH=K LәIHAHH I,$uLHD$ HD$H HvAWAVAUIATE1USHHHn0HuHkHujHL[]A\A]A^A_H}~1HtLO@AIcH;E|HS0H@HfLMR@AHK E11H $HcH;u}uH<$LDLtMt]MM8I0IyH4HU@MHLHD$L\$I+?$@LL菞@MLMw]I/HuLlH?HLxw?H+uHBLLRt5IHD$VHT$HIP?H@HO!?@H HHXHJHNff.AUIATIU1SHQHc1HtHH9| Z[]A\A]HtLLHVH6t݃ff.@HuUHHHG>HHL$H<$H<$HL$tJHW8HH $HzHZHH>H<$H>Hm>H]|>ff.@HHHXHJHff.ATH)IUHHSHx"HIL$HPHH4L1I8HH:HLL1ILJHt{LT1ILRHthL\1ILZHtULd1 I$Lb HtAHl1(HEHj(Ht-HL10HHJ0HtI4HH4HH9uHX[]A\fDAWAVIAUAATIUHSHEgL]My=ILR}M@E@@@81L9ItLLLT$L$]=LT$L$HHUHtL MyMHL貚f CHcоkLjh;HھrLK;L-H:;H$H$I9;LMLKt;HmF|AA :H5e B HcѾkL׵:ALLsf:I|$8dHH:1H¾nL6:I|$8LGpIXH_pL ^:EtMd$8Ml$pImIl$p}1LnLu!:I|$8HH :I|$8IH9Hu1HL9HuDLL91HھnLZ9MT$8HuDLLMZpM{Mzp}9Mt$8IFpHXI^pff.AVAUATUSDg,EuNHG8HAI։Hxpx8HS8HHkHJpHQHDjLrt# LC8AltA[D]A\A]A^À MHpEdAǀlMQE\:fHcGxfHnfH:":HkPWxHFIH8HzHt?L1L9}5SHZD\LTA:t5A[vHL9|Ӹ[øAAA tJMRL;@L;  L; L;AD @HxH;=H;=~@ H;=qAD H;=[AD $ff.UHGHHx8tHD=HtHH1]HHH?]AAUIATMUHAw1HcH4(L98I)DK<$LLHL]A\A] AvLJ]A\A]H)H HHHHfDPZrfPZbfP*ZbfPZRfAWAVIAUIATUSH8H8I~8II~8HI~8HD$MIHIH|$IIHI1HھzLII~81LHGpLxLp IImE1IcHuIHUH9}HtL虺fIAоWL.KIIv8HT$1Lnxn'II}H!IH/H,$I~8E1LGpIXH_pH$HH\$L;<$|kXLHMN8L\$1I]MQpMZMYpLcE1HtL;M9Mv8IFpL`MfpH8[]A\A]A^A_IMJ\H{VLJlHS Hd/HHHHH{t`L,HHsL H kL!GHrLLH{I~8HHD$GLxGLcGI~8HT$1ɾLGpIPHWpWGH[E1IcH'FHJIHHc HH{YL[]A\þWrEtLYP5LD6QL/E;ERL 1ҾL:@@jWAAQu=LAA1'EuDWtDHS1ɾLIAAHFHcվuDL@@WxDHS1ɾLUDLAA7WL$DYLDHS1ɾLk@@L_CLJCHS1ɾLAALCC}CxCAVAUATIUHSӋufHv׋DHH#tfL[]A\A]A^w!uCGuDtXL H5<1I91븽=럽<LuCLoCCLG0G8Hw0Lsff.SHH8HtHS8HJpHAHBp[ff.wHFHc HHwHF1HsHf.AWAVAUIATUHHHFFE1H~tgH5&`LIHhF1HH1SI,$IuLMtMINELr]LA\A]A^A_IUH;st@H;u]LA\A]A^A_E1Hu11H5GH81Zff.HwHGH9KSHNHOH?HxHfDAWAVAUATUHSH(HF Ht$T$ IAVAA0AZHcHk0Iv >Huf:f|$ AED)ˉؙAHcJIHRIv D9vAFHHHk0H]IHRL1f|$ :NHw H<$HIHWRL $1Ayt;HULI`IH.RAD$AAAHMTIq HHD$Hv`bHHQH $HH$EH4$LD$uQLt$LLANUSEFu^_ Lp0IQff.fHnHfH:"HQH׾)$Htfo $H@AWHAVAUIATUSH8HFHHt8H:t2HwHz%RL=IH8L[]A\A]A^A_HHL$HL$HHQ HɶHD$HsQHt$1HD$HBQH\$H{QLc(1Lt$,HH\$IHLL衾D$,HADI/PH;\$|HH9QIHHI)L9oQHt$H|H|$Ht$H|$\QLD$L%ZIxJM`(AHmuHwH|$H\PIuHL$LHOHt$H>H|$HH>uH'HOL= ICI/yOHmuHLL$MLT$IMsOLE1fDH*AWAVAUATUSHXH|$H9PIHk1HIIHPHI?IHI9v# \tgHuHMHL9rHLL$HLD$D1L)1LIHtHD$HH\PL跛HXL[]A\A]A^A_H{E\HUL9OKPHHuHHI9v ;yHH1LT$H)IHO@ LT$H ԊT$ tOM^H@VOMFE1Hl$HLt$ LML|$(MMH\$0LL9|NL1Hl$MHLt$ MH\$0HIL|$(Hk HI.LLT$LT$||$u-TH1H|$8HH|$8H H y|$NT]ff.@SHÃO1@[@t@AVAUIATIUHHXHD$H9NIHFO1HHOLD$L4$1HIULHILL9LMI9INZH|$AtHHXD]A\A]A^Q:HPAH9PDZff.fAWIAVIAUIATIUSLHHwHHo(MLL)HLL)H9`PHLL$tX]IUH<$HEPIm(H)Jt%H|=L)1H~ LHs&ubHt E7DuuBH[]A\A]A^A_MH}LHLEILHLH)H +H)HH1EdfDdED]ElDlA}0LD$H $L $LT$IUMu2M)M(I4LL $xWH4$=O1I}tHIm(L)J|Jt%L $H4$LIu4WH$yOH-iH-ATHBUHSHHHUOHLe HL[]A\`OAU1IATA2USHHHH1HD$HOHX HH\$(H\$DHDd$8HD$H\$ aOHLNgHvHT$HtHt$H H|$H)Vx|$HD$u HH[]A\A]bOVO~2SH HH芯HC0HO1[1fDATH HHUSHfHnfH:"HpHOf)D$ HD$0D$HHD$PD$ L$8L$XH$PHPHPHl$ H?H讷t%t$ 1HLHHHpH[]A\OIE1HѺff.fSfAnfnfHnfA:"fH:"HHH f:"L$0H|$8)T$fl)$証Htfo\$fo$$ HXX`8H [QH=3H2OHRH!OZAUfHnfHnATfI:"IfH:"USH8)L$MOHH-fHn)D$ HfH:")$IHtjIfo\$ NHI9wL$IMIELA]IEHHNfod$fo,$1HLAe(Am8H8L[]A\A]AVAUATAUHSLn HLHS8ISHC HHp0HHSL]DK,DC(KSEtAu)ARLASyA[[[]A\A]A^ULAS¿A\A]WLASAXAYff.@SHWH1H01ff.@AWHAVAUATIUHS1H(QRSHA xRI4$HcLIHRE1D9H(L[]A\A]A^A_Ã}L} D$RI H<$Hw0LaHD$HuRMO LIHYRH$L\$I4$zHI{)L$I1HaIM!RAtJO\ICHp HHN 1fSfTRyHq H`Io E1HHHO f9StAyL$AQI4$IcIHQL$E1E9f}QMSEHm LLT$L\$LE L $Ip0H4QL $LT$}L\$KDtkI뜋O$W HD$H$DH\D@XPVH|$Ht$謿LD$L$ 1Ht$(HY^IHm UHy H`Hm H`f.HcPff.@UfHnSfH:"HHPHPLǾ HՉ)$覷Htfo $HhXH[]ff.V蚡PHHZDfAnfnfHnH(fA:"f:"fH:"flHPH|$00)D$)$Htfo$fod$ X` H(fATSHQHHt.LgL;%]I$PHPHI$LZ[A\H=IHP1HHCHufPfAWAVAUMATIUHSHH8LJ L$L|$pDD$ HD$(LEHD$ ML9&A|$MJ@<\u @pM@tL9vRAI<\u @HMʀKL9v)AI<\u @P%ML9wLMM96E1M)|$LLLLHIMAtPLML9vGA9}t>L\$HHAWAUL$T$LL$0LD$8QZYL\$.ME1LL+rOHt$(HALt$ MI<$LLLHHt(I|$H|$M~H|$xL<~FD$ q|$ uL9v A8<}IL9vA8}tE1Ht$(HXL[H띃|$ HuuJHH9gND$ H8[]A\A]A^A_MWI|$PMWI+MN>}D$ tH|LL1<"IyAH}M9Ht$(HCL3L9MABMJ t HI9uHH)AA8 AEMHL9vOAx MPL9v;Ax IHH9v'Ax II9sA8 XII9uADDLmH$LLL$HLLD$ wtHILdMpIoHcML\$ A9=dA9!ALI9\E1A9::}FH\$HIH;EL$,AL$LHH$6DAQEL$(ED$ȕLd$(I$ZYH1HH[]A\A]A^A_ID$ Hf8H@ HuHt$H}L@HuH9DEA=<<E1MiM.I9bEiIMEEAAaH$H}.L13Ll$I}#߀]:<)IFD@A(H$Hy-L13@8iA1E11UIMI9fo LH$0HDŽ$DŽ$0HH$($VLATD|$LL$L$HEGL\$N_AXH|$zH$LN!IHIH9H$HsrL12HUH9s8EtELIH EHگI,$HLEHDHD$}DHDH}8kD},H}舷HdD} tHuPHH1 HD$HCH}h1pCHT$HEPHHEpHr HHEpH}hIߟIt]ICL9~ H|$L蝮HD$H[]A\H?CH+u@HJH9HHN~DCbCCff.fAUE1HIATHA 1USHHXHH蔒H賔IHHH{1LH01 HHtvI,$uL6H;-'CH2HH2GHmIuHMCM9CMtHK0HtLHK0HXL[]A\A] ;[I,$uLIILGMt=HGHxI9@~IPH HHGHHHGHGI(t1PLM1ZfAT1IUSHHPHHHLӞPCCHnC{CCrCHT$H4$sH˹H.CHIH|$tHTHPL[]A\AWHAVAUATIHUSHffHnfH:"HH_CfLzHD$@D$XHD$`D$ )D$0L$HL$hHCHCIMCLl$0I<$L͖eCMD|$ HT$hAA1H5CfH=e(H|$PIALѡEx}L%mI$LLeHĈH[]A\A]A^A_I\$HBH{H5H9C9CH9Ń CI-BH=Ht$hH?kHv^B~BfAU1ATIHRUSHHhHl$HHEH;1HT!CH FI|EH{H;=ZEHwbEHt$qIHiEH轛H;D$fEIu[H|$Ht$ HL$LHt$HT$IHtHH=Ud1IH|$tHHhL[]A\A]H[H5H{H9E贫DHEHL$AH|$Ht$ IE^E1fDSfnfnHfA:"f:"LϾ0flH)$螙Htfo$HXP H[SfnfnHfA:"f:"LϾHflH)$NHtfo$HXP8H[UHDHGHbD D1]@UHH]>Aff.H=FH)'ATUQHuHXH`IH.FHѱ|$ ;ff.@AVHH=.AUfHnfHnATfH:"UHHHfH:"HHaBfHDŽ$DŽ$HDŽ$HD$@D$XHD$`D$ D$)$$$)D$0T$HT$hHBHBIHBL$H}L gBLd$0H}LSBIQBL$T$ LLA&ILەLӕHL]A\A]A^ÐAWEHHZAVL5LDAUAAǃATAAUHE ASAQEHDEɃHN8HW8EEH5Y1H=YAH{ t H}BH{BvIEAHu H{ -ALREAHHZ[]A\A]A^A_fATAUHSHH?kt!H{HtDHN[]A\ÐAVAUATAUHSHH?'CH{DHBLkE1Ic1MtIEH9|H{Hd[]A\A]A^I|HtDHtABff.f tHG$HHB sBAWAVAAUATIUSHH(HL$LD$HYB1E1SD94McHs Mk0IAf= tf= $AF92HHk0f<!AL$IcLk0LLHBL$Ht$LcMS H$A{JDM{ LIHA1LHLHD$AAW,EO(EGAOA4$R1Ht$H|$ IXZMAHD$ENN|D9K~IcHk0H{ f? uENEf#uH(D[]A\A]A^A_f:tIHWLL1A1Ir`LL\$ǪL\$HH$@@ff.SfAnfnfHnfA:"fH:"H f:"L$0flH@H|$8HH)$)D$Htfo$fod$ HXX`8H [SfnfnHfA:"f:"LϾHflH)$辋Htfo$HXP8H[SfnfnHfA:"f:"LϾ0flH)$nHtfo$HXP H[AVIAUIATIUHSHV LHcuHHk0Hf>#tILH?MIyLcLIk0It$ &H?HE[]A\A]A^ÃHLk0J4 H\?IHESfAnfnfHnfA:"fH:"H f:"L$0flH?H*?H|$80H)$)D$FHtfo$fod$ HXX` H [ff.UHSHQH6%>HsHu Z[]H$>AWMAVMAUIATUHSHH(HG> LaD$@LIt$HT$$S?IUL\$jLM>DK$DC 1HLL:g>A|$IM?IH1H=S1莀HT>IMHƺLHD$\,Ht$ >H.>I}OII4$L#>MMAaIMd$E1Mc1MtI$I9|dAMcL;]MutLL#1>ImEH=Dt$LAD EHH([]A\A]A^A_kKtLDL$O#Q=DL$AaLL.#y=IuNDLNII0LD$#_HEu91ҍufL^KLD$PHL$1ALL>$SL9LdMG8LIMpI}Et9MQ91LLL臕99I.I,$9L4$LIv@t9A~9DLztoL]tTt%9H[]A\A]A^A_LD$PHL$E11LL6 8L1W8888AWLcAVIAUIATUDSHHJDH8T$ xHL$ LD$(9uI~8IuI~8HD$uI~8HD$uHM'9H|$9H|$9H9|$ O|XIV8|LHBP1p\8IN8HLHqpLf]Lap1L&H8I7L>8IHjD$ PLcM;}Ht$ L>F8Dl$ LAIc[0I~8Ht$LGpIpHwpLOpLT$LqMQLWpL/7Mf8M\$pI[I\$pHH[]A\A]A^A_LHt$ L >7VL7LАNn7(]Ht$ L=G7Ht$(L=27L$ LHcZ7LAE1H\$8LLEMLD$0L9|$0EH\$8ID]HCHT$1HJt蒡6H2H6IIwL<6DLҏp6LD$(HL$ ALLP6M;}I~8-Ht$ L<(6T$ LHcY67755DAUI̓ATILMUjH8HH1H5H=裶8LLHHmIuHL]A\A]fAWAVAUATUHSHHhHG8xt!H8Hd`t4Hh[]A\A]A^A_H5\?HoAEuHC88Q*H8HtZAWHcAVIAUATUHSHQHFH8L|qH{8I qMy8IHm8I7H:Z81L⾏H@8H{8LHOpLiLLop98IwH&H臍0I~HcH7LL9u4Mv1LcM7MM9}/KtHa7҉LHWH5Hh7H{81LL_poxMcLgp^=7QH蹌(7RH褌7XH菌6H[8kxZ[]A\A]A^A_Hv96666f.AVAUIATIUHSHHtL5+HL˜H6LLHTIHt [L]A\A]A^wH̥H9r6E1fDUH'iH}!H} !H}(|!HEH]H@ff.USH896H61,HH6HXjHm66HD${`uO11H5H}H16H(6H{ 1H5m1VH|$H5H8[]H{ 11HH5 Hp5H(uX5HHfUSH56H5HH9G6HHt:A6S]H߈S_J7xLH{ H11[H5]錟1HHH5HiHm5y5z5DUHG`胵5HMHUEHAHH H HAHeHHE5HHuH]L@AfSHGH HtHC H/uiH{(HtHC(H/uMH{0HH{8HtHC8H/u$H{@HH{xHHH4HHH{HHtHCHH/t{HHtHǃH/u豟HHtHǃH/u菟1[HC0H/9t/HC@H/F`4S{HCxH/27(HǃH/3)UHHHtHEH/uH}HtHEH/3HEH]H@@AWAVAUATUSHH؟D$HXHZHLH81탻H hHL$7d57HHRH!H6HPD$w9H5̭HE9PH~u9|H-]}l8D$Hĸ[]A\A]A^A_Lt$ HHD$ Lb7t%H{HHt$ 0:7H|$ H/\71Pu=HHuHZ6tHH 276u PHHbIH6HH5!w1H==$J6LԬI/IuL胜MC6LByHt$HImt RLD$ED$57DAUATUSH(H?d8HGHH5SH(H`uKHHoH.8H+XHHPaH8HH([]A\A]H5H1tL$@HL4vRIHLh/HIEHcHt!HH)HHHdH[77fATH8IH5KjfSHH71LOA\fAWHA1AVH5AUATUHH=Y<SH4E9H=S<IH/8H5A<H赍IH7HVHH_IH8HDH=_1覌HH8H1HL萔IHtVI,$P7Im87I.8HmuHMt8I/A8HD[]A\A]A^A_mnHH9u6H|$ D$ Z Dd$ AQHHX]HHHuH cHPHuHSH0H9H=#^1AX韋ff.@HH HH9tHtHpHtHfDUHSHQHN9H~HuHݔH8tZ1[]N9f.USHPHoHG 7HkZ[]ÐHHWHAHH H HALOLFAM LOI8H~H7fDPZP1ZfDAUATUSH(HoHXHJP;HIH;l;HT$Ht$H|$H5YH>)H|$HthL-ЙL9t\LGA@t5H5nwnHH:;H|$H/u蝗H\$HL9tHot7fH|$HHT$H|$E|A,$H([]A\A]:SHFHhHtHǃh HHt*HXHtHǃXH/u1[@ff.AUATUSQH-De E[HSLXMl$IX H=HEALeA9tn迠DH誤EM萠cL|SɁDnjqfb薔A|bWiHlLbdh\dYtXH=H1ɎL!\L-ژ9P9H H9赩I}謩HT6CZD[]A\A]I` іff.UHH HOHWHt$HAHH H HT$HAHgHGH|$ڃHPHHT$Ht$H|$yHυHsHgHP[HXOH`CHh7H蛔HPH`HXHhH8HuH@H ]@UH=u裛HuhH8]H1H5uH1H;8H(>8Hm@8]HtsAVAUIATE1USHL9c []A\A]A^JDHPt;LhMt/LQHH7HL7HIVbH7HYhATUHH(LXH`H`DžXiho7H(]A\fAUH=tATUOH=tIOHMt>L;%t5LwAŅu&11H5tL}HF8H(M8E1Ht9H;-St0H1u$1H5sH1H|$IvHHOHD$(H1Ht$HT$(H~HI67m0IvIHu1_HHA0Lt~M9D$/LT$0L\$8HD$8LT$L|$(L\$L\$(I{H;=~|$ 1Ht^H|$(1HwIH0Ht$0H¿1xaIH0HHqw0L/Im0Ht$0HLe]0HT$Ht$LLNGH}I9D$0L'HT$HzPUIH/L|$IPI(IPP/Lo.]WH=ހIGHHMLyIMx_H}J4LF LnMpI>~I9tLcLL$I9APtI9AHtI|$(0LSI.uL0HmuH|$/H\$H{H6fDH~ATUSHX1HjH}@u/sLxHtHx HtH@ H/u&}HH}@HWH9~(HOL$I|$H;={tH5zet11DF.[]A\H(HF.~ .H;B|Ht$uHH|$UHD$H(.fDSH} .11ǃ 7ǃ [fPjZHcA@HHGHu&LGMtHGI(uL|1HH@XHtH|$H|$tfAP9HcHxY?1ZAWAVAUATUSHHLwMI8HcHm/ILvhIED$4HH@(LHT$(譄]/L=(YHtLLeI|蕍HHHLt/HmuHzHL9|ID$4~N)L&.LևL:HH[]A\A]A^A_HHH=>[]A\A]A^A_%?H5HLdy.q.l.@fAnfnfHnH(fA:"f:"fH:"flHV.Hp.H|$00)D$)$|PHtfo$fod$X` H(fUHOHHWHAHH H HAHgHGHiH}`HuH]L@Aff.SfnfnHfA:"f:"LϾHflH)$OHtfo$HXP8H[AWAVAUL-ATIUSHLwLHL9uHkHulHH I9 t'L?HtH8HtHH/uxHuH1[]A\A]A^A_HLH[]A\A]A^A_HS1Lz IHI(H9tAuAGuIOLH9HtHH/uHt$H!Xff.@SHXGH{0HtHC0H/p,H8H;u[SH H=St(H=EIH=9T>H)H=*Ht8>HH=uaH=tLH1H1辂uHsH9$u1H=D蟂H=X3HHH [1HiH=HH'HAuH=23H"bDRH=XIH=TBH=CHH=/%H=H+H=H(+XUSQ=6wt>*wHCHp{t;Hs1CWHðH9uH=vHtH/HvuZ[]qX[]ff.fff.@HH=r@AT1UH1SHH=CƁ*H{0LeMH{GH H}*HhH}xHtHExH/upHHtHDžH/upHHtHDžH/upH}8H)H}@HtHE@H/uupH}HHtHEHH/ *H}PHtHEPH/)H(HtHDž(H/upH}XHtHEXH/upH0HtHDž0H/uoH H)H@ HujHH HuFHP Hu"H{<)[]A\LcMd$]HDžP H/usoHDžH H/u[oHDž@ H/uCo{ff.USHQHGd8*HHHH)H{XHr)H{`H)H{hH)H{pHtHCpH/)H{xHk)HH((H{HfC8HT(H{PH+(HH(HH(HHu#X[]HǃH/"%nHǃH/uZ[]nLGMtHGI(u PLm1Z1fSHnHXHtFH9Cu@Hm:(H=7116!oHHǃH([@QHGHWH&@H=HuH=H(H/H(Z!mff.SHHHtHCH/ulH{Hu1[HCH/ulff.ff.{ff.ff.H=IHtH9H/'4f.ff.fAnfnfHnH(fA:"f:"fH:"flH'H|$0H)D$)$uBHtfo$fod$X`8H(fH=HuH/H|b'ff.fUSHQH HH9tH;HtHH/uzkH=qHtH/H]'X[]QHoH8HtHH/&HlH:HtHH/&Xff.fff.kff.H=H&HuP0SfnfnHfA:"f:"flHHX&LϾ0)$@Htfo$ HXP H[SHH(HtHǃ(H/u:jH0H &[Hp SHH?HtHH/%H{HtHCH/%H{HtHCH/%[ff.=Jo%ÐSHH+Hx0H[8H@8HtH@0H/ukiHHuH[fDff.RH=xHtH/HdD%X`QH=`H/%H=XH>%Xff.fAUATUSRH='HHG BIH%HP%Lh10IL$H{ %s @Hc HI9I,$uLJhH=k'^yH=_'HtH/HK'uhH=5'HtH/H!'x$L%I$ II9t=I<$HtI$H/ug@-$@JH=a?mOH=hLXMhIqJIIDžZJIDžX[]A\A]SHP HHHHtH{HtHCH/ugH[ffAnfnfHnH(fA:"f:"fH:"flHq#H|$00)D$)$%=Htfo$fod$ X` H(fAUATIUSHQHtHH95#HsHHkH55eH}H9tkWND#HwHH#HKHmI"I"1H[ LA$0Ht LhHHXZ[]A\A]""AUATUSRLgG$D/Ax3I\$1H{HteHCH(A9l$I(X[]A\A]f.SfnfnHfA:"f:"flHH"LϾ0)$;Htfo$HXP H[SHHpXHǃh[ATISHQH"HM$$H5cI|$H9]"LP"LeÃ!HeH5>H=HX1LbLx.~Mt Md$M1"I$LZ[A\"!!@?tSH[[fDUHSRH3eHuHutH{xHC HS H!H9"H}"HMH H;k(uH{ HC(!H{N:H}(H!XH[]vFHvfAWAVAUATUSQH~{H^HIIHH9Cu H9E1E1HrH10HH!HXLHHK8IHv!MHEMMtII}u]IELm HKHQ8tHEI,$ LeM L^H5E1I:f7QH HG HwHx3AtEHtDHr9TLHH IIM9u*ILbcH5I:sfILZDGH==cH5H?NfIAWAVAUIATUHSHHHH Htt6IH( M{8H{LuHOHE1IHuEH{LHOLI!LLHHL[]A\A]A^A_E1HtHIMt2Ll$HHCHLHpHJ LHo{HuH5?RLg>uHdSHZ]A\A]A^LLD>uH5 RL1>tff.AWAVAUIATUSH(HI9H1IHLeL5QM9H5UI9L=LL=HUHmuH-U)HH(L[]A\A]A^A_LHLtHmuHTI/uLTH+zE1HD$IEH9E~ILt$Ld$Hu(H} LLuHT$LHHRHHT$:HT$tHL.tI/wLE1@TI/]LE1&TH(L[]A\A]A^A_ff.UHSRH;=CSu XH[]HOH9tH5#S;HESHff.@AUATIUHFHLMHWHHAHHtIH1L1LHH]A\A]fDSHHH5|HH%UILD$H$1z H{H $E11HT$H5$WH[ff.HH)HcHff.@AWAVAUATIHUHSHHHhHu1H[]A\A]A^A_HD$ILt$^H$LhI}~OL;-;TtFIHt(HW tL`Hu &HgHLLOx1LLH[ ue7ff.fUHSHQH3HtHHOZ1[]ff.AUH=ATUH=H=wH=RIHH43H}LIHtHH5HI,$NLIHtHH5HTI,$rIHtHH5ZH%I,$6PIHtHH55HI,$H=s IHtHH5HI,$L]A\A]ÐAWAVAUATUHSHQLgL-LL=mOM9tM9uxLuM9tM9u>LHIHH9tHH莴ZL[]A\A]A^A_LL7uLL7uL%LI$LL7uLL7ta@ATIUHSHHV)t*1HsLՃtH3QH[]A\#Ht1@H1H5S1 ]ff.ATUHSHH0IL$KH?H9Ht-Ld*H1H9HH)ʃHHHtjHtHHt&HHt A@@0HHt A@}@0HHt A@a@0HHt A@E@0HHt A@)@0HHt A@ H@pH9HL4H0[]A\H@0L@t LA@HO@0Ht A@HOApI@t A@HOApI@t A@xtHOApI@t A@x[HOApI@t A@xBHOApI@t A@x)I@@pH9Hyt;HA@A?HAɀ@pDHHt A@xH@pfD 1fDG HHw$HGUDAWMAVIAUATIUSHH(H H;=#NH$nHH0HDVHAGIHHLZ7HHtH{H;=MuhHIHH{H;=MLIMEIL&L $IMMI/L&ImAH(D[]A\A]A^A_&ff.ATIUHSHuVH%H)Ã} }L1$zHEHHuEE LeHߒH[]A\HйHHHHH)HL9|I)뀃}L@ Hu$LH럃}L_tfDHGHP`HH[ff.ATUSHHHs ]&HH{HH5HmIuHJL[]A\ff.AWAVAUATUHHSHH!HH HLmL%HL}I}L9L1LJD$mLmIULuI~L9)LT1LZHHH.H+H$H<$HM HqHL$ H}(LGH|$A=ImH=OHH=<HH_7HH5HIHfH@@H@0HhP@ HI1AtyItIIt"MUI:[AAD$XL9IEH<[ADXHH9MuI<[ADXH9HH9IuH<[[ADXH9MELsK<:[ACDXL9YMULsK<[ACDXL9eIELsJff.fIAV1AUIATUH͹4SHHH~H?L9RHIM(NHH3fvHHT$LHt$LC(HC($Ht$A~HHLD$L9IOMLT$M9MOLc$fnHCfHnHǃfI:"LfA:"f֋HMHLHKHCIELk SxHL[]A\A]A^ÅfL-:H5 I}BHLk(HǃMtH{(E1IH-U:H5H}EBu(u|nff.USQHH;HHHHHHHHHH1Z[]DH~OmHq>H@SH(HuVH{ HtH/t@HHtuHǃHfSHǃ[=H6f)HHkHlL% .H-rLE9OHH81LA0HDD$LL$(fHnL`8LT$HhHD@@@ILHXH@PH@hHX`ILPpH8[]A\A]L%-HsPHGJZHc~ff.AVAAUATIUSH jH5vLk-HHHJIHDH0jH{8HsHE11Htu}HHHjIHEI|$H;=7hID$ I\$HS@HtHLkuSHs0Ht Lmu4Hmt2[L]A\A]A^ÃAHWff.AUA1ATLUSHHHl$PIHLLHH;1Hu{CHH'H{1LuTCL!LHnIH|$XtH;EH|$tL+EHĨL[]A\A]E1D+ff.USQHFH9GuRHH11HtUHx 1҈T HHuE1L9C~5HML B4GIB4L3H51I;Y 1Z[]AVAUATUHSHHHwLMHF`L9uRHH5H9pxL%4Lt$E1LH5HHl$-NL9tTH[]A\A]A^IQ`HtH {H9JxuHH9HxLt$LH5HH\$MH{H9}tI,$#EuDHGHWH@ff.AWL='AVIAUILATIUH HT$H|$Ht*LLLHb,HmH ]A\A]A^A_@AVAUATIUHSLoHML9uWH}XHt LӅH}HHt LӅujH}pHt LӅuSH}xHLH[]A\A]A^I~(MmHt LӅuI~0HtLӅumhc^YQH肊HHǾZ{ ff.SHէu-1u1Ht$ HH)H HuD$H[ÅuSfDAUIATIH5UHSARH_Hl;H1HMt$M@AYL[LHE1]1A\A]L%6ff.HBATIUHSHH HHuHl6[L]A\MHUfATUSHoHHtLeH5E2I9uHs[]A\H>L8uA$LH5HE HHH@yHS1HH='HHmHuH3H[]A\fHGHpH8p Lhf.HHHc>Hoff.@˳ff.AWIAVAUATUHSH)IHHEu MHHXL`A A|MLHHNIL @85HNAIL @8uL`HtxNAIL @8uL`HtYNAIL @8Ht:HD$LhL4ALHALLHH @8MDIsHD$LD$HE1E1C:<*t>CL*IM|IAMEMoL9}EHLE[L]A\A]A^A_1O<+DE8t%H9CL*IIMAu$M|HH9L`L`O|%wAtZ1E1Au IHL9oA8+uIM9uXEtMKIL9t$E1fUHHHSHHu;H~jHHH1HH0uHNH[]HPHYHRAL̔HHT$R1jj(,H HuHAWAVIAUATIUSHH;5.HLl$P1LHG1H|$`H\$P4M1H$HD$M~1L\IHHxHH(I~(IV(LD$IwMHH3M1AIt{ItdItLIt4ItI%D B4 @4HDB<@<HDFDHD4F 3D H4D3DH<D;DHL9DF4D4DLB4 @tDDB<@|DTFD\DtF 3DLtD3DD|D;DTD\F4DtHL9wHt H|$Pc7Mu+HĨL[]A\A]A^A_DF4D1H+7E1H$Ht[F F IIuH4$E1M9~TB<IDŽ1HL11L$GIIuMIIxHtAIMI)LLaSH1HH(H01EHtH;q)H9u H(H[ff.AUATAUSHHQ;.HIcHw$IHHHy*E1HH{H01HmItHI,$MH$LH2m ImHt"HiHk0ZH[]A\A]H(L(USAPHoHHHHtHtH+CH^[]I-@AUHBATIUHSHHHHM,$~[Md$H5&I|$H9L)ƒ}WHLH1[]A\A]#DSH=#H{ u1҃{$tH{`uH)[Hr,H{PtHSHHYH+S@UHSHQ HGPHt3H+G@H9|H{@HH{8 HtHk@Z[]H(H1ff.SHg@HtH(YHH[ff.@UHSQ >H_PHu1HUxHu8HH)H]H~HfHnflEHZ[]DHHHHff.HIL 'L9sHpQw IcvMI)IpH$H{I9VLXLDL)H91|D9#HHuHBMI)IL9HAUATUHSHH(HwLMHF`L9tMII`HtDHH9Qhu7HH9PhHT$H5:HH\$;H([]A\A]H/H5H9phIL%!HT$E1H5ҞHHT$Hl$`;HT$L9uH{H9}tI,$EwATIUHSHHHt HՅuH{H[LH]A\SHS%H;CHuJHXHs(H9pu9ǃxTxh l ׉P61[ff.@AWHFAVAUATIUSH(LVHgIJLH]HH8(LhHHoL;-\%LxIE/L HHHIM9+J<2fHnfH:"I)$L9H<2IME1HM9} O\IE1L9tMM)O I1LA$0HO1L9fo $Lp @H@(HX0x8HH([]A\A]A^A_HHtOH]I LHZLQA1HLHt$VLjj[!H Hq1H負1ff.ATUSHH; HuH^!H9Ft []A\[]A\dH= HH1H0IHE@HmuHf!L[]A\ff.AWAVAUATUSH8LW8LLO Lw(MjHO0HMFMI>I~HLL$LT$H $g+IHXH $LT$HE(I.LL$LT$MuHYNHL$ I4O\MHl$(L$LD$Lt$MHM H~IM u4HT$HnH)H;\$IOL$MI)HI(MHM)HHl$KLT$ HIMHHL9}'IaLL IHBHL$%I/Lc@HLx IHI9=HLlI/UHnE1!ff.AUATUHIHH5A=HHALtZCIMk11LHhI,$It:HmuHMAIm]A\A]i!ILf.%-H fHnff.ff.AU11ATIUSHHxHl$ HHL2CH{H{h1@#H{8HCpj{,PH{O{ tH{Pu{$VH{`KLk@HSxHL$0L)H9dLc8Ht$ MHLID$HM$HTHIT I)LL)HHLk@HL$0{$H{`Lc@L9cXI̓{ ILk@L;k`~Lk`L9IHCpH{hH|$(tHHxL[]A\A]HsDE $YDTfET Lk@HL$0HHLH5óE1I8ffC@LkX'HsPH-I9$ HR}IHH({ t H{P${$t H{`Ll$0E1L;kx^{ tHCPM~Ht$ H{8LLM{ HCXLk`Lk@t LCPM9 HCHItTHT$0Ht$ HL)L HHII)G]>A<$DDED Lk@HL$0HkAWAVAUATIUSHHF~ H{DkEqHcH9S)HHlH{0I${\Mt$t H{Pa{XWE1{YAHChHAD$ @HKI9L$H=½L H9AL9AEuLaDL9I$LCpI,$HL9}HLeHCHHLH9H H9OH)HmHLHH;{E ~H{xHCxCHHǃHH{8HuLHL[]A\A]A^A_I1H8HHHHmD11H5+SHH(uwHǃH H5~fH:"HhEHLHHbHUrHHH5H=O?H1[]A\A]A^A_H6HzAWAVIHH5AUATUSHXM~iHHHIHHWLl$0Ll$H LL1E1IM`A$mIPL$L nM9L$ID$ I$fHnfI:"I|$H~LLfHL)L9MHtMM)M91MHPI9HH9h1LLD$!6LD$HIt+Hx MHkPML IKI3IPI9uI(t:HkPL HHP^H9uL;l$HXL[]A\A]A^A_LHPL`tM$$HKI9\$:I$I(uH(8HX11[]A\A]A^A_D5HH9HkPLD$HL$HL$LD$HI&wL 81LHL$(LD$ LT$Ht$xHt$LT$ILD$ HL$(9Mt$H1LD$L=H5U|E1INI?LD$I ME1MtLLIJI2IIPL9u_MdLl$0Ll$Mff.@ATIUSH?HHLHHHmIMu*H5>H>V9H1[]A\L;%t>ID$Hu#L#1LH=wL#1L#1H=V1H5{H?I,$HIu   f.ATUHHHIHHTHHLHHmH]A\DG(uHG@u H`%DG(uHG@u Hc\DPHXH5y)H8Y1ZDATIUSHHHH+H5H}H9ti HHHHHmHHHSLxHHH[]A\ff.AWAVAUATUHSHH(gXHWHU LmLsAĉC At$L$ 9M9 @L}0 4@LK0LL$DT$ D9T$AE @(C @MIHHT$ILLALtqHHLHD$>HL$LID$HLI\$ H)I<f>ID$(Hl$ 9l$ H(L[]A\A]A^A_EMAAAMT#IH-HT$ILLALwHHLHD$ALT$LID$HMI\$ L)K<\AID$(H6H5mHEfHnL.fH:"AL$IL.It$(L}H"LCHLD$-H|$1t$HHD$HMKIH$HT$ILLALaHHLHD$TLD$LID$HMI\$ L)MK<TID$(H*HaHH1HHH=;IH/ L"HEfHnIfI:"A\$HIM\$(L5HEfHnM>fI:"AT$IM>Mt$(AWHAAAVAUATIH1USHHhHl$H{HIHIIHH{1LAEH01EuHHtI/uL H;-HHH2Hmt7HI9HtHK0HtHHK0Hh[]A\A]A^A_HHD$HD$pFI/uL~H*HG@ IHGHHHSHÃ1[@4@HH50fDATUSHuC.11HoH;HC5H,H E1HCD[]A\É`^vC.H_H;H;HCH`u?HE1HS륃,u=.,HH;HCHtH E1HKcE1[tAVI)HAUM)ATUSHH|$@Ld$HLl$PHl$XHLGH1HHGC A} ffHnfI:"HC(C8K a+-sHC(N4I0=IM9MMMM)LKPMV1111HD$PAt$At$H HC0HtcfnUfn\$ f8?f~UHC0IUH)L)HHLSI L SLk8MulLHC(HCHCHC@HCLH[]A\A]A^E1O-HC(ACt6+@s I$IHLGHHGHJM$$AA|$ @@DuE9EBDufHC0%-A-A HC(EEDS HC(C -|EEA>u HfnefAnmIf8?f~ewAHHyLLaKI,$uL*LL: ff.fSHH?pH{pH{[AW@։L=NAVAAUAAATAAUAASJHAH(HD$HT$;(LSw 3IcHLH0;HLH#HLHmHLHHLHHLHsHLHِ|HLHΐeAHLHN{HLH7|HLH }HHL ~HLHHLH|HLHqHLHfLHLLHLHLHQt}HHLa_HLH/JLHL7LHL$HmZL[]A\A]A^A_f.AVIHAUIATUAPGHcIHMt!HtHLLLHLL+XH]A\A]A^ff.ATIUHSHHH H(H}9}HH[]A\u2AUIATIHU荧HHLLH3]A\A]DUSHHHH;=|H'1H01cHHHPHHL$1HH5mZH4$HHmu HNH4$HT$HHT$C H= 1H[]ff.HATSHVHH9u.LcM'Hs L]H#HCLZ[A\HWHSY[A\ATIUHSHHHt HӅuI|$HHH[]A\fATUVHHGY]A\ ff.QHHGHW1HuZHHH1ɋtHH HsHZU1H0HHRfHnHfo HEHHE8HE@HEHEU(H]HmATHtHHmHmL$LA\ÿIH-ff.ATUSHHPH?HHHHHu~HH9WuqI1HL藷+H Ht$HHiH)H9HHdH3HL$H|. H4$L/HP[]A\HH;HH/uxff.fATIUHSHHHt HՅu!H{ Ht LՅuH{(H1[]A\ff.UH @fH"HfHnHHfH:"H0HD$H$HD$ )D$HucLGIYM~ HWHT$IPHH}HE@0Ht$Hu1H0]HH1H(u.1HL$LD$IHsH<$H;=tHtHHvff.@USH赿HHHfHH1HWHHHPHHH[]ff.@ATIUHHl$HLHljH]A\@ATUSHH OD$t&H|$Ht$HHH9u1H []A\HHff.@ATIUHSHHHt HӅu]I|$ Ht HӅuJI|$0Ht HӅu7I|$8Ht HӅu$I|$@HuI|$HHu I|$PH1[]A\HӅtff.@H=qiHH/HYifDATSHH=Q IHt5HCHS(LHK8HsID$IT$HI\$ IL$(It$0LZ[A\UHHHEH]H@ff.AVAUIATUSH_@H9WHpIHHI}u fo\ AE(ID$LLAHHu[L]A\A]A^HHL菍uDLGMtHGI(u PL1Z1fUHH}^YH} UYHEH]H@@HHXHOH HOHUH藠H} XH]şDHYSHXHwHWHHJ0HHHuۃ[f.ATUHQ$LeL9uCE1H}HoH}XfH}p]H}xTL<HUHH@Z]A\HEfHnH@Eff.fSHHHu[H[H/uCHff.UHHӭHNHm`HHH]ff.ATIUHSHHe1HHHtXH|P[]A\OI4$HtHNaHyN@UHH}NWHEH]H@ff.fAUIATUHH LIGHID$H1HID$ L]A\A]f.UHWH}HH}tHH}THEfHE]H@ff.ATIUHSH^OHID$H}@HHE@EVHI|$ IHHxXHPH}HHHUHVIL$ H}PHHMPUIt$(H}XHHuXUMD$0H}`ILE`UI,$H=LL9MuH}`HtLWAu1[]A\H_1A(H1Hu1HuH}`1AHپ:HHxH9~Iff.@Hu1AUATUSHHfHnHUHK(HS@HCLkHC8H)fo CH9IlHOS(LdH)HL9tH;HkH/uHT$HT$H LH1[]A\A]fHbHHSHL[]A\H{PHuH{@HH[]A\?HH9WuHt$ XHs@HH }ff.@PZH顔AVAUATUSHHOHRHX!yIHID$H5LAD$ ID$[L]A\A]A^HIHHH9HHH9HH}!IHHhH5HMID$AD, HSHuPMtKDC I|$ IrALIIHHACE1FIM9r.H%Mt$ Hs LZH[II<LI)I9LOLL5H9|H-\H9ouAHIH5CH9wtLIH5~E1I;WQ=x1薱ZHfAUHHATUSH8HHYHRE1LHT$R1jjH HHH(HLhME1HH5R~HH5B~LH5:~LqHH@ HRHP L;HH L~$HHH8[]A\A]HtLhM8 L`7DUHOHHWHAHH H HAHgHGMHuH]L@Aff.AUE1ATSHu D[A\A]HIDUHH@HtHE@H/H}HHtHEHH/H}PHtHEPH/H}XHtHEXH/H}`HtHE`H/NH}hH%H]off.@Hu1UHSHAPH?u1HH&H;HY[]GAVAUIATIUHSHHMHHtVIHt5H蕓HHHH5gHWHmx)HLL,HLMHH[]A\A]A^f.AUH=`ATQ:H=[IxL-[H5c`LR[LH5\LH[菃LZA\A]fDHWHHt'QHN2H;V HDHZHAUIATUSHHHo(LgL9c EH[0H9~ 1H[]A\A]I|HtHT$HAHT$uH@HWH HgHHGH|HH7HHHpHOH9rfff.AWAVAUATUHH~SH(LVHIBLHHLH5HLQIHE1HH5cI^苜H胲HH5%cImHeHH5bIOHGHD$M9BL9L91H߷1IHu(IVItHItHH91HHHLkD$I9~MukHHIDHI.L IGMWMMcfInL M$fH:"AGMSH(L[]A\A]A^A_Hk(HLLD$J4LD$HrfLoH5FL»IHrMkIU Z1L9=fVfvH 1H51Y6fDU1HSHHIAPHHVHtcHHHH9SH'HtQL@11HHHHMH9t3HKE1L9~NTOIIHH9CuHHZ[]fATIUSHHH8HT$H5تLD$1 |$1HT$THH:HIHL[]A\fHWHHHzH+xHu1TVHHT$H<$"RH<$HT$Hx HH(V1HÐAHHHLEuH (H9OuHuL9GuHHH)H<0HAUIATE1USHHM9e~dIUHJ,HEHHmtZ I1IT$LLAFHHH[]A\A]HH5uH81HD$ mD$ ATIUHSHH HD$HH{Hl$HD${HzH9CHH軵H{8PH]HH{ 1H5r1HH/H{8H5LH9wH=hIHmuHkLHHHD$HBH|$LtH|$H{xHCxEHHǃH HD$H []A\1HIHHI,$L IH HE11I1ZIQHGxH11f.AVAUATUHHHSH0HH\HRHHFL'Lo1HuE1LLHrH0[]A\A]A^LwH5I~H9LhHH9H脫H+H Huff.AWAVIAUATIUSHhH|$HHL$LD$ 2D$I$D$L$1LHt$ILeH1UHHHD$8E1H|$fvLHDŽ$X)$ шH\$H$LHsXH$0HXHHL$H$Hc$L)HHIH$L)HHHM9}>$LLLIH|HH/I/|$I$ML;=tLHI/L$E1HD$8IL9$AL$D$<L$M9~CH$$LL"HHHHkH+NLI,$H$LE11ɋ$IH!H}$HD$HHELl$IImVHmuHMCMH|$ HhL[]A\A]A^A_Hl$@LHL$0HD$@HT$4Ht$8IHNjD$0HHT$8\E1#HAH|$@EHt$L1H=VoH$IHHD$H|$LJH#HD$(1HL1LT$(II*uLMLVI$II,$?E1H'2Ll$IsHT$H9T$8_HmyHHD$3Lt$bHT$8LH=a1IPHC>ff.AVAUATUQHIH=OH]IHpHxI,$IuLMMLLóImIIM+HL聮I.IHmuHUZL]A\A]A^fAWIAVAUATIUSH8LHHGL)LHD$HGMIHfo MMM`Ah@1AIxMH?fL M`E1Ml$A<$'MhGA$IcLMH8Mi MAMIMXIT$IHH8L[]A\A]A^A_AD$IAtIIIMIH9 HMH9IMhM,I@IHHD$E1EL$H)HI9NIAT$ It$L6 HIL$LMXM`I@ M`A{H9E3GA EofE:EP(AR MIIpL)MI7HGM MHEp@J)IHEHH@ K  MXAT$E1MLI+OHH9MHMI)M)MIGVIM@LIHMHIH@ L@@@AL$HI9AL$MlMhMM`IpLM'H IHMIHA~P0fI:"P(I@I@ A^MP8JL!IJMIMMvMp(M~1J II)MLMp(NM)A~p0M`8IPMfI:"AI@ HI$IMX8MLICL)MIHGIILIHMHHAX@LHMH@X@SIDIx8LD$HOIFLD$MMpA>I4Ip(AvAAP8MHEa(I@H;D$s 8A;x8HII@MX MX M9}E131I9wE1Md$M`MoMI)Iuf> tL9t1I9wM;gtEofE:EX(Ax@tAYM'AMP(MAoH(f:AxME1M9WbHLLD$vLcEhLD$IHLvIX(HLM)MA|$E1HI9ILLL,M9AMAMM9LL$(IHE1H;L$9LD$ HL$iA}D$i;D$LD$ kLt$LL$(ILIVIPIHTH4H9AHAE[HRML$ MHfDAUATUSHLoL'LL)HH9~ H9u%_HbHc,HHM,ًFL©u L9sf9tNHL)HH[]A\A]LLL9sf; tHLHnL9s3HtHHg8ff.fAWIAVILAUATUSHH(W@LHJHHWIHWH{HHHKIHtZLhH@IELhHSLcfHnLbfH:"Al$Md$0HCPI$HmH(L[]A\A]A^A_蔅HQHChH{XLL7fHnfH:"I) $HxH{HLH蜫H>H0H{HHC`H9GLsI9IVINL=OIv(HJHQIV LL9aHfo$Mn HLMN(M~0LHD$AV(H{HLL$ LT$Ht$H{LsfHnLwfH:"AFI$H.I*uL误I/L蝯H=e{IH+Lh H{HLHHh(HL`0rHkLsfHnLufH:"AfI$8HmE1%HHm HmuAWAVAUATUHSH8H@H;pu0wIMuL ILM1H8[]A\A]A^A_L|$Lt$ Ll$(LLLoLd$ MuH|$(+-H|$!-IT$HL$(H9HHHL$H$HH4$HD$H;LH<$H|$(,H|$,L $DV FME,EMAOd^H+LH蠑ǃHL9L}IfEv1L;ILHL{MDARHM9MItbIt.L}fEv1LL;HL{DHJIfEv1LL;HL{DؐHfEvIDL;1LHL{誐HM9IofEv1LH+HHkDsHIOfEv1LH HHKDEHIWfEvLHHHS1DHu_fvI@AMAUHuwAuAu,ǃM$AL9sD:m&HL9u1H8[]A\A]A^A_MEI)M9|AAM)L9LCMEL LH)H91AuHH9uI4ԿĨI)IAM)L9nAE L9^H:EuL9LǃAHL9-MtC8Eu1IL9uIJTI)HIL[EO$G$ L\HkLEuH$L1HvH$fvHHǃIHL9uL謰tHk1LHH+HXfEvHD1HLT$ HL$LL$LD$H4$֍H4$LD$fvHLL$HL$LT$ I9>=F Df&MAI)IM9ME]AOLAA3H+LHL $DL<$fvǃ4L9THL1H+HHkL<$L<$fvHtI9>N DfLH)HH9M*A}MLAAH+LHL $L$fvǃHL9HL1H+HHkL$bL$fvǃIuLlL $uHL $L9r1Hk1LHH+L $HEEAEIA}L4AM,ǃL9;}tHHI)L9LCJt5HkH3E<$1HL{<$fvHh7MUNLH)HI9<LAHH)L)H)HL4H4$Lt$M4L9AUH;UL9ǃA9EHI9HL9HuEEAuIEmEAH<6AM,ǃL9ffD;uHt=HkH3EOH<$1HL H<$fvH&HI)L9LCcL\$ L\$LT$L$IHL$(ILD$LSLE1LHLD$LT$fvHL\$ HL$(H,MUNLH)HI9w1AgHI9uALALH)I4L)I)H?MH$L9-AUHf;UL9ǃHL9HtAf9UHI9uH<$JD5HHH{EFǃIL91ff.U1H0HH讂H=J?H1訑H0]fPH=S5JZAWAVAUATUHHSHHHHHIHxILu1IoLd$0LHL!]IH1IHHt$8HD$0Lc$$H)HIIHD$@H)HILH!HH9HLjHmLD$0E1L9D$@AD$LD$@Ht$HH9t$@fvLHDŽ$)$ _H|$@HsXH|$0LsIoHM~~H{HHu&LLHH4HHE1L;{ILLLHJDL]HL[]A\A]A^A_oH 6^fDATIUHQ]xHHZ]A\H}H5BH9t u1HH8qntXH=H)HHtLH]HmAuH蔙Ey1ff.PZ/HkHZff.fAWAVAUATUHHHSH8HH7HIHMJ} FD] LmD@t$A &A@Le0M|$LcLOT%E1IL $11MM)Lt$LH)ȃhHtpHt3 L9HH b YHD A L9ZHHA ,A "HD1A {L9#HHA A HL9 DqHAHA %L9HHA A DqHA L9IqHzA tkA teDpHHA L9eIqHzA t;A t5HHL9t; L93LNHWLH׃ '1HI9NEH}H8[]A\A]A^A_HH5H{H9~H轗Ã3H8賊H 1]H ]遊UHSWH~H5OH9qmHqÃk;9u脍19@Y[]4Iff.fA؎HBB@uHQf.UHHH~H5H9lHυHcv H]H5<8UHSWH~H5OH9qlÅHov YHc[]FHH?H1fP_ZH4@H11H|$~HD$Hff.P芋ZtU@AT10IHt#H@(f@QID$HmLA\DUHHH~H5]H9rkeHǃp9Hct H]~lAT1IUSHHHPHHZWHt$I\$HH)H9xHL/UI|$HT$H4$t&I|$(HiHaI$HPL[]A\H=YATUHXHH9ZxIHt$1艱IHHT$Hx CHWYHHXL]A\E1AWIAVAUATUSH8HD$(G(HGDhAH1LL$(HLD$ H !6H/Z~HT$ HJAG( L\$(AG\MH$$IIw8 IHH|$ aHHLp H|$LHHIt$`H|$HODD$EHAv AB5ID$HHHIHG} @uAA~?2{H5LcIAEH.H=kHDI\$PI\$hLIT$`AD$\HID$pMD$PLID$xHmHl$(H H8L[]A\A]A^A_EH-L5EIDEH-H -HDkEH-L5IDQEH-H5AHD7DT$EZAABfHc1H9|PM I[HCIsH4$H@H<$t @H<$NIhH<NHH$ML$8I\$PLL$AT$\Lc4$Ml$hM9~jL]AIJ|HwdHHHHHHH9FK|HIHFH|$I9\$H^L4fUHSQHIHHtAo@8oKS HK(PXHHH!HsHHH`HhHHEHEZ[]ff.fAWHBAVIAUATIUSH8H_IIHD$(IHH5{H9sLt$ Ll$Hl$(LLHHKtKHt$H~HuEHT$ LqyI,$LE1'}H8L[]A\A]A^A_H~AN  }@tDH0 >+xIHtHT$ HLI/s*oHHInHU} E1I,HD$(蜐IHHKHH}H9{S D$E AAA @L{0 @H0E1LT$(L;S|$C<wHD$H}LL$(ARB| vHD$ HHHt$L貍H|$H/H|$ H/LT$(IbINHqHDH5?)E1H=Z MAE  Z@IIm0E1LD$(M9Eup>LvH5{I8qHwH5H8Qy tILvH5I;$>zH swH5DH9dff.@>@~#D@A$wLEOcMAHHÍH wHH%u$u%t'HԹ~Hff.G(uHG@u HPw~"vfQG(uHG@u\^HWhHZH UuH5vH9V~HZSG(uHHGH@u;H`SIHt@DK\H{8E%HKxHSpHshA[AHtH5 H:}1[?@H8xAWIAVAUMATUHSHHH>HT$蹇HIE12LHLDHIT$HL$JL9IL93HL[]A\A]A^A_ff.@?<2H;LcIA?8?/sHc?'s?fUSHHHHHT$ZVHHC Hu8H{Ht$HkHC 1@};H[]H9kuHPH9HDwHS HfSHUHS HH9CHBHC HuHCH{MHxH[DH=I}@UHSQ5OHHx HCmHHHHH=eh1Z[]ff.UHSHPb_HX H` Z[]AVIAUIATUSHNHË@ 9CI~RMfL!хHHIVLdKHEHLeLmI$MHcsHLNKH,I$H[]A\A]A^ff.AVAUE1ATUHSHMIHtJE9n~DIIcL$Mt/I<$Ht HՅu%I|$Ht HՅuI|$HuA1[]A\A]A^hQjLHtHZff.@AWAVAUATUSH CG LwAAA @Lg0IE11MuWHI9~8AubA,u8yu-EuщE1:AIcH[]A\A]A^A_t8HsHH[]A\A]A^A_AA,\LgH_AtAtA<$:1@A<$A<$hff.}@fff.@Q1HtH@HuHZÐAVAUATUHHHD$H$HH}Ht$NH}HNLd$L,$=Il$ Mu HbH 1LH5LH=>!蚃LHH=.!1AIHHx _H=*LLoImWL%tI$LH|$cH<$ZHH]A\A]A^fDHHt$(HT$0HL$8LD$@LL$Ht7)D$P)L$`)T$p)$)$)$)$)$H$HT$ H$D$0HD$HT$Hff.@AW1AVAUIATUSHHXHl$ HL@IHt$DHD$@HD$(H!IH+D$<L%AU%H guMuA6I1A.wEEtA%tEBzE1AlE1A>zMAM)LT$0MZL\$0%y@@IcLD+A/wwEALCD+M(HL(HHLLH'IHMnAMILH IHXL[]A\A]A^A_LCMPLSDE@EA/EALKDIIH5P+1LML;/HS;DAlLT$0IEG9DEEA/dDAHKDIHH5t1LPMAVdpIAPA~@dCIA%LT$0IAG%A/EEALCDIAH5/1LLIA/"DAHKDIHH51LLuLT$0L4FLLHH3HH$HE1l;/HS;IH5cL1+L3/ALK3IIH5b1LKL$Xxa@uu HSHBHCLCIpHsHKLiLkA/wgDAHSDIHH5|1LaKLKMYL[cHSHBHCL=SoH5I?drHSHBHCHKHyH{LKMYL[A/w EALKDAIH5LKMYL[1A| 8HH9u*IADBmD+A/wDAHsD+IH54&HsLFLCff.fATISHHAPMHtHHLHZ[A\DHHHt$ H8*#v|$ Hff.fAWAVAUATUSHHGHt$HIA4uII;|IHtUM9+KHkHt$H|$HtvH|$xDIH|$;H|$1H(L]A\~ff.@ATUSH>]Ld$LH^H/HH=5HL]H[]A\ÐAWAVIAUATUSHt$ fAL`LzyHzHLLIHE1.HYIHtIMuY|$ Hts*HHjMuRLHq2LeHLu*HL[]A\A]A^A_HLX\I/HuLIbjiHHff.QHHeH9GHHHH_ZDAUATIUHH5SHH(HT$LiHt$Ht"Lr9H|$H/uPhHT$H5HixwH|$Ht(1OE1HHH|$I9uH/n1H([]A\A]LILHH(HL2HmIff.@1fAUIATUHSHQHeH(H9(u&HHH/u MW/1H0IHHtHI\$MMl$ LH=914ID$H{ID$0H1Lt]HH1HH=GMID$8Hm]I|$8^LHt ZL[]A\A]Aff.AUH5ATIUHLl$ LH;AhHYH|$ LHHmIjHL]A\A]ff.fAVAUATUSH VHIzIH1H=HHL`Hs8HH\IHzH{0LHwcImHsHLwHmcI,$K[L]A\A]A^ÐATIUHSHHHt HՅu"H{ HuH{0H<[LH]A\--DSHH=-b1~tHtHHX[ff.@ATIUHSHHHt HՅu/H{Ht LՅuH{ Ht LՅu H{(Hu1[]A\[LH]A\HAUATIUHSHHHHD$H$HL.HHWE1H9HHNI9J|LhLhH[]A\A]@AUH5IATUHHT$ H;eIFHK|$ LH;I,$HHtBHEH/IIHHmuHCcHL]A\A]IATHBUHSHHHCHt$H 0IHHl:H;D$HPLeHHPH/uH[]A\ÐAWIHHAVAUATUSHHHYx(L@0H3LH8LX@HT$hHPH|$D`HxPLD$DhL@XLL$0DpLHhL\$8Dx LXpHT$@X$H@xH|$HLD$PLL$ L\$(HD$XHu H[RLE1LHT$xR1jj%aH IHH|$I HMBMJMJMIBH2IJ HMB(MIxH5A`LT$hLD$`H9XYIKH\$hH|$`H\$`MbLT$`Hl$EEEeE?|$PAH51SH=AWAVAUATLD$XHL$PHT$@!qH0t$Xt$ AEDDVDt$8t$8t$pt$pt$pt$pt$pt$XfHPH[]A\A]A^A_cff.USQH6H]HH9F"HIH1H H5H=kp@HSPHu01LBH L9HH}H]r1Z[]ff.ATHHUHH$HHHHH?H{:L$$LfHZHfDLG(MtHG(I(t1PLX1ZfAVHHHVAUH!~fHnATfH:"UHhH#H-_ fD$8HD$@Hl$ )D$L$(L$HHH)H H Hl$H?H)HT$HH1H5w2H=|h H=m$IHHxfHH@X\$HJ|$8tM4Aƃ8DIXlLID$X3I|$XtTHk3HhL]A\A]A^Mt$0M"8LI~0LID$X3I|$XuA*DHHAWAVAUATUSH(LgXMHIH8H}XIiLI3MMt$L2.A|$.IJAD$I$H=D$HT$"IHMM8fL}0@@ I@@M[L-LHJ|+HHt$eIH Ht$HPHA|/I<t/I|LPH}0H}HLGMMLLIID$L}ID$LMt$M}8unI|$tDl$HD$El$0ID$8H(L[]A\A]A^A_HeA|$.HO;,HE1Mt$I듉H@MtLUHMZMMu/LLHID$:LLHID$ UHHcH}ZH} QH}(HHEH]H@ATUSHoXHt5HGXH5{8ItHbDHY[L]A\~0[]A\fPH VHZff.fUH'$HEH]H@ff.SHH HT$Ht$H|$BH{XNH{/HT$Ht$H|$l8H [fD1t?@HH`ff.ATIUHP!YLHH]A\8ff.@1 ff.AWIAVAAUATU1S1AP>4IHHIH(HHHHKHL.Eu"HIH5ZL[]A\A]A^A_fP ZHcMAWIIAVAUATMUHSLH(H>HD$Lt$hLl$puH$)L$HHEHD$`I}MHHI4$H0H)MLHIEIuHSH}11HH:HPEHHL$HT$1H5BI}L0HHpL+Hx M>M+,$I<$LHH;L)H(HT$HH9Ht$L I$LFII)IL9NH$ztxH|$I>Lt$xM&HmHP1H([]A\A]A^A_HL$mH4$I}p XI}L?1HEL$IMC(L9ZL$AAB4~ AA@H$L$LI(MS E9{rIKMM)HH $L)I9M9EM)H$LFHt$@PHLAQIHH5AAPIHH81HfAUATUHSHHXH{@H:H{HHH{`HPHC`HKHHPHS@LKX1LCPH5L$ZYhH{HHS@E1HK`HwHHHHXD[]A\A]H ff.HQH@*1ZfLMtHI(uLNfUHOHHWHAHH H HAHgHGHuH]L@Aff.UHH@HtHE@H/;H}HHtHEHH/*H}`HtHE`H/t H]"Mff.@P(ZHH11H|$^HD$Hff.QHW@H"HkOHZff.fH(H0?t2LG LOHO0IHLOHO0ItI9wWHG81H(HT$Ht$H|$lIHKH|$HT$Ht$HG ILLG HG011HHHrH01HuD$LD$ff.HG Hw(H9p8LO0Mt0HWHOILDHLO0HWH@uM ILE1LHGLWff.AUE1ATIUHSQH_I9HU(HMLH|PH9]1H=LHHdH+MHMHZ[]A\A]f.ATUSHWHHHHHC(LdHHC8HC(HSH@tL[]A\HtHuHC(Hkfo5S C(ff.@AUHHHUATHpfHnfUfH:"H`H-Q D$8Hl$ HD$@)D$L$(L$HH.H%HHHl$H?Hr/HT$H1H5H=Z +|$8IŃH|$0)AL&EL%&LI$MH&H`L]A\A]ÐHOH1AWAVAUATUHHSHHHH9HHH9HC8L{1Ls Lc(Lk0H;H1HfInL{fI:"Ls C(H[]A\A]A^A_DUHH5H(HD$HD$P1LL$ LD$(ZYH|$XTHT$HJ!Ht$H(XHH1~D$fH:"D$fHnHfH:"L$EMHE HtLD$LL$LT$IIMK=$H=&H.ZHH H ]fD1y6fAUIATUSHHX=yLd$LJH7IHXHtHJHqpH[1LpDHH\L(H|$HLHXHALAEH|$2HD$HX[]A\A]ff.USPHoHQ*HZ1[]fDATUHPLg %H=iHLI$L)ID$HUHuH}H@hvAHH(H}H/uFH}H/H}HIL$LHih  MfHP6@USRHhHGHHHHۇH#HHP@H;X[]HAUA@BHATIIUSHH=HH HiID$ʚ;HI$HHfHnfH:"A$H[]A\A]ff.AUHHH QXATUSHHD$ D$Hl$HD$ID$ P1HT$RH*LD$$&ZY|$q&IH`HŅNH=GHc\$HHiH;u'Ll$ t$ LFH{ &LLD$M!H{LC}HFDL$ fnMT$f:"D$HDKLfCH[]A\A]QHWHp98HH9u?Zff.ATHIUSHH|$H$KҁЁ@H=$t $HL)HĠ[]A\ÐATIUSH_p`"H9HE$I|$hHŅNXH[]A\ff.@HDHxff.fHH4@S ,HRH9!11H=S<JÅ Hc[&>fDHCH@(@P+H@ YZ;H(HT$L$H=$UH(ff.@AUATUSAPHHW1I?HHtHJE1L9eHm\ZH[]A\A]AHE1N,L/HGH(0IfAUATIUH@HFE~ H IL{.MD$1LHLtLH@]A\A]Lw=1HGHHOH9HOH9LGL9IO:fHHGHWH~&HLDL9sHI0HIHwIH1AUATIUHH0L9tvIHHLA>E1Lti|$(nwDv&HOHuHUHrt%uLLHH0]A\A]H0HH]A\A]ff.fRz(1HH Xff.AVH1HAUHATUSHHL$LD$Dt$Dl$Ld$ D$ DDLH.Hx.Dt$ Hc:H=HD1RH[]A\A]A^@28EH:H8NfDATIIIHHL$8LD$@LL$Ht7)D$P)L$`)T$p)$)$)$)$)$HT$ ILLHT$H$L1A$D$0HD$$HA\ff.AWfAVAUATUSHL~ n(D$ )D$0)D$@IE1~HIAEA}n-f.?F z%ExroHL$@DDGIH^LHH‹K +tK tFH{u?{(nt9{u3LL'LAHĸD[]A\A]A^A_ALHH$cLIxMAE H$Ɖ @gV@EIE0E1-8-AED4$HL$(LD$$LLHT${(nHT${Hl$0HT$H?AƃH|$ LT$P1LWLSUDD$I;m}8IuL$LI$Lp=I,$6HH=~4LH51H? 1H []A\A]A^HC=ImHHn1pI]HH^fDAT1USHHH5NHHL$H xH{1LlH9~D$fH:"$HCH[]A\ff.AWAAVE1AUMATUHSHHHL1HT$LD$D)F$A I(9)t.DAAv-t)E)LI;DCuEHL\$8'vHCLA^HIcH9L\$H}Hl$(IH|$8L\$E9~iHLANL$$HHHt$8MDI$$LD$ HT$HD$"H|$HXZHtFHl$(H\$8E1H]HHL[]A\A]A^A_fATUVHHGY]A\lff.UHHF~ HH~ HH]HUH 2H5O1HRH9)H1]ÐHHGHWHt7HuGøHyHHH1ɋtHH HsH1AVAUATUSHG HIHAHurMZE @t=D9LeM)I9LOMcDLLH>[L]A\A]A^Ã<t<E뫺ff.IЉO HI@ 4@t Hp0L?HpHʚ; fAVAUAATIUHSHHH~H52H9H#f. D$fL$DH*YD$D$D$T$f/14 \$%%4 f/l$E1H,I4$HD[]A\A]A^|Aƅ]H)-HHt1H?HHH9-HHHH9|HI,$HtH 5H5:AH98pH=4H5:AH?7QL.H5ԾAI872HILD$@LL$Ht7)D$P)L$`)T$p)$)$)$)$)$H$HT$ I$ HD$LHT$1D$0PjLL$Hff.AWAVAUATUSHH$H|$XHt$HT$LL$0H$HDŽ$MZILHtHQH}0H]0Du sH\$(Dt$LcH|$MLD$XH|$Ml$M LL$ L\$MM9HcE(IH;D$}HUHL$p1Hl$@HL$8HHT$pA9l$9HL$p9|9$H;l$MA9D)Ht$(H|$HHTHT$hUHt$ L>HHt`IH$L$RHT$Xh$HT$@Ht$HL$LD$XY^HHL$HLD$PH\$@H\$@ff.ATUSH0HXHHHHhtLpL=H9u 1LrHǃX[]A\ff.H)0HXHHYfDP=xw1ff.UH(H]H}HtH} SHEH]H@AUATIUH@HF?~ HIL;MD$1LHL tLiH@]A\A]L7*1H1H|$?H|$Hf醮fDUHoH9u01HGhHGPHH>HCTH/H]HGfHnH@Gff.UHHSHHlHH'HHAHHV. ǃ D7ǃ HH1H[]@AUATIUHHx%tH.HH]A\A]H1H}H5+H9t tH)H8t.H=K(HCIHtHL0ImuLD$ =,D$ i1qf.HI-HXHBPHuH-Hff.fH(HH51HL$HT$HD$Ht$|$Hu1[6H1HH(>6H1H{fATIUSH IHtF@Cfn%f:"-3fA@A$=tAHu[L]A\A$tdIxt]A $)}a)A$Rt4EPEHA E)AE AfAnfA:"fAHAxuA@tA4$AxA@AxRuff.AWAVIAUIATUSHH|$H|$PHL$ HD$8HD$@H|$N&HI9H|$J4HH HT$@D$1HT$(I9LH)ب&IHAD=p(‰Ɖ ??ɀʀ=#?UH΀E@uMI9;A?LUI܃AɀHUEDMLAJAD=D(AAljA ??Dɀʀ=v}A?HARAπAEzMI9IH[ADvz=vRD(AAA ??Dσɀʀ=UH@}MYAă?HAȀAEDe8EH,H|$8諦H|$@衦H|$HTHHĈH[]A\A]A^A_Ã|$uH|$ D$I9~AD-=DD$1I9@At$lAL OcMAVMIL9H1L)L9H HLHhCDIIAƃ?A ȀA?AwAȀEGAGfATIUQ;HHrLH-_HIHrLZ]A\f.ATUHSHH Ht H;=%ttL%m1LL$LD$LHtbH|$n HHtP1H0HHT$fHnHfH:"@H []A\L%HLny1fUH7H}H}HEH]H@@HH1HLD$H ȟH\t+H=qHtHT$HHPH@H1fS1HH cHHH3HLD$t0H= HHtHSHL$HHPHHHH[1ATHUH(H9FAHWHNLGfHnfH:"HHHt$1ɺL)D$b|HHt8H5&DHH6 HmtH(]A\HHD$i$HD$1L w!H51I91fUHHH/tH}H]P$$fATIUHSHHHt HՅuH{1Ht [LH]A\[]A\Dff.RH$HXHJH3LI@LFMt M9A(XaATIUHSHHHt HӅuI|$HHH[]A\fATIUHHHLHHmH]A\HHULGHI@hHt H@Ht]>t%H>t1H"H;]H IPH51H91]AUATUSQHGgIH=N%HvIH-L2HHL]H1HtDID$8IUIEMl$H%fAD$AD$(@.ZL[]A\A]ff.SHHHt$>AHD$HE1H[fPzH[H@ Zff.fHAIӹʚ;HSHHHDIvx=?BL1[A3Í@BIꍰIHHx'ff.fHH|$H|$H)1Hff.fP H"HZff.fATUSHH zfZ(T( .) wGL$ 4t%1Ht$ >HHHu1H[]A\HHfT' f.] wff.ATHGH;t H;X MH IHtI|$tLA\I,$E1ff.UHSH1QPHL@LH< HuHtH}ZL[]@ATUHSHH\H]HHuHfqفI)IIM)MHL$`LD$XL9umHt$`Hl$hLe L)H9uH|$P5H|$H+HD$hHx[]A\A]A^A_ËL$HT$`HLHP"f@ HT$`PIHLLL$`AQQH APLL$0MHT$8H|$(LT$@H IHLPALT$ x ;MOAG @MIIOEAG O@>I0L$HT$`LLT$ LT$ I/%LTOO<M9A3IfH f$f-@(fqfA뫁mvHfH f$f@(ffQffyM9AAIfwfHf1H:IMI9IAvIH|$`Iw LML\$`LHAyLAHIII~Ht$hH|$`HLFHN H)L)H|$ HHL9KtXH|$hLT$8LL$0L\$(Mx^L\$hLL$ OT LL$0L\$(LT$`LT$8KH|$hM)ILHI)LH|$P H|$HH|$h1H\$ ff.@AWAVAUATUSH8HD$(HtsOXIƅtdL-cLcIx9IJ Ht$H9HQHq$ HHiHIL/H|$(H8H8[]A\A]A^A_fE1UHS1R9]~H}HcH<tEX[]ff.HcUHH(HH}H/uH}H/H}討H]ff.@ATHBIUSHH HI,$HU} 1H2HLelHHtfH LH=ү1[]A\ "I|$H;=GtHOHt$bHtHHD$H;D$mHt$H 1[]A\4ff.ATHBIUSHH HI,$HU} 1H4HLe.HHDH LH=1[]A\)!I|$H;=etHOHt$HHHD$H;D$DHt$xAWAVAUATUSHhHGH4$AHD$@HD$8 IEAD$ AA  @Ml$0Il$HHHEH9HH1HHD$XH7Hx H|$PtLHt%L$u-Au]HT$PDHL!HD$XHh[]A\A]A^A_LtL@$@ LD$PHtLܿMl$H4LT$fo- HD$HHL$PLD$HHI9uHL)IIAKL ?MLIIÅ~PDP~fAfD!fDPf83f!fAD!ft!HHL9rI9DHA(HDYDP~fAff83D!fDPfofrffr!fAfD!fftHHL9rI9vADHA(vDAHADYI)HIL)LHL$PH|$HH9u6Ht$PLd$XMt$ L)I9t$,H|$@܉H|$8҉LL$8Ht$@PHOLD$PAPMQH xWHT$(H|$ LL$0H IHHxfo- HD$Ax MPA@ @MIIx7A@ $@Ix0HT$PDLLD$LD$fo-f I(cL$ fo-L NKDL N6L9I9DHA(HDQL9s_0P AAD!DXAD!DXAD!ڀt)Ή1pHHΉqPʉQDXADYI9DHDAA6HqH|$PIp LILL$PMPAGLоHHII~L\$XH|$PHIK M[H)L)H|$HHI9KtH|$XLD$(LT$ LL$2LD$(LT$XLL$fo- KL LT$ LL$HL$P0P AAD!DXAD!DXAD!ڀ31pHHqPQDXDYI)HIL)H|$XHH蠆H|$@薆H|$8茆H|$X肆1Hl$L:铻L@ATHBIUSHH HûI,$HU} f1H6HLeHHtH LH=1[]A\I|$H;= tHOHt$.H)HHD$xH;D$?Ht$vff.HGHP(H:@PHHHXH H1 C1ZATUHH(HD$HD$HD$H6L%PLHHD$P1LL$ LD$(胿ZYt6H|$H|$tHT$Ht$&H(]A\H|$1HD$fAUATUSHHHD$G(HG@H1HLD$H HRLd$Hk8ACMHsH1IHgHSHAHx HGuDHL[]A\A]H :H5[+E1H98 fDSHHHsH;[DSHHHSHsH;"u1[@SHHHsH;6u1[H>H~ ff.QHHH9FH~uZH `HH5f1H91ZAVIAUIATE1US1H2HELHHm HI9]~IEH,L9uIHL[]A\A]A^ATIUH(HT$Ht$H|$rHT$H5LHt0|$LHHoHH(Hm|HT$Ht$H|$H(]A\ff.fSHwHHHy#H{HCHtHCH/t1[7H+Hk[1ff.UH(HtHH H}GHEH]H@fDUSHQHHtHCH/H{ HH{0HtHC0H/u&H{8HtHC8H/u H{t HtHxHt ;HHuZ1[]HHt&HsxHtHsHCHHHff.HGff.H=w'H(HG@ff.UHHt HxHV1]fAT1IUHH5SHӺHLD$bt'HH|$H0HHuHt 1H[]A\HLfHGff.HHGHtHuHH=sAVIAUIATIULSHH HtH[]A\A]A^HHl$MLHiH:HLlHL)HMt}LLH:1LE1lI|L-)C ·HHH1H)H;(H=HH?.IqHL1LI|ff.USHHoH7HEH9HyHHHEzHmbHHH[]U1SHQ;kv{ uZ1[]H;fAUATSLgHMtI|$H;=uHS[A\A]H: H5uHCH=UL([LH=HLA\1A]SHHH HfHHHHH8HpHtHPH [H11H5%r<11H5UrHH/uHT$8HHHKHD$ILd$XLd$M;fMVL\$KH{H{LkHC8HH{ IuHk(HD$@Lc0XLD$HػHt$ LAăH|$HH|$@D$LnDD$LHH|$HEADEHLt$XHH5LH5]LH56L1H=A~HIf83K\DIHEL$hAl$xA|$DPET${ff.fAQHHE1E1HLILZDAWAVAUATUSHH)IIHEu MH]=At;1E1Au HH9}E+fE9,zuIM9u[L]A\A]A^A_A[L]A\A]A^A_LoLKt-A,3ALML1Ht$AA $LHH fA;,$LDIHsHL|$Ht$E1H1D|LrHHH9|PHf9,uHD$M<E1CsfC9wu IM9HD$M9UEu%IM9LEIMEIEALDIA CIHIM fD9LDHuIMշA\2IrI)Ix.K4$I,2fD9EuLACf9TEHhI]A[L]A\A]A^A_mff.AVAUAATIUH,6SHHH()H9sfD9+tHHL)H[]A\A]A^HDtHDHH)耦HtHfD9(tHPHH)HP%HH)HPHXRH9tfD9*tHHHH)HPfL)HHrf.AW1AVIAUATUSHHHWLl$Ht$4D$0LLHD$HHT$D$,IE1HT$M9f~HI^1J,HEHHmHHt:HwsL;d$}@AIILLϖHH[]A\A]A^A_Ht8LK1HT$LLHIH׵Ht$Ht$L4H5cI85H YfDHH9w|7 3SHHHtBHCHWH9}"HHO(<HtHC[HCH/u1[ff.fHH9GtH4HB``xH9FuHPH9t H9tHHfAWAVAUATUSH(HG HNI [AՍR̴HvHH9wDHO E1Hy fDLrMD$ HL$LHEHLIAPHt$HHHmI.ϴHmH|$H/HK IL9y ~YH{(LAHi(AI~AIMKIHHuGHjH4IL;y |1A9u-L%I$H(L[]A\A]A^A_J,HL%L%1밅y鲳BwKH yH9Ou>H9Nu8LFL9G0HHvLOLVt!M9HHHNHM9ٳHff.@XfDAWAVAUIH@ATUSHHHHL|$1D$0LHt$4LHD$裒IHD$,Lt$1D1HHmHH_H\L9A$HIL HHuݶHuLLmHH[]A\A]A^A_!ʳAT1IUSHHHD$`Hl$PHD$H莹1HLyHT$Ht$`HH)H9H1HHt)Hx HL$`HtHt$PH|$`H4$HL$Hx H|$`tHH|$tHHĠH[]A\AWAVAUATIUHSHL-LGLHʳLl$P1LL腸fI1HLd$`LhHl$I9I9HH|$PH4$INLALEu;ֲHBHc HI9u;H5HHĨ[]A\A]A^A_ÃH5cBHc IHt'HSHDHs(I|$@I|$(LZ[A\AAWAVAUATUHSHHD$H<E1E1E11H?H)H9ELD-E1II9ECEC<$LLD$IH@ LD$ g@I0HEIL5 1AItbIt,MиA D MAG$ Dg4I@DF*DG ME D\GHD$I6AEB.GDIAF DLGHH9DM.AELXCt%@4GMA LGDLM.AECt%B4_TMA BL_DLLXM.AECt%B4_TMA BL_DLLXM.AECt%B4_THMA BL_H9*<$HL[]A\A]A^A_HIAEHH IGHA AG ƒ $@I0E7Ey $EAEHEtsH~nHEDHH-LLD$DHHЭLD$E1HLH<$H<$I菙oEw o1IH[H=H5H;>E1H-H5vE1H}L11L]E H9uLD, M"HAAE,LfD,7 HM*ADD7I9~HH)HIHff.ATIUHSHHH~I$[H]A\H3fAWHG AAVAUATIUSHxHOH;HD$HL$HHt$ 1Ht$詮MLl$ Lt$01Au~L|$LII9|Ct< LL}HuH|$NHuH;l$uLsM9T$uI$H|$HH)HIHxL[]A\A]A^A_HH;\$}At LL HuE\Hl$y1҃t%H;T$}A\ H5tHEtiHl$HHH9|A|, LAuHuH;t$uL M9L$.H|$HxH)[]HA\A]A^A_E1%Ht$DAWAVAUATIUHSHHXHHM4$L=CM91HL1uTL$$Ll$H]HHm(HHxtLLʓHuLcM9tHLH)HX[]A\A]A^A_L=L%qAML%_A{ff.@UHHHSHHu;H~jH9HH-1HH0uHNH[]HPHYHRAL 8HHT$R1jjhH HuHAWIҺ1AVHIIAUATUSHH^L$L|$0LLHLF HvHE1MI^1LT$Ld$HLD$HD$(IH6HT$L\$L` In H|$H1Mu'uIHE3D8ET$HEHyHt*LLHl$(HH[]A\A]A^A_HI9FuII)uLLt$(H;5tS1LLLT$^L$H$LT$MZAMbI E1M1H$A  HH=uH|$LLL$HT$Ll$LL$1LT$L9}AHDŽLLL$ILL$M1A8AMXIEMIxUHuMÿHH~M)H|$(LWVHl$(yE1L$GIIuff.AWAVAUATIHUHHHHHϧIMçII$1IuwL|$@HLIHtKHt$PLDŽ$Ht$@HuX萓IXHkHLLLIHL]A\A]A^A_Mt$M!I~L=9HT$L9LSڧLHT$HIHHT$I.HT$HHݦIMl$HT$HL$I}L9$L۷L[HL$HT$HIϦHHT$HL$cI,$HL$HT$IzI閦LiIPLA1LrXHD$(PjjH IH4%阦fATUQ HI@ @tLZ]A\H5-YH.I,$Hu ID$LP0HHu1H} HmIuHUHR0ff.AWAVAUATUHHSH(H<LaII\$PHA1L'HD$PjjH HHOLuH֦LmMLH L}M\IH5H9j]LIH6H褳I,$IݥIHH-HtLH3YH3L;-u^L蟤vHHLLLFH([]A\A]A^A_HZHHƥIH鵥>fåLMuHI(uLfPHHOLFH5bH81O1Zff.AWH]AH RAVAUATUSHZHHgHEHEـ H|$Ht$ HD$8H\$0HD$`HD$XHt$F LvAAA Hl$LUH@MH\$pLT$(HH\$ALH薧HH¤D$LT$(E1GI\$E9s/DEHIM9AAuGbHL9}AAE ZE9sE1L9AÃ|$D$uH|$ LT$(耣LT$(D$T$H -HcHHT$H|$HILT$(LMI)L$LT$(HH,I$G"H|$`IH|$XIH|$H8HĨ[]A\A]A^A_E E I9AAUC4bD#AHI@uHt$8LL$0ILHT$H|$X1HHH|$菼H|$`HH|$XH1LLU0LHT$HIH)H$H|$LLT$(耵LT$(HH1LHH?L)HLL$XLT$@Ht$`LL$(PL\$pASSATLD$(HL$PHT$XH|$@cH LT$@HHD111@SHH;Hr[uDSHHH?Hu4H!WAQMIHH8H1H5R9AXAYHH[HLL$L$ H4$LL$H;L $H4$H;tڢUHSHAQ@tsH{@HH{HH#H{`HHC`VLCPHPHKHHS@1LKXH5|_AXHS@HKH1Hs`HHHZ[]DATSQHGLg L9ţI)Hx I9HW H\ LH聆HtH)L`LZ[A\ff.fQHWHBHWHHH9w)H9HSH{ H9&LK(LS1HI)I4LHu 龢HӢHʢ ff.AWAUATIUSH G AAA @L0H_HHM}H96AHM,LLHM7L9s+DHHDIDWDQD_DYGAMOE1HM9IBLM9LCE1MOM9vCBIH LLutHL[]A\A]A_LH&AuLLLO,IK<H9rDMOE1KI9IGLI9MGME1O;M9vC;BxIA~HHf83NH$H 1H5WH:tH$H~A$E12Zff.ATIUHSHHHD$H1M~H}Ht$Y{HHl${I"HSHC H)HxH9~ 1HHI{0HH@@tH9t6JՠLCLKHK4ILCH[]A\!H{ H{鼠铠0u1ATUSHH8GpHHL`HL5Hs1LHHHm{1[]A\ÐAVAUATUSHHIHHu?H[]A\A]A^zL4J7HHA 5IH@ ƒ AAt/MhH@ILLO44L9LML$E1L)HHM9LMBHMM9IBLH9v'DeHIfEeL,}MIHL[]A\A]A^Ä@Ix0ILHK 4&0HH@rDHDJDPDRDXDZH9rHMT$E1L)HHL9L,MBHIL9IBLH9bDuHIEuB rHHJDJHH HH HL HGIHH@HLLIxHff.HAH)HHH9s%DD OD OD O AuFHAH9s,#uHttAADÁtu AAwff.@UHOHHWHAHH H HAHGHgGHHHt }HEH}8sH}XHtHEXH/+H}`HH}PHٝH}hHuH}pHuH]L@AHEhH/uqff.@SHH1HHC[fATUHHHFt8~ H}IuKLfM~ HHx+HL]A\H HP1H5QH9NH1]A\Ýff.@ATUSHLd$LHqHԖT$ t$H=o1H[]A\ff.fH7HH9v H8uH)HDHHDH|$薡Ht H|$H)HHff.AWAVAUATUHSH(H$HHHH9H $H<H|$PIH1Ll$hHHM4,ZIHW1LHuBIwLvLIHHt$HLI/HH;$uH\$IDH(L[]A\A]A^A_ff.fSH%HGHH H>HuQI1L;C[HK1H [DUHSHRyH;HHuXH[]yfATHHUHHHHHH/H5H}H9ٜ2̜H2ŃRIuL>xH۹HH]A\`fAUATUSHHHH+L%H}L9L誟H誸ŃLkI}L9LvLIH_HI,$HwHt[HDH1蛰HD$HHp Hډ蟉HHH9t H|$sHD$H[]A\A]D@ATUSHWHLHH HHC0LdHHC8HC0HSHLL$LL $萑L $E1D9~-fCnfAn]L\$If8?fA~]fC~Tҋ>1҅HLcL9}ruaELHLL $%Ht$L $1N91ɅHHHIfAn fAnEf8?fA~EfA~ Hǃu!E^H(L[]A\A]A^A_>Euff.AIP@@u D¸AÉйH5RIH4HcHsu6tAH>AI9IyN\HO\I)DL)HDAEFDGDf.AULiATUHLSH(AtH(D[]A\A]IIΗFdmDHt$HL$HT$肮HT$HL$Ht$uDHt$HL$HT$XHL$Ht$LiTHT$L9 uQH([]A\A]øJ7FdmDHt$HT$HT$Ht$uDHt$ӼHt$I|fAIP@@u D¸AÉйH5rIH4HcHsu6tAH>AI9IyN\HO\I)DL)HDAEFDGDf.AT1USHH`Hl$HH0L#H5PI|$H9mLmAă^H{1HuXCH蒒HT$ Ht$DȌHHٕHH|$tH蓹H`H[]A\驕ff.fATUSHHHHt$ (|HkDd$ HH9HuHH{HS(HRD$*HH[]A\fATIUSHHH H+HHHHHtfL'MtHtQHoH5ɪH}H9VIHʕHsH{ LxH []A\ùE1fE1UHHHH5-H9uHUHEHfHnfHn][uH蟇Hu3HuH~)$H$HD$~M )$H(f`)$$uHff.UHSQGyHEHyHՔHiCBHHH9HGZ[]UHHH;=AE]@SHHH;=!C[@SHHHsH;[鐐SHHHsH;[pSHHHsH;[P11H5ATIUQGf. zt111r舳HHAD$11ɿrbHL`H5^IHLH=^14wLIjHjLZ]A\f(fT = fV f. } _YG111rܲIH5L~P1LLwff.ATI趑LA\H9HxXH5^1dAVAUATUHSHHHwLMHF`L9tRIQ`HtIH H9JuHL%nHmo!L4$LM9V$M|$IM7ABE1xL-H59E1I}ߜ0+鴋AWAVAUATUHSHH|$HH)HǎHHHH0L?MՎHfH5>HLD$IXMp I9Ht$P1LHt$nULL$PL|$`LL$MA L9LNIzI1HD$D8 IH;1E11II9}WHs OII9tG:<.uLHT$H)LHT$HI HzJI}IILHH9;H)LHT$HSIHҋHT$H kI\$HHIT$H|$謢HĨL[]A\A]A^A_LgH5I|$H9}LYIHHu{ImHHHL$HYLq HtH5hIt$H9~eHAH)HH!HIHLH4[]H)A\A]A^MvI~xH5ԁH9u I~u"IV( [L]A\A]A^O luLHMH5H=9蹘[1]A\A]A^ùLH=9stCAWAVAUATIUS1HHI1HAPHIHH *IHw1IAHH詳IHtrM~IxA(IP(HHIL$HIt$(Ix~MH(ILM~#IxA~MP(I\$HILZL[]A\A]A^A_AQH~H~E14E1HLILZDHJAIAUE1ATIUH,7SAP IM9}HxHH)AHuZL[]A\A]ff.@AWAVAUATUSHHHH(HH~HVHHJHL'H5I|$H9~i~LۂAŃe~LcM~L{(IcM1E1HHH)H9~HA t@A t:IM9vGEA uE~HL47HHLTL9X~I)LHH)L9A~I1HH)I9$~L1HIHHx.~LX(H{3~H[(1McA3HMK@ tU@ tOHMI9v}3@ uE}HMƾ LHLD$II)LL:LD$N 01HiHRE1L+HT$ R1jjH HH9E1H(L[]A\A]A^A_A[f.HHwH]}H(gDAPHAHbSHt%HHtY鴄H{H55H8辄1Zf.HwH|H(}f.Ht0HtHHH9v-L]AuH~HH@tHHff.HwH|H(7f.Ht0HtHH9v3LAtHH~HHtH~Hff.HwH|H(rf.HHHHH9s'@t?x(HHH#uHH9rH9uH!~HH}}HHwH{H(Bf.Ht0HtHHH9v-L݁AuH}HHtH}Hff.HwH,{H(zf.Ht;Ht*H1H9vAHauuHH|H7H=5<*AHc"AfHwHzH(7f.HuHtH|HHtHH9vLǀAtHH|Hff.HwHDzH(jQf.HtdHtSH1E1At;t?AAHDH9vNHED AtЅuADE1Hk{H7H= <@Ic?fHwHyH(2f.Ht@Ht/HE1H9vEHuD HDHzH7H=<u?Icm?ff.fHBAVIAUIATIUSHI.H5zH}H9%c5yH襌HH yH`HmHxHxI !IuH9~IH)L1H[]A\A]A^ MvI~qxH5AxH9u I~u"IV( [L]A\A]A^wbuLHH5 H=J0&[1]A\A]A^ùLH=&02jtff.ATUHHSHHFtc~ qHn1H9@6{IH9u H[]A\Hq1HH1M7I,$uLHD$ pHD$HH H5' H=#&ń1룐AU1 ATIUSH8A|$ HHt$kqAD$ Ml$ƒ @ bqI\$0LHD$ HD$HHHt$$H^HHqN+7L-ep AD <we{AT=HHЈFL9s'L sDCtD[HCuI9wH1H8[]A\A]AD$ p@pI0L)HLjH5M1I8@H胡1뮄pIH1҃L9}Ãu-A<xHAD$ Mp@I/HkPH\$ LIP9yI9uLt$(L9t$oHXL[]A\A]A^A_L1襜IHtHx=oHx(Hu8LkPHl$IL9zHMHuHPL`(MlLL$E1MtLHIII1IIPL9u%Lk"fKff.HpAU1IATIUHPHHHL2C{nCHPnL1H(IH|$tHwHPL]A\A]AWAVAUATUSHAPnH8qn,IAHX{ oHCPE1H H{h1nXI{$HCpIl$HCPEHC@AL)H+LnoHHCpH{h AZH[]A\A]A^A_H9kx}HGHHx oiff.@HHwHt H(khH=gfHWHHmHzH+xHHif.AUATIUHSHAPHmHLeMmHLmI9xm}0%qH}mHM(LH<HtH)D/6RIt$HYA[]A\A]^M,$H5FbI}H9jmdK]mLtIHpmHII,$H&mHPmLeMlH,Z1[]A\A]IIHtH1HH9mH= LL% f.HHwHlH(1HHHu1Hff.H; adIIIL `"tHALHH=h_LL1H5H?3ATIUSHHH HmHlHzlHHnlHtoL'MtHtZHoH5`H}H9&lIlHblHsHlH{(L.H []A\ù׹E1fAVAUATIUSHHHHglH(mHmHHmAE1H4mC(lHsFlHsH OlH{8DL-HHH[]A\A]A^f.L;f.ATISHQHH5K^H9u"HsHmH{(XL[A\TkHuZ[A\"BfAWAVAUATUSHH|$8H$HuH|$p1IH|$IH$LL߉$DŽ$HD$xHHYou DŽ$H$HzLAHD$HLopHt$`Ll$Mt*I}5xAu H;=/]wHD$D$4H\$8MI;%Lkt4L%L MHtH)IHHLM)HHHD$hD[A%MA(wD$ LE1MgMD HEQAwLCAIc LEA*E2t9McL0CD~tA.tIttAIAM wHHmHt$H<$HT$`LT$(&LT$(HIMkAg~YAMw$AIAA tU LCHYD1L+D$8DH5ZH;B/mAD~Au"wHkLc IAI~kIMFMN Lt$hEuA M9MMMIuH|$HIWLL$@LD$(= HH|lLD$(LL$@1ҋ|$ tM9iA lUjIsqAFME)DmAtGtfFtqLd$L9d$`} H|$q|$4iH|$H HĨ[]A\A]A^A_I1HHuK|LJ|H}HH)H)LHHLM9!iH|$qH|$hIvH;5]tItAtD$ tAX5oAdAAtL"Oc,MAL $1MQLT$E%HIHuI|$uIL$(HuH9HHNL$H)H|LNHH[E,$HH[]A\A]uff.@ATIUSHoHuHHHHH9uHLHuI|$uMT$(HiuI<*AI9}LHII$L[]A\DAUATAQLgMt-LoH=/AXLH=iHLA\1A]dkH=.ZH=JA\HA]1BkfSHHT>HtHSHtHtHJH9HOHCHJZH[ff.AUATIHUSHHHHHtHMtM,$HtIl$Ht[HUtHHt$%HHtHN/H;D$tHu1HLHH[]A\A]IL$HqtHt$H$Ht`HHD$.H;D$ptHT$Hu1tHYHPLA1L HD$(PjjmVH IH1fHAUIATI1UHL(HtLLHH]A\A]]=]1A\A]DSX~HtHcH\H(sHH[ATHBIUSHH HI,$HU} s1H1HLe1jHHH LH=1[]A\hI|$H;=XtHOsHt$##Ht@HHD$q-H;D$WsHt$낹HH=k E:H 1[]A\rff.HWHH>sHzH+x0smZff.fPHGH5 H mRHP1H9&HZfAWAVAUATIHUSQHLhMt$HMBsHX(MsM|$(0WIHrHAILLL9HHrLL11ID$11ID$ քID$(,)H8rHmuHdTZL[]A\A]A^A_E1ATUHXHH+xTHt$1yIHrHxHT$rHx(CH +XrH`HXL]A\E1ff.AWAVAUATUSHHHgHLxLkHMkrHP(MBrLs(HT$UIHrHT$ILLALїHHy`11萃11ID$肃LLID$ rID$('HqHmuHSHL[]A\A]A^A_E1HLL+LI<ID$H)HEIl$ ID$(c'H9qAUATUHHSHHt$ "twLeT$ M}qLm(LL_"HHBq}0_tMI|$H9n[6nL[OAŃanLeH] Ic1HHE1III)H9nHA t@A t:HI9vGDA uE~HLt5HHML9mI)LHH)L9mI1HH)I9mL1|HHLP 1McA2HMJ@ tU@ tOHMI9v|3@ uEwmHM LHHL$II)LL\HL$N 01HYHRE1L˱HT$ R1jj*LH HHY1H(H[]A\A]A^A_A|ff.HHwH HwH JHwH SHwH @HwH sHwH CSHwH 3HwH !HwH #HBAVIAUIATIUSHI.H5JH}H93lHe]HHilH1HmHFlHIlI 1IuH9~H)L1H[]A\A]A^[L]A\A]A^MvI~tI~kAN H5HH9k53kLHtH5H=_[1]A\A]A^kLH=:tff.ATSHQHw1yIHtHSHs Hx %:LZ[A\ff.fHHwH HBAVIAUIATIUSHI.H5'IH}H9E2dkH[HH9kH/HmHkHkI 1IuH9~H)L1H[]A\A]A^}[L]A\A]A^]MvI~tI~jAN H5CGH9j1yjLHH5H=q@^[1]A\A]A^jLH=HG9tff.ATIUHSHH[jH~I$[H1]A\qHJfATSHQHw1wIHtHSHs Hx 5LZ[A\ff.fATIUHHH~H5hGH9Rj0EjH ZHH jH&.HmjHt[IT$H9HL]A\̾H)й01LHHHiH|( q@tH]A\ÈH 0iDATIUSH^HiHHA1LHH5HmiH[]A\HWHw 1H=*Zf.UH=H{iHH??H]i]@ATIHUHHFtX~ Mi15L;%GHuH]A\HAi1HL1HmuHHD$FHD$HHH5H=[1ff.fHHFHh~ hH DAWAVAUATUSH8HGiHoHiG  ziLgH@eifvH|$0@H9)D$HOH)D$ H{hfA<$@E1E1ABhC4DVahtAA B|,t:|40t(AMcI9}2uC4DFAvhD|40AF\,AA@AADg@gEED\$ AAMcMcK|?L$3IHgH5.H/M]8T$ LLE}4L $foL$AU0MEK43AMfoT$ AU IIME1P gG tAt6EDA CHL؀8t)ADHLcI9}uG 4D8AH8L[]A\A]A^A_IIHLJDHHUMA<$@AVHBAUATUHSHHHhgLmIUA} gHH}L5sEL9[gHOgHt$IH gHH;D$)gH7gHuL9t8LLIm HHfHHH=h1[]A\A]A^U1E11fff.fAWHAVAUATUHSHHL:MoH9Fu?AHHpAqmI9mLhL+Ed 1H[]A\A]A^A_JIH*mH;ID'mHPH3#mHI9lLHmH;LOL D= M$1MZM$Mu5mHA AjmtFD2=bmH|8FmDR0ADHD8%m1HHHu1Hff.HGSt HlHHlH[HG(H+GHpHLH$VnLL$L$LIGIMMO L)K|%.nIG(HVkAW11AVAUATIUSHHhHl$HHL~CH$4kHt$Ld$ Lk HT$LsHt$MZkH$@IHH$ILLALƂHjHLH$NmLL$L$LIGIMMO L)K|%&mIG(HmjH|$tHJHhL[]A\A]A^A_E1ff.f j @fDAUATUSH jG LoAAA @toH_0Iu AuU;uPH[Hc]A\A]S1MtDI9~AuF<+HPt,HH=HH[]A\A]At';H_HHQ<HAjHD$8HiE1I9K|HWH|$@: iHt$@F Lv i@iHF0E1E1M9}hB<.„IEHH|$@LLl$8LD$@ODIPH=BIHiHD$8Il$LID$/LHXL[]A\A]A^A_1LD$8LH5/-hATAzHD$HcDT$H|$8H/uZ9E1Sfff.HHHHgff.UHǻgHMHUHAHH H HAHeH}HExgH}HtHEH/u8HuH]L@Aff.QHLiH8H9FgiH~5iZH;AT1H01Ht!HI[H~LA\I,$3iE1HG(uHWBuH4AWAVAUATIUSHHT$HD$fHnfH:")$G(THOHACL8H`HIHDsXETMss\JiH}LG`M4H;=9eiLl$0LLThL$HShLLL{pfo $H[xH)$HD$MLD$HiHLiH$LLL]L$L$LLqH$H$gPj$$LL$PL$H$H$fH L CHD[]A\A]A^A_I`gH o5HH1L$HH&gHs8L1!uHHu#AL9UgLH^xHHtLLvAiH4$8uLc$HuHwuu>L 2H5AI9:*L=1H5[AI?: Ln8H5I;o:QHc2H5LAH8P:AH;2H5RAH:(:AUATIUHSQLoH(H^Hv(?@@*g+u%I9u LH8AEtZ[]A\A]H0H5 H891fW$;V$f19~HO0LF0L M; uHMu1f.G$HW@HHfHN@HfLG8HI9<fF$LV8E1HvHI94ADff.f1 ff.Q*hgH5HZDAVAUATUSH1HBH|gHL5TL-`q LLH11IHH;P5gH@ngI|$tLH.*I,$;gyfI,$gH 3HH9}GHmIuH2HL[]A\A]A^5NHmfH2f11H5pqATIUHSHHHgH~WM$$H5U1I|$H9grgLCHHkgHHmgH{H{8g{,gH7gH{h1Ff{$HCptHPH|fH(ef{ tHKPHffHCPH HHAfH#fHC@H{8*IHCpH{h HL[]A\flfHfH0HfQH8fLGMtHGI(uL0H2HZH f.HfH0Hff.H(D$t%D$tudM;D$D$H(T$f(T$G7\$f(\fT A7 f. Q1 zuE1 Y7Xf/^6 D$r D$f.HOPHw@HeHf1/UHSQ5?fH1H96f11HHZ[]ATUH-SHLc@H;tHHL9u1[]A\H} HeHfAT1I1UHH=S?eHW01HHXLH{@H{PLMe1H{8HC@HCPK0蕭Hk@LcPHle1H{8@Ɖs0[]A\ÐUHHH3?H]H.@SLIL7HIHHL؅u,HHfPKfHSfPKfHH9rHH_1H)HPHHHH9HGHHH9HGLH4I9I)E1MI9MBLI[HHfPKfHSfPKfHH9rHH_1H)HPHHHH9HGHHH9HGLH4I9w(I)1MI9ICHpfHH?DAfDHHAVIAUIHATUAPyIHc1HLHHtYH@cH}cLuII,$uL,Im}cHmuH,ZL]A\A]A^LH5dH=1WLE1IH|$tH8HhL[]A\A]H[H5*H{H9b7bH7,bH|$Ht$ tE1[LD$QE1fATI1UHRSHH`Hl$HHbH;1HfCHbIH{H;=l,xbHwbHt$HH#bHH;D$aHt$ H|$HrHT$ HHt-H=z1f(5D$|D$ " I"f.CAHf.D$w"fTf.wD# Yd( L$D$뺐ATIUQH[HLH}HmAuH!DZ]A\ff.H HH9WuHGffD$fL$f(T$fW) )T$L$D$@fD$fL$f(d$fT$f\$f\d$)d$L$D$f.AVAUATUSHH#H9G[HIHHZHxHT$HHD$2ZLt$MttIH=UIHZHHXHEHhIMt$ LAD$(1H|$LH47ZHL[]A\A]A^H=`IHtHI\$HEIl$Zff.H9!SHXHHt[HtH[UHfHYHHEHYH H}HMHHHrfHnH HfH:"EHJH]ATu6H=xIHtAD$(fID$ AD$LA\L%onIT$ LID$ HNqff.@HAATHt HILA\PIHY1}ID$HXH=ID$ uI$L%ff.ATH= IHtH@ fH@/LA\ff.ATSHQHXH=!HIHti1HHXHx HI1HMI|$IL$HAD$HHrfHnH HfH:"AD$HJH&XLZ[A\Q&XZff.H t5ATIUHSHHDƒWH{I[L]1A\Dff.AUATIUSHQHG IHWHxLHHSHWH}HEH/uAoLc 1f:C(Z[]A\A]fDATIUHSHHH D$o=WH{LLL$I1IHWH9CWHV|$HS L`u HP H []A\HQ HWHH 1ЃVZff.HG8ff.AVAUATIUHSH0HGH;VH0[]A\A]A^ff.@AWIωAVAAUATIULSH8GT$AՉt$ALL$AA^!DDkLT MuNL$M[LLLT$t[HT$u8HEHA|$ LD$XHL$PLMLLI\$GIuHH}11HHH@VHL$`1HT$HH5MfVHD$HPHVHL$`HHUH9UHHmu HHD$H[]A\A]A^A_1LVAUATUHH0HLfH0I9Ht$HHt$ HHIHHt$ 1H+t$IHVH*HT$I|$HML$0H)HL$ H91VAL$ AȃA @t4@UEU@H^VDVA#JI|$'AD$ ƒ ujJ@JML$0A1HhI,$mJHH\$(LH=tBH=wJH%yWJyJMD$H@bJA0uI,$ JL=H5:o1I?hLvH|$PvH|$XvH1Mg0)A4A4AFDXL.GD D@H6PT A  H=f\xAӃAHLG,DhLA4@pLg0H(11[]A\A]AAЉAAAAA AH5AH @\U00AL.AGTDPL.EAATPLG,DhHFD@LA<:@xGDX4f\nH&f\rHf\\H f\tHf1 ff.ATHLL$LD$bHtbL6bL.bHHQHH[]A\A]A^A_E11E1LHIHu|H=H11HL>IH0?L[HI0pImI?MELHH/I,$>Hm>LuHHrE115f.AUATIHUSHHHHH*?HM?M,$H>Il$Ht[HU>HHt$BHH>H莹H;D$>Hu1HL0HH[]A\A]I|$HOM>Ht$Ht`HHD$3H;D$=HT$Hu>HYHPLA1LbHD$(PjjH IH1iH@AUIATIUHLeH>LLHH]A\A]ֳfDAVAUATIUHHt$XHT$`HL$hLD$pLL$xt@)$)$)$)$)$)$)$)$Lt$Ll$ Hl$(LLHeH|$(H )HW H9H uXH9(H5H98L(L9G(nLHLLt$ I~H_uLOLM9QHL貦Ht$Ht LMOHt1L}XH|$H/ff.;ff.ATSHHHHtn111^IHtiH{HtII,$>~7H{HtHCH/uH{HtHCH/H>E1HL[A\HH8Bt)H{HtHCH/=H{HtHCH/u=fUH觓H}LHEH]H@ff.fUHOHHWHAHH H HAHgHGHKH}KH]wATUSHw=H*?>HR01Hc H1H= UIHn=H{H5HHW=HH53L{<=Hm=H{H5gAGHH=HH5L9[L]A\A]A^L7HI1LIHs>L9}H|AHV>IT$HHAUATUSQH CHBH/1Hc H1H=~IHHc{8zHH@HH5t"L,x@HmKHc{<@HHX@HH5L>@HmKHc{@HH@HH5pL踸@HmOHc{DHH?HH5L~?HmmOZL[]A\A]H=y~IHCHkH*NHEHH5!L$o?HmCH{gHHO?HH5AL4?HmvCH{H5*HH ?HH5_L觷>HmACH{ H5sHH>HH5}Le>Hm CH{(HH>HH5"L*u>HmBHk0HuH-HEHH5L:>Hm]BH=G|jIH&@H{HH=HH5L藶=Hm0FBH=o|IH?H{H5FHH=HH5L8=Hm;H{[HHc=HH55LH=Hm:HkHuH-HEHH5Lµ =Hm[|: ?@AUATUSQHLHH=vy11IHH;L-LOHHLHH5LALHmLH{LHHLHH5[LLHm\LH{FHHaLHH5LȴHLHmLH{LHH#LHH5L芴 LHmKH{ L-LSHHKHH5=LEKHmwKH{(HHKHH5L KHm/KH{0LHHeKHH5L̳LKHmJZL[]A\A]ff.fATUSHHH=qw11 }IHH+H~KHEHH5LQ9KHmFKH{tHHKHH5.LJHmJHkHuH-HEHH5L۲JHmJHc{HHJHH5L蠲JHmUJHc{贿HHgJHH5>LfOJHmJHc{ zHH-JHH5L,JHmIHc{$@HHIHH5LIHmIL[]A\L%I$fAWAVAUATUSHHuL%~I$HL[]A\A]A^A_ËHIHs'1Hc H1H=vzIHLHkHLHEHH5fL.LHmvMHkHuH-HEHH5L{LHm.MHc{ HH[LHH5L踰ALHmJHc{$̽HH!LHH5VL~LHmIHc{(蒽HHKHH5LDKHmuIHc{,XHHKHH5L KHmV)IH=tyIHfKHkHIHEHH5. L趯>KHmH{HHKHH54 L|KHmJH=$txIHJH{HHJHH5\L$JHm{UHc{7HHJHH5! LqJHm#SH{ HHQJHH5 L议6JHmTH=Ns)xIH JH{H5]HHIHH5LOIHm\9GH=oswIHIH{UHHIHH5LIHm G{{HH`IHH5UL轭EIHmFH{HH%IHH5z L肭 IHmyFH=2rvIHHH{HHHHH5 L*HHmQH{H5KHHHHH5@LpHHmZQH{H5S0HHIHHH5 L覬.HHmSH=.q!vIHHH{HHGHH5 LNGHm#EH{XJHHGHH5 LGHmD{WHH|GHH5 L٫aGHmDGff.AWAVAUIATUSHH(HL%dLsfInL) $裿HHRE1M9}J|UHJDILifHnIfH:"HRL11I0L9}MDH1MLHItM01)d$LA0HRfoD$fo$@ XI$L`0H([]A\A]A^A_HHH9BRHRH~HHuH5tIHHuLL ZH5]H$I9GH$L%HmH$QHH$`iQUH7H} :H}(:H}0:HEH]H@ff.ATUHSHH~tfHHE1L9c HH[]A\JtHeeHMHQHUHt"Ht IHHHD$IHD$Hu\QHHH[]A\$g@SHHMQHsH;14u HH[1[ff.@AUIATIUHSAPH`HuAH]0Hu HLLHHY[]A\A]H;Ht LAԅuH[HAԅtPPHHHHu1ff.AUATIHHUH HHPHPHHPHL/MPHHoH5̸H}H9PxPHjHHPH膟HmHPHt|L;-t0IuvPLL]H ]A\A]HH1L?HiHRE1L!HT$R1jj芸H HH1OAWAVAUATIUSHH8H<$HxHH$x VMA|$ VH $At$ M\$A AHiAE@AADL$ADD$E9L9L,$ zS@M}0@ 'S@@I|$0H|$DD$D9D$ "@UAD$ @UMM H9HNHIXHT$D*/IHHE1HHxMHtHHHrIHH XPMGM4HIoL耽MMtwPRH={莺M}H:L\$ IH[Lt$ E1H\$ HHL9l$ tZHT$ILHALX$IHx5I<H)LHnHHI hLMKILMIMnLH1IHKI MD$OTPSH@H<uMO<tMw<0fMDGA-t A_MHDA8uM1[A1tyA3M2MDWEA-u9HD_B<eUMKM?8btlt0MA_t6M[À6MWtS-t _MHO<eLL7D0AbtAl L[ø[ø[ff.fAU1IATUSHHRHhHl$HHLI}Hwu}1Hwt!E1H|$tHHhL[]A\A]þCH$LHSLHt$ H|$HT$ HHtH=?1(IHt$lIHtHL$IuE1HAHTifUHH3LHUHz|L]HBAWAVAUIATUHSHAPHMM}IH;=H5܆Aą:MLYIHMHuI.ILILHL{HnL{ILLA%LMy=EKMKAKAKL{LY[]A\A]A^A_$EtLATUHo8SHH C0HLHI]LLH迂uC0L[]A\qLATUQH?{LHoHGHHmIuH|LZ]A\@AT1IH=DUHȦLHH`Hm1LH]A\t+w v1Á( 11 øAUIATIUHH@Ht HAԅu=H}HHt LAԅu/H}`HtLAԅKLLH]A\A]BKKHKHI|`ff.S1HGIAsKH{80TH{XHtHCXH/KH{`HeKH{PHH H9Jpu1HBH9HpBLd$LH5EHH\$xEHBH5H9ppBL5{Ld$E1LH5HHl$6L9t H[]A\A]A^H{H9}tI.?BExBfSHHBHsH;[pDAWAVAUL-c}ATIULwHM9t L;5yuZMt$M9t L=yM9uLH]A\A]A^A_aLLeuLLeuHzH]A\A]A^A_LLeuH5hyLetf.ATUHQH`)Ht)HHI-HAH(ALZ]A\E1ff.fAWAVAUATIUSH(HD$H9wLnL;-ZzHL5xM9t@H5&|I9t4Ldu(LLduI|$H(HHu 1zHEL|$H\$@HD$LH0HPHt$H$O AuH$Ht$L$F%AHu(H} LHYuHmtH~HH([]A\A]A^A_H |ILt$Ll$H\$MLLHH脏tJHt$H$LH@Ht$t H.u@H$LuE@Ht$H}HcaHr}HNHHt$HT$H56!Hff.Hg@HWHB`Ht H@8HtPHRH5S1H *xH9L1Zff.11H5鰹ATUHHH@HF"@H~@Lf HvHH?HHLcHm?H]A\AUATUSQH@HGH @HkH耉IH@E1L9~"r|H@I|$JIH;k@HS AHrLR(HA@IH[(IH#@IZIE1L9~2L+HMt!It$IJ HIHQIELi IZL[]A\A]ff.vfDPHxvH54H8i~1ZDATIUSHH@H-vH|$HHt$H9oc)d$0H\$H{H9HaHt$ H|$?L;%zkff.\$(D$ IHT$ H,HD$(zufH*f.zD$0L$8fHnfHn$L$$z L$A<$f.Af.ix AE!f. Zx AE;f.1"!$L$WH@[]A\HOdHt$0LD$8HH>fHnfInHf(f('  ' $L$%H_YHt$0H|$^L>o{)|$ qfHnfIn$L$A$H-GvH5H}|1L%sH52I<$|1+>!t"%>ff.@fD$~5} -} fEfL$fD(l$\$fDd$)t$DfE(fE(fA(fEfE(HH9HtSfAYf(fA(YfEYAYAYDYf:f(fD\DXD)l$DfE(Af(fA(HYAYAY\fD(DXfD(fEfE(FL$D$ff.Sff(f(H@f.E„tf.Eʄ:1L⾚Hmo$:H}8LLLGpMhLopo9IwHbHH9MVSLcM9MM9u6M~E1McM9II9}.KtH=-9ALHtWHX5HXQ9H}81LH_poxLcLgpo&9QHjX9IHUX8H5^qH~8HH)X8RHX8XHW8Hm8mxZ[]A\A]A^A_þHWs8n8i8f.H1H5c1|ff.ff.GzD8fAWAVIAUATIUHSH8L-rHt$AAD(ANIADuAHt$(1LH4$ $f.bv H4$f(zH\$(L9OD EQA1H$#f.v $z}Lt$(L9LA߀JI^f ADEt)usHD;CDP7)$H)H;\$uQ1LA$0Ht f( $HH8[]A\A]A^A_E1AfAJuf(HfpH=%iH5H?&r1Ht$$A$Ht$HHhH;qA6TnHt$$A6s ~@EAAJnI^fH;+s A6LsID$@$D$HdL;hI;@5mD$$8@+t8t ISff.@PHhH5'H8p1ZD w&wntfv't\1Á_ w3' w1à v/1HH101øff.USHHHH-hH|$HHt$H95oc)d$0H\$H{H95o[)\$ f(D$ L$8T$0fYT$ f:fYf)$$L$IHH[]fPHgH5H8o1ZDPHgH5H8o1ZDAT1UHHH5e&HXHT$@=V5Ld$LWHT$1LHLBESLt H*HX]A\f1AWAVIAUATUHSHL9L$HHLA>E1L5D$Et?AM)wHHu%IvDHvH[]A\A]A^A_H$H$fLH|$( D$l)$)$H-6$0A5$=5LK:f.#q f(z3LL$9/f.q d$f(zE1$AAEAn5AD$$AD$XHL$pDDDf(T$rHD$0IH|3D$DDDHL$tqHD$8IH3L?LH?LHI"IHu3LL!IHv3AG ƒ s33@3I0?-AAD$ EAALT$AA- 5@ 5M\$0A;--DʉD$@HL$Ht$HL$xHLLD$dHt$LLH$LD$h$n4$H$Ht$iTLh D1H$ LL$lH|$PL$IHDŽ$AQLL$Pt$0t$DT$|ARL$HL$0bjH IH$4|$XL$D\$hH|$HH$M1DŽ$+HD$HWHt$0t$ASHL$8T$`iH H3Dt$$LH$H$L$L$CT6Hcڋ$HHL$fnl$lf~LH $ H$9U3HtHLD$(SLD$(HuDuL$$Ht$(MMt LH}Hu LHLD$@LD$@LE |$$LE |$Xu-PE1E1LjHt$jHL$0Ht$p?lH t[RE1E1LjHt$jHL$8Ht$hlH t.HU Au~H\$(|$$jLM IIHM )Lm H|$0D$%H|$8%LLH|$IrD$D$$D$XAr1AL\$(LAjH|$$HU p1f.%j zD$$D$XbE1ArIHu H}L‰L$\LD$@;L$\LD$@Kfn$f8?f~f~l$lAu)LT$(C(HE LLt$(CD)HE AH|$(B(HHL[]A\A]A^A_@f(fTj fVHj f.@j  D$$D$Xd$D$n7d$T$H-H$M1H\$HWHt$0t$ASHL$8T$`ffH H-E1c/R.H0*0ff.HHW IAAA E0@U0HO0H9}DA20DHfBtHAu1<.u HH)A8I210HHx H9HHLI>uH)HI HH)IÃ^t<1v/H)HHE1ؖHg]HrH8^/H512GOH=>uSDLf.AV1AUIATUSLwLHu/HH@P/1LHIHtvH5H3u=LLH=HP.IH5I,$t [L]A\A]A^LZ`HLIvLH=U1IH.I.ff.fH'>ff.UHH1SHH9.HHH.H[]dDQH;=_tHHt,HZHHuH=Y'>@@H[]A\A]w/>tL1YH5I;a>AV1IAUH5ATUSHPLl$HHD$LHL$Lp/H|$HHLLD$0>H<$1(HHHǻIHIH<kIH>HHLHLHHtH8!LIMHHPL[]A\A]A^=oLH"4GE1I9vI>Q>fDAT1UHHSHHHu->LC LKH1LSL[HT$ WHKHAPLC AQLKARSAS-H0Dd$ AlCSA$DCL JfnAf:"fnfA:"flCL9MuH}`L%~\L9uH}hL9u H[]A\jHC0Hu1)HC(.H@@H6\H5)H;G_1QGtf wsO tc;?=wewtAmDZGAGG HUH5H:^E1LUH5;I;^E1HrUH5 H8s^E1HWUH5H:X^E1kH=9UH5H?:^E1MLUH5I8^E1/LTH5I:]E1fDUH=H;H(H*;Hm;B-H;HzZH]ff.ATH UHSH{;HC};H`HAH`H/Q;D[]A\AVHBAUATUHSHHHHLm#ZIHh;L>HH-L5HT$HLlX:H|$u;HTHmI;M:LLL/.HD$H;Il$AH|$I9|H/u1WHL[]A\A]A^111H:KDILeH5UI|$H9t:>g:LthIHtaH9H6HHt,LCHEH9EHHE fLItLZ]A\ff.ATSHH=3Q5IHt H@HH@ HHXfLZ[A\ff.fATSHH=Q]5IHt&HCSLHID$AT$ID$ ?fLZ[A\UHH5HPHT$7t/GHl$H|$HF uHzHP]1S1HHHD$HT$'t4H|$Ht.H;=vVt%1HB&tH$HH[11hH$f.AUATAUHSHHHH5SH9utHC$$f.$DD#H|$$$[T$f/RT rQ PT f/rCH,E1HHD[]A\A];AŅuHHHu7(HEHxUH5AH:XH lOH5eAH9iXATSHH=3QIIHHc{HlaNHc{ID$HONHc{ ID$ ANHc{ID$(3NHc{ID$0%NHc;ID$8NID$@CHcMHc{ID$HHMHc{ ID$PMH{0H5ID$Xx?H{(ID$`MID$h'H6LZ[A\ff.@UHHH]fDHH 7LGMtHGI(uLQ1Hff.AVAUATUHSHHHwLMHF`L9uRH6H5H9p L%NLt$E1LH5HHl$=hL9tPH[]A\A]A^IQ`HtH {H9J uHm6H9H t:Lt$LH5wHH\$gH{H9}tI,$>6Eu.L@6L% NALt$QL%MI$LYUHH5HPHT$t$Hl$H|$HA)uHUHP]1ff.ATSQGJIHtLZ[A\%H6fDATHHHD$Ht$T+6Ld$1H5MH=IL`5I|$ =T5H=>Lv<5L%QI$H|$HLA\ff.H(HH51ff.fS:Ht&H;LtHXHH(5HbOH[ff.fUSHH8H- NH|$HHt$H9$CD$(H\$H{H9-5H75Ht$ H|$=l$ ff.z5T$(f(l$f($A!4$fE|$fA.f(f(\^z4fD/fD/84fA.ztLf(L$$YD $L$D\fD/ =O `4H=L ~@H8[]^f(fTU H 6Ht$(H|$6HD$HD$UHH H@HHV+4HD$H4fH*&H@]UHH5 HPHT$t$Hl$H|$H%uHHP]1ff.PDOLHHcWHcwAlO AQDI4H1ARDODGH=^ HÐAWAVAUATUSHHHHHHl3H3H3HH3H3H5NH4$HD$0`IHq3H{(H L|$8Lt$(Ll$ Hl$0bHt$ H$HH虂HD$(HH3HL$8Ht$ L&H|$(H/ 3H|$ H/32H{(H MLLHw_uHHL[]A\A]A^A_ÐAUATUSH(H|$.3Ld$Mxf%Ll$ILLwG2,1111MIL'2H6MHH([]A\A]H8GH5H:9P1DSHHHT$Ht$w)~D$AHcD$fH:"E21H[ff.SHH2HsH;[UPDSHH2HsH;[$DAVAUATUHSHHHwLMHF`L9uRH2H5H9pL%TGLt$E1LH5 HHl$`L9twH[]A\A]A^IQ`HtH {H9JuH2H9HtLt$LH5HH\$`L1L%FALt$mH{H9}{I,$1EuL%FI$LUff.fSHH2HsH;[DAȹ@BfDAWIAVEAUIATUHSHH(HH5GH9t;1Aąu/HoHIEH;1H(D[]A\A]A^A_H8f.fH|$I*T$PDD$D$YD$D$D$D$L$f/L$\$spff/w>t$f/5H r{=H f/rmDD$H,E1I,HIU;l$t$Xl$\5KO l$t$\\$5/O Xt$\$t${H IH5AH9LTHEH=CIEH5AH?Lfk{ff.AVAUATUSHHGHD$H$!0HVI 0HHT$H_H3^)iL-ZKH<$Iu-HH/HLHHmAHl$H}MI|$xDEDEuu;HH|$HfHnfH:"$@H[]A\A]A^EyIuHHSIHmuH1FLl$M//H<$LHxa IH<$H/uFL$$M`/HHmIuHEM.L IvIHE1H|$>H<$51ff.1鹤fUSQHG. H\.C Hk@tTHvHH.S H uEHsHx @ I.@@L@HtL@0LZ[]Ã<0.<E땀@HsHt-DATUSHG.HG .HHd.H9wZ.A@A>.C @@$.ƒ .ED9-ƒ -u"%.LSH@.fE$j[D]A\T-ff.AUIATIUHH@Ht HAԅu/H}HHt LAԅu&H}PHuLLH]A\A]@---ATIUHSHH H .1HWHGFH9E-HT$H-HD$Ht H []A\HBHHD$H:HD$-fUALʼnSAQHAHHHCH;?J-AECADAAtVAE1A!EGNL LكH\ M-L^G-uH]H[]øf.+!ff.UHH}j-HHEH]H@LGMtHGI(u PLA1Z1fATUHSH_ HUHH9B0 -H5BLXA$1,A$H~OHr H| ,H]H@Mt&A$I$A$t,[]A\,H,HG ,HGÐSHH"Ht*Hs1H9~HL HtHHL HSP[fHHe,ifHwhH1H=Ukff.HG(HpH8PIHM,ff.ATUHSHO(1H@HL$I9v>H9wډvH-4<H5@ 1H},+H.HEHHH,E +HM(LHH)HHHH9s)DHHDBDPDRDXDZDHDJILIE1I)III9NMGIII9MGIM9sE IIEK} @ +HMHHU@E Le@LeM *DHuHE Hu8H}(Le0?HE(HE@M 1[]A\@AVfHnAUfH:"ATIUHSHHwH;@HF`,LMI9tIY`Ht H H9K(tOH,H5H9p(,Hu;IE1LH5LH,$UH9tYH[]A\A]A^H+H9H(tILH5HL$$TL+H;AII|$H9}tH+,Eu+@AVAUATUSHQH:,I7HhHH;,11.HHH,MIH+-1HIHtLHb4UH{1/*HH,E1HH5L~i+Hm,H{ 1)HHV+HH5LB-+Hm,H{(1)HH+HH5L*Hmd,H{01x)HH*HH5{L*Hm,MLfH{8HH*HH5BLP,HmX,H{@1(HHr*HH5LC,Hm+H{H1(HH6*HH5L+Hm+H{P6HH)HH5L+Hmk+H{Q6HH)HH5Lb+Hm#+H{RT6HH)HH5RLV'+Hm*H{S6HHJ)HH5%L*HmH*H{T5HH)HH5L*Hm*H{U5HH(HH5Lv*Hm)H{Vh5HH(HH5Lj;*HmH)H{W-5HH^(HH5qL/*Hm2)HHt$HHD$H$ (HT$H5L(H|$H/(H$H5jLo(H<$H/G(H{HH'HH5?LxI)Hm?(HL[]A\A]A^L1CH{1%HH:'L1eCrSH7II)1[fDAVAUATUSH1;tlHcǃtuHcGIH(LcN,3I}3H(IL$JAu@t@u[L]A\A]A^[1]A\A]A^CGAVIAUIATUSH/HHtH11BHH( HH(1XBIHtHH."(H;1$IHtVH{1p$IEHH[]A\A]A^LcL}cHY1A<$yK'HHWHHHzH(H9y(;fHGHH`Ht Hu (_VUVDUHOHHWHAHH H HAHgH HG'H/5'L H-5LM ]SHHHv'H{HtHCH/u#61[ff.@AWIAVAUATIUHSAPHGHHHHH9HNH)IH8H(LI$IHg(JIWMAHsHt&AAyLTHHLHHMTHH M^H4Hsu_Ht!A^HDLID HHHLBLI$BHE1Z[]A\A]A^A_AOAItAtD>E~DlEl fIHI1E1McLǃHHHHtXHt.H$FA)DC+ ?B} yILd$1LBLHLD$@tLMHX]A\L1 @AWAVAUATUSHH8DH 'DgAHL8~H~Hc4HL5e1H{H+HcsL-=L5IHtPH{H$H|$^L$HcKHE`H9t*I(H|$uLH$'H{H4$L5ISHsD1H=IIHHHLH=1ILLL9LHH{Ht K'HCH8[]A\A]A^A_L}#Do$MA,Dw A/A6AL5iHLE1L511qL5k1L5}1~fDAWAVAUATIUSHQHo`E LuAAA @L}0M9AC<'}H d)<9„t{H=<H5LLHA:HtXHH=H{`ALLH5hHtH)1Z[]A\A]A^A_ QtHHcHHHZHHZfQ HHcHH$HZfDAWHAVAULcHATIH51UHSHfHnfH:"1HH &HT$PHH=)D$@,5r ~ H fH:" HL$p)L$`7A Jt`H&+ #HD$(H;-=&"H5H"NLt$(H5qHL$"L\$(M!ICz I[LE1HOLD$8IHH|$(L9~DHLLLD$J< HL$(H;Y HT$8LD$KTIHtHD$(H/!LH5kH$!HL$(H`!HQsLqLLHHtE1H\$0Ht$$H|$(M9HtHD$(H/LHLcHtHĈ[]A\A]A^A_fAWAVAUATUSHH;=$Ht$HD$xV&Ll$xL=yHHLL'#:H|$xH9Ht$d;&H|$xHtHD$xH/o9LH5qH"9H|$xH[9Ht$`%H|$xHtHD$xH/"9LH5qHy"n9H|$xH8H;=#8Ht$\L%H|$xHtHD$xH/n9LH5pH" 9H|$xH99H;= #9Ht$X%H|$xHtHD$xH/8H5,H8:H5H88H5HdAƃe8-H|$HAXAYHNiE LH5eHiHl$0H7fLuALuHLIHh1L|$HH|$0L9LGHLI<hLL$0M9qmLT$HMTHLH5eHz8H|$0HHt$HHAąbhH|$0HtHD$0H/`LH5bHۃH|$0H+L9 Ht$8hH|$0HtHD$0H/iLH5%bH{H|$0HtL9I.HD$0܂HD$@St$(VH|$XDL$4DD$8L$醓酓@AWAVE1AUL-ϡATL%UH-zSHHHhHI9}UN|MęAHctHIABItI뚸H[]A\A]A^A_ATAHAUHCH5HQHE%t1DH4Z]A\H H?AUAATAU1SHQHHH9| Z[]A\A]H|HD tHAWAVL5zAUL-yATAUSHHPw IcLLAIc4LLCH-L=@LLLD$L}HLD$Mu֋{D9H{vAąAHD[]A\A]A^A_H{H1Ҿ[]A\A]A^A_H{H[HtdAfATUHH;=jtZH;=YtQHWH;$H;2 H;@ H; @ H;ADu H;RH]A\fH(HHAUATUSHQH`IHH{@HHդHCHHSPHKXH;P} HrH9t6HMH1H=CNIL3H+ZL[]A\A]DL HMHH=1DIff.AWAVIAUIATUSHHT$PHL$XLD$`LL$ht=)D$p)$)$)$)$)$)$)$HHL$@fIH$0HXHT$(HT$HL$0H]XHu`EXH}hHEhH$H\$Ht$HLH|$HD$ D$$0ZLd$MtH|$LI,$bH<$H/aHL$ LLHyLUhLEXHLM`fHT$LHEhHMXL$LL$LT$څLt$Ll$ILLLLHL$LHH4$RH1[]A\A]A^A_ff.HGHx*fH*Y9 f. zHHƒfHH H*Xff.fH9HÐQH H9F`Fff/sY S f/sH,HHZ\H,H?ff.HHÐHHHHHGHLG`HOhHWPLHHpItH5M1tL%H531_ff.@HGhHXrfAWAVIAUILATUSHQW@L^HHHIHH{HHHIHt'HHCPHmuH ZL[]A\A]A^A_*HtHChH{XLLIHt6H{HLHHSHmuHmE1Hmu.H54@QIWHM+H H5H9Zf.#VHG(Ht(HWHwQPLO 1LGHH=HHo DUSH8HFXH1HL$ HHT$(LL$LD$H5 1(H|$(LD$ IHH|$H- H9tHW H;  IH9H5&H9w HH|$H9HLL$(MQIMZ8At~KHH{LKAAȉK8H/H{HT$ HSH/teH{ Ht$Hs H/u4 LL$H{(LK(ҸHEHH8[]HD$g1HH5,H; 1 L8H|$HD$ HbHD$H?AWAVAUATIUSH8 TH=HH'ID$1L5LhH|$(I9HD$(Lt$H\$ Ll$(L=I|$ LHLuKIL$IT$1H=aHqHHmIuHLH8L[]A\A]A^A_HL$HT$ 1HLH~HmteH|$H/HLH\It$1HTHL@HmHtHHT$(HHzHDHHD$5HD$H8H=[]A\A]A^A_HD$HD$bf.USHQHoH9HGfHnH@GH{XHtHCXH/vH{HHtHCHH/uH{pHtHCpH/IH{xHtHCxH/uVH-Z1[]1@QHhHHXH%$w 9L BG$1w HwI1WADZff.H1fDATIUHAPHuHHkHMtIT$ I$H8L +1Z]A\@ATHUH5SH(HD$HD$P1LL$(LD$ 脿ZYHT$HtHH|$"IH<HHŜHMHLHHtQHt$HH}HuWH} H] JH|$1HHD$HH}uHHmuHTH|$tXI,$uL=Ld$H L[]A\HD$BH;H;tH;H5 H|$観H- H5H} H胳H|$yI,$LE1vff.SHHHsH;[DH=)t@AVIAUIATUSHLg0HHFHHVH\HgHHV1I]0LLHL-mA(HmAjL訂HD[]A\A]A^H^HT$HHT$ӚHHHܚHtHzATIUSHHGHXpHH{HHHHݚLHSHmIuH2L[]A\f.ATIUHH˚LHIH1HH#HmI,$H]A\fDUHH}0HuHH]HP0HE0H/fATIUHHH0HwHLHHH]A\fHG0HHG8HQHtHFmH"H5{H:Zff.QHtHFHHH5cH:Zff.HHX`ff.ff.AUIATIUHH@HtHAԅ˚LLH]A\A]SATIUHSHHHt HӅu-I|$Ht HӅuI|$ HvHH[]A\gbf.QB՛HhHc HH[ZH|ZHZfDH1 fAWfAVAUATUSHHHHHXLmXHU`EXHMhHEhLl$8HT$0HL$(MݛIHHL$(HT$0HHt$8wLd$(Mt,L;%t#H|$0H5CI9t$uL1E1MH|$0L|$8H|$H=RL|$IHtMMLL$IMFMMIMMV MuIM^(M\HCHHIF0H5HIV8Ht H}XH=85sIH1LH5 LH=flL;=n1Ht$ LLt$ 莏I.4HH(H|$8W}H|$0M}H|$(C}L;}H111-HH[]A\A]A^A_fHHHHUff.ATIUHS1H9]~HtLbuHHH[]A\1AWAVAUATUSH G LoAAA LwH@tLw0ItxE11MI9~OAu&A,uhu]EtHA}A,^ΉE1 AIcH[]A\A]A^A_CAt3At'A>_ HcHsHH[]A\A]A^A_A>A>2ff.@E1114!@UHSQHGtHxawHHt'H]Z[]HH5H:1,Ht1UHSQHGtHxAHHt'H]Z[]HDH5YH:E1H_ɐH11T^@ATUSLgHMtIl$H5H9uHSH=x[1]A\H2HuHCHULH=[]H0A\1jf.PjHxhZHHHHff.H1H|$ H|$^wHfAUATUHSHHLd$LyHu"LH賾AHD[]A\A]H= H Ht$@H H{ ffH*T$HY H*\$@XSzfDATIUHSH Ht'L+e1Mx9H9]~3H|LHIH5H9r)eH L[]A\DATH7UHSHHH9uHuwHuHH}HHto1fHnIfH:"Hh1)$H0H)fo $H@ @(HH[]A\HH=+r1ܹH= I^1ff.fATSHQHHu3HKHQHt}HC HqL$HH9~9HC I$LZ[A\訵IHt{(uH{Ht香1\Hu!H{HtHCH/uvE1뜐UHǾH}.wH}%wHEH]H@@ATIH~USHLVHuvIBLHwpHH/uZHL1A$0IHt}H@ HH@(H@0HXHID$HtPHL[]A\H_HZLVALXLHL$Q1jjH HH^E1I,$uLuUH跽H}vH}vH} vH}(vH}0uHEH]H@fUHSHAPHt HjH9tHsHu(HS HsHY[]HpHH=IuH=uZ1[]AWAVAUATUSHQLoIELLAIHtUH{H;=tdH;=it[H11蓽HHH?HmLcsMtI,$tMyE1ZL[]A\A]A^A_LLLcUHSHAPHt H H9tHsHu%HS HsHY[];HH=,uH=uZ1[]fDATIHUSHHfHnfH:"Ht;1H)$LA$0HHfo $H@ HH[]A\1f.AUATUSHQH{ HtdHGIHtRH{H11HHtIHɼHmLcEM~ ZL[]A\A]I,$tMuHC E1LI,$uff.UHǺH}.sH}%sHEH]H@@UHSHAPHt HH9tHsHu(HS HsHY[]HH=yuH=uZ1[]AWAVAUATUSHQHoHELHAIHtXH{ uZL[]A\A]A^A_H{H11迺IHt9HoI.LcMtI,$MyE1HC I,$ufff.AUATUSHH~H8LVHIjMHLHttLgMIL-LHH1H0HtL;%u1H@HhMtIELh(H8[]A\A]L%vMI$L` LjMImPALS1LHD$PjjH HH01L%LoBff.fUSHHHG(H;HHGHHtMH{Ht:LC Mu?HFHmtDHt'H{HHCH/H[]HHC1HH1L1譸HHD$nHD$H XHGHHO(Hff.UH臷H} oH}oH}oH}(oHEH]H@fSHHHsH;[DAUATUSHASHO(H-H9HoH9t3HG HIHWLDHwH=HHEAY1[]A\A]5L-~L膮L%LosHSHKL1H5>螶HHNHK H{H5HHD1uHH%AZI[L]A\1H=A]L-LHS(HKL1H5HHȑHK HsIH=HHDff.AVAUATUSHHIHH{(H{ H{IHhH{ HHXH=HLLIH7HkH=A,[LH=HH1]A\A]A^=ff.fHOHW1HwLG H=ҲfSHHHHHS(H9HOHCHsH[DPLGHHwLmHLHZff.HWHwHHOHuH=K1H=51f.AUATAQLgMaLoH= AXLH=uHLA\1A] SHHH@HSHtH?HJH9HOHCHzH[ff.SHHFH$H1HHHT$H506Ht$H HVHH9t[HtVL$Mu8HH{HskL$MuMH{L[kHHH[MHMMtI9uHH5H81IHH5H;1ff.fATIUHSHH HH{Ht LՅu0H{Ht LՅuH{(H[LH]A\ݎff.@AUATAQLgMt-LoH=UAXLH=yHLA\1A]t1IHH=TYLA\HH=1A]HH(HKHsALH=)ff.SHHFHD$qHHH1HL$LD$H5tI|HTLSM\I{HtvHH9HOHKHC<5of:C(M_s{@t sHMA=EwCC8L[AsLS I9vLCL;D$srK8A9ujLHLEL)MHG/J?HHHUL Lc[@H@A<$X@M LHHE1L9UIILCLS a҇ff.@AUATUSHLoL'LL)HH9~ H9uH%H/Hc,HNLL9s9 tHL)HH[]A\A]HM,LL9s׃; tHLLHnL9s3H tPUHHHcH]HUHVH4HHHH1聦HmH]HCH3AV1AUATIHH5AsUHHD$HT$3H|$HHHHxHvHmIMHH-LHHI.IvH-[MtgLL6}ImItHMtMIv LKI.IuLjHL]A\A]A^H(-LILH<$It LLkL5IH|$tHHXL[]A\A]E1HLI蓽LE1H4H5%UH=;믐SH'HNHsHH=ο1[AUATUHSH(HHD$H"I1Ll$H9]~%HELH|7HIDHH|$iLH([]A\A]ff.UHSAPHbH9Gt HHZ[]H>HuH=wHHtH;HY[]6~fDAUATUHHOwH}usHUHt$HD$HzuIHTHMHH=-1HqPI,$ItH|$iHtHL]A\A]LOHIHHELH=Hp1I,$IuLff.AVIAUATUSHHoHuQHsHu~I~Lkt^HIHt?1H9};IFLHtlHIDHHH=uE1[L]A\A]A^IV[L]A\HrA]A^!H=U[tcfAUATUHSHHlH9FtH[]A\A]gH^HIE1L9~)JtLGI,$Ht IIE1HL[]A\A]ff.fUHH}^gH]5~DHHWHwuH=}11gATUHVtzHMH}H}H=|HEHU1HqHI7LZ]A\ff.@ATUSH H~jHFIHHHD$0H=jHHHIT$H|$HT$HmHt$HuHu7H] IT$LHEHHHH []A\HfATUSHH HG HHxH=葷IHƊH5.,HI,$HNJHoCHK Ht$H)D$ߥHmHyHSH=_1H []A\HSLbI|$HtHK1HHHL9|HsH H1[H=]A\ϨH{LDHILDAWAVAUATUHSH8rUHE E1HgHULLjL)HE1SIHM9MH=*izHHLHyH+IuH豵MÉLEHU1LH=O{Ip[ImIuLyI,$uLjHMoH8L[]A\A]A^A_LUK|HQKDI1HL$ Lt$(HD$HL$Ll$H} HL$LLguAI9鱈L]HUH=xy1Is蛂HI\LpHT$ Ht$(1H=TzjHsI9rKDIof.ATUHSHHuIHuHuWH}Hs蚈HHt=HS HsH袮HmIuH L[]A\HH='yuE1H=t@UH'zH}~bH}ubH} lbH]CySHHHsH;[DSHHHsH;ÃuHt1[Hc[hwAWAVAUATUSHH=HH1HARIHu=L 3I9談HuH=I HL[]A\A]A^A_E1E1L菂HHtMHH藷Hm|uWAuHI9DDII%H~AGI/iLP\AAԆAuHI9u8H=FyHFH;ͳt H;0@AUATUHSHQL-WH Iu誶H{ H臶Hs1HAvAӆʆEtat]HsH.IHHs HnHHIuHL_H_Z[]A\A]11E1@USHWH}HsH;HHu薅HtZ1[]YH[]еvfDSHHUHsH;[~DUSHWHXHsH;脊HHu&H[Z1[]PffDHHt$HT$H5V&Hff.HHt$HT$H5%Hff.HHt$HT$H5%Hff.HHt$HT$H5$qHff.LuzMf.HHt$HT$H5v$!Hff.HHt$HT$H5$Hff.HHt$HT$H5$Hff.HHt$HT$H5%Hff.HuSHH HCH9u HH[HmSHHHsH;[yDSHHu HsH;[鉌HֹH=ht0u1[ATIUHAQkkH; Z]A\fAVAUATUHSHHHwLMHF`L9tIQ`HtH H9tYHH5H9L%Lt$E1LH5&HHl$!L9>H[]A\A]A^dfDHhyH(zSHHHsH;[ŔDSHtÃHc[pAU1H eATUHHHHDsHILD$H$iLd$L,$L耝HHLLHH]A\A]ff.AVAUATIUHSH0HHIHHU@H4HLLHHRH9EtHLHqtLHLyIHtlLHYӆ[L]A\A]A^LLH覦IHt6HLLH̟y魆.HuLH «H9MlHHt HIH=LE1H?7r]XH0thATIUHHHAPHBIT$@HHt/HLH:H}H/#Hk1Z]A\H(Hu11ff.H9w0u-HNHO0H9w8t2LFMtLNMHfFHGXHFHtHVHPLVLW8ATUHHHH(HLaIRE1LcHT$ R1jjdH HHMH?qzHM0HL!HIH1I$L]HH@HL1菊I,$IHm'H(]A\HلHIH^H}0t HM8wH=H5oH?W1AUATUHHHHHHH΄IH„IL/LgH.LHH9Ut7MuPLLHI$HL]A\A]sHur<}Hu[LLH)yGLHuILaIAPAL_1HD$Pjj茧H HH6E1|IHIkUH'HHH]fAUIHATUH͘H1HHLILHL]A\A]DAUATUHSHHL-اL9H11L8IMH]0L9mt3DL+HLrHH7HKLLueH[HuHL[]A\A]HtH3HotIHt6H3HL9ImǂuH[111IYI,$قLE1諦fAWAVAUATUHSAQHcaH¦H9EH}蟵IHH]0E1NL;HL|qIHHL1IHtIM9u7IMJH[IHuM9uH}LH=|jH1sIL$HͲZL[]A\A]A^A_1H5]H1˩IHtH˸I,$IuLyMuE1E1H胙AXH=k[H]1A\A]A^A_syHkH=ѢLH?&TMu+kYH=[]A\A]A^A_iff.AVH5\AUATUSH{HHHՂHjHu HmK11IH.1H5M\H1賨IHtVH蓋I,$IuLaMHuJLDLHs1ML#ImIH"L"[L]A\A]A^LHff.fUHHHSHHu>HHHHHH0uJHHEH[]HYHRAL \HHT$R1jjŢH HuHP@SHHHHHHuH{0Hu1H{8HH[H $HT$H $Ht$tHt$H $H $Ht$tffDHHfHHfHHzfSHH@ILHD$HtHHT$0HtHL臵H|$H H|$0 Ht#H=DZOxHH=~fH1kHH@H[ff.@ATUSHHHH HH~H~HH~HL'HiŅ~HS0H~uxL;"tOLHHHt^H;C8t.HH{8HFH~H+~HwHCXHs8H#HH []A\H{0~HS8H;C0tHZHK0HFHNH~HqHCXHs0HiHPALY1HD$PjjH HH}BuHHD$}LLI8r|HD$AUHH`HuHkH1]HE`H/u,f.AUATUH\HHt4}]H=A\A]dH-IH}HELH=udHp1mI,$IuL趟H辬L]A\A]DSHG]HSHH{0Hu"Hp|HkHMD(ILMPZHHW1HJ(H HB HHGHff.AVAUIATIUSHnH5H9tDL5L9t8H謆u,LH蝆H5H9tuH腆H;-u{Lt|HHxILd|Hx<(|H Hc4HH9{LL@u {1x{HH[]A\A]A^ÅV{x@AUATUSHQH{IAHH2HmA{E~!LgZHHu:rHDEImuLoZD[]A\A]@AUIATIUHHHŮA{HmH}O{HELLHKHm{H]A\A]fDUSHHGH5{H-H1H0HHP{HHHX茁Hm{H[]f.ATUSHH_H{HCHK HIAH8"HP E1HLrfHC81H[]A\HH߉T$ CDL$ zHK HCff.HGHh8fDUHWbH}HtHEH/uHEH]H@f.ATHLCIHHHZbH HD$HL$1LD$HD$货DzL1A$0IH+zH|$H@HpH@`syH LA\ff.AUH5ATAQLoHqHyH=I.qAXLLHA\H=a1A]AUHHGHyHPHyHA"yHrHt1HPHH m@\HpPHH`H@PHPhHpp@(H]fDHHmyrff.G(kyHWB]yǃ-^ff.fG(AyHG@3yHG@H+yHfDUH'`H}`yH}sHEH]H@fATH/USH9FzӃzIHH9zHv(H(FuVI|$(duHHuI|$ u0H I|$(H1uHu I|$ sz:z:zHH[]A\w HH2zff.fQ xZff.AUHHATUSHHzHyHyHyH/H5>H}H9Lz\?zH\ÃzLl$wyLI~L`tyLuHĨ[]A\A]fUSHH(肩HyHHt$HpHmzT$yH=yH=yyH([]@ATAUQxD1ҾH1PHAsEyDZ]A\@UHHHSH(HyHYHRE1LFHT$ R1jjUH HyHyH8^Ax(H@D HcyZH([]kyAUATUSQG0< „yty< tf@y<@@Z[]A\A]y@UHHHSHHzHYHRE1LFHT$R1jjuH HzH&zH8]AxDHH[]yfyfDHG(HuS1HHC(HtH[HATUHSHHHt$pzHD$}@L@ zLd$LƉL=H|$H/u;yL sHĠ[]A\ff.@AUHHH[ATHqfHnUfH:"HpHf)D$ HD$0D$HHD$PD$ L$8L$XHyHyHyHl$ H?H]ekDd$ HT$XA1H5SH=9[ɤ<uH|$@I^ALtpEyL% I$MHpHpL]A\A]LifHD$0D$HHD$PID$ )D$ T$8T$XPA1LD$APLFjjH IHkxHl$ H8H[dXxII|$Ht$ K2x1DH5?H=%Z赣x"|tHt$@DI藛AwwwAUATPLoLgH=iAXLLHA\H=Y1A]*f.AUATPHGLgH=LhhAXLH=YHLA\1A]fDAUIATE1UHS1APH9]~ H|L5~IHYL[]A\A]8KwQHGE1HHLIyH~LP>HH=pV1Z^H7H9Wwff.VzLHvHH=1V1Yoff.@HWHwHt HOHv1zrf.AVL5oAUATUSHw0HL9t Hv1襓IMv1H5H16HHvHBxIHvHsIM1LLqImHIvHmuHݐI,$"vH[]A\A]A^fDH=rDU@Pz:H= UZH1AUATUSHHHD$赣IHvHƿ1JqHHvHT$H5r/H uH|$tCHsHL$H1qIHLH|$HL[]A\A]HؑHHD$DAVAUATIUV@LI|$LIHVuHImHuL~H3uHEHHPoHmIuHNMuIT$H;t;HrH=&VL1\IImuLLZL]A\A]A^LH=U1\IIL$H=sUHqY1]A\A]A^\tIt$H=;THvf.GH=Uf.H="^S@1FfAWH5$AVAUATUHSHHGH^HtHUH5$H]IH]HsH}HI{IHsIHsMkHuL9}*Hk(HHTLJ4!%D~sH1LH=TLI.sI/gsH[]A\A]A^A_AWAVAUATUSHHHLwInHd1HHRIH\ILzHkSLLD$4ID$HLHL$(藆sI,$uL(L3sE1L=M~LLwIk(IH.HH dH1H蓚HHrHLrHmuHU=L蘕erJ|覞HHOrHL诅LrHmuHIL9c.)L= rLLIHHL[]A\A]A^A_qrff.USHHtH-1H9lhrHHuH[]f.AUHHHATHѰfHnfUfH:"HH-a D$8Hl$ HD$@)D$L$(L$HHqHqHqHqHl$H?H[q"l|$8IŃqH|$0Ht$`ShALfEqP$$$$$L$L$H$H$H$H$&H0IH7fHL]A\A]AWIAVIAUMATULSHHH|$H=_RHqH|$I,HID$LID$ LID$(LID$0HID$8H|$PID$@܄H|$XID$Ḧ́H|$hID$P辄H|$pID$X评H|$`ID$`JID$h]HNpHL[]A\A]A^A_ff.AQHEpHDpE1E1HLILZDAWAVAUATUHSLD$H)TpIHEu MpHLbLjJ4I3A HMLE1AAMIM 9LDIHsI1E1DtMrHHH9|OH 9uHD$L<E1CC9u IM9HD$M9ioEuaIL9D$tLEHLE[L]A\A]A^A_DoAAt$1E1E#D9$HH9|IA[]A\A]A^A_(E ALADIA MHIM D9LDHuIMnBt?IrI)IxCN<J,?D9MuLA9\nH"IL9D$I IA[]A\A]A^A_>ff.SLHknIAHxH[f.AVAUIATL$USHH(~&HL9s9+uHL)H[]A\A]A^HtDLDHH)EHmH9(u L)HHPHH)HHmLH)H=~뫐AWIAVAUATL%MULHSH8] nIGoMo1MoI9~\MtMFA2nHL^4mIXt"L9mMMuH;-mHL\IHmHLHmIH1ILPLLPH$7IHgnHHmI,$uLɄL;P{mLHE1E1M;w}'K|LGAtH觌DHIHL=13觃Iw0HI85 I?u mf.AWIAVIAUIATUSHH@H9@YnHHJnLH7Aąu!H9SnAHD[]A\A]A^A_HfDHE1HtaHp H9w uWHH(H9O(uMH H9 u=LL9u-HH3@uH0LEAL9nDff.AWAVAUATUHSHHHt$bAąL|$LXM`nLLH1cIMYnHLyLAEAnLzHrHH:nLpE1M9|!HmuH苂HD[]A\A]A^A_HEHJ<)AąxIff.AVH5AUATHLgLwLl$LLoHt$HnHFnLH=IH'1OH|$I0HLA\A]A^ff.fHHGH;nHWHnHGHDAUIATIUSHHnE1HLAHx 1ALYK1H?HmnH[]A\A]fATIUHAPHH;=ZnYLH]A\DATIUHSHH HGHD$H{nMVHUH\$HtCH}8nHynH;] }H] HHxH脅H []A\Cnnnff.HOHwOH=D@AUATUSHQH}PXHnnH{0HH}n~<HnH{0]IH{0M;nH{sHLH=GH1MI,$IuLHmuHZL[]A\A]ff.AUATUH;nH裒IHnH}Lm@jsHMx7LLH=F1LIH3I,$uLL]A\A]LH=C1LIDH@Hmރff.SHH 1lHmbSHuHK HSH=F1Hs[bLmff.f9t.USQ.AA9t:9Z[]øATAAw |HF$DA\ATAAw mRHF$DA\AWAVIAUATUSHHDg8uD%$ uA1 IHlHLkDHI9uELdHH=kBHHzlLH@H+IrlMYlIv01LH=DKImItbI/uL}HL[]A\A]A^A_H;AH lHLHD$sHT$&lH*lA!#L|Iv0H=]D1~JIzDH=(D1eJIHkHL~s}kI,$kfD11H5 H@Hk>ff.HG(HH(HkHW@HkH;QxkHDHff.AWAVAUATIUHHSH8HEkH^lHTlHHHlLuE1HHKkLLLH8[]A\A]A^A_fE1AI%@@u D¸AÉйH5~IH4HcHsu6tAH>AI9IyN\HO\I)DL)HDAEFDGDff.HHHHHHHHAUATAUHSHQH(*HH+H9vHfD9 uH)HZ[]A\A]HDtHT-DHaHtHHHH)HHHfD9">k볐ATHIHHHwkHnkHdkH[kIt$(HL1ZH=iAH趸HA\ff.@AVAUATIHHUH8HkHAlH7lHH+lL/LwHkHoH5xH}H9k5akH赊HHkH^HmH}kHt ALLLIH8]A\A]A^ikHz@ATHz1USH[HrkHHCHKXH=^HSPIHp1>FHmIuH\xL[]A\@AUATUSH FkG Ho LgH@tLg0Hu,uA<$:H[Hc]A\A]<tVA<$E1Ht2L9juC<,9tIރjCdHIZL[]A\A]ff.AUATUHSHQLfL-kM9t4H5oI9t(LWuLLWu HlH!HHtHtH(cHHZ[]A\A]fDUHHHGH;%st H;mu"H}ɀA1Et'HmH}ucHEHH!1Zff.fATUSH cHHIm1LSH8t A MI)DDHBM~@t t HA9tD)[]A\ff.USQH-oHpz|HbHHXH9tH J1Z[]bDUSVH-nHp(|HbHXH9bb~bZ[]NUHHSH5HӺHH!oILD$H$1v&SbH$Ht$HH[]fStHH4‰% ƃt1f*Yn tXs z,u[ÿt[=rfWus [[]yff.fATfIUSHf.zff(fT's f.gl 6f.f/H|$ %m f/Ia%>s f/7a|$ XWT$ ||\ăYm f|$ ,ȉ*\f/wif.zt]DT$ AA D tII1A$CH[]A\fWGr 0 +:l 1ttpf=u|$ Z`H=mH58RH?pf/D$ 1UfTq fVr D$ f.r E1#D$ 1fTq AD$ fVq f.r AEDUH11H5%2HPHD$LD$#t@H|$H`Hl$HQHtHtHHP]1ff.fUSQHFtUHHcHHt H]1Z[]]>HtH-kH}8>_H}H5UqnH fHP1H5H1H9:f.gff.@BT@Hʚ;HHHy Hʚ;HH1HVfAȹʚ;AUH=0IATUH*H^IH55H?I,$H^H^1LH cHm^H]A\A]@H(HH501HT$ f;_|$ Ht$@( _ffH*D$Yh H*L$X9H(ff.UH1H5 0H0HL$HT$ :^Ht$1H|$3^H|$Hl$ HQ^|$ H(f^HAcH8w1H0]fAUH1H5/ATUH0HT$a:^Hl$Hn HH5rHD$HHT$ HD$D^H5T/H-^H5G/H^4^H5=/H]>Ht$HkzIH ^H|$7+IH]HH5Lt]Im]Hc|${*IHP]HH5.L8]ImX]Hc|$?*IH]HH5.L\Im)]D$ 7IH\HH5d.LD\Im\LXI,$HuLeH0H]A\A]H5-H\uSHt$H\Ht$Ho`\Ht$HEC{\\H HÀ\]LGH@s]A8L]ff.fAWAVAUIATU1SHHHI1HHIHH H]HIILH)H9E]HI)I96]AE IAξ@D9L $ABHgIHtP H<$ \@It$HtIt$0H~!I1DD$H4$lD$H4$M~IMIDHwlMEE11LHLHL[]A\A]A^A_Ã<t<E9/fAVHBIAUIATIUSH D$ H7\I.H5_H}H9I\HrHHX\HFHmH5\H8\I~I~Ht$tKA|$ L$y:IT$H9~H H)L1H[]A\A]A^H L[]A\A]A^G[[[W [L)<t+L1)<t ,L?)u@L(H )LDLÐAWAVAUATUSH(HU\II^xIH6\@ @ \IL$HHL$@[IE1M9Ht$[Bvw/LbA<8u*iMFx&X0A_MI막Atֻ MFDKAvH|$L GLLHD$H5xH|$I,$[$B6^AGI,$F[L^1H([]A\A]A^A_@AUATIUSHQH( JH9vqH9(uH)HZ[]A\A]ÄtDJDHEHH~\HHH)HHH9*tLIH)H(#\I(~Hff.AUIATIUH,SHHLQ!9C(\MtLHt?L Hs AI  tC@#\I0uILLLLc 1Z[]A\A]Àt I1[[\AWAVAAUIATIUS1HL9}*E|AwHDfxDx0E9EBDLzIH[@ AAA [IWH@tIW01L9}@AlwAtAu@f,ZH@,HT$RfHT$xύh0HL[]A\A]A^A_9[fAUATUH0HF8[~ Hn[H=:}(IHLl$HEHU1HhLML$HPjLD$(ZY[H|$HZLDHHZLH1= 0Unknown PYTHONMALLOC allocatorError setting LC_CTYPE, skipping C locale coercion can't initialize builtins dictcan't initialize builtins modulesmain interpreter already initializedUnreachable C code path reached-X int_max_str_digits: invalid limit; must be >= 640 or 0 for unlimited.PYTHONINTMAXSTRDIGITS: invalid limit; must be >= 640 or 0 for unlimited.PYTHONTRACEMALLOC: invalid number of frames-X tracemalloc=NFRAME: invalid number of framesPYTHONHASHSEED must be "random" or an integer in range [0; 4294967295]--check-hash-based-pycs must be one of 'default', 'always', or 'never' Try `python -h' for more information. cannot decode PYTHONPYCACHEPREFIXcannot decode _Py_StandardStreamEncodingcannot decode _Py_StandardStreamErrorscannot decode PYTHONIOENCODING environment variablecannot decode PATH environment variablecannot decode PYTHONPATH definecannot decode EXEC_PREFIX definepath configuration: path too long/builddir/build/BUILD/Python-3.8.20Could not find platform independent libraries Could not find platform dependent libraries Consider setting $PYTHONHOME to [:] failed to get the locale encoding: nl_langinfo(CODESET) failedcannot decode nl_langinfo(CODESET)failed to get random numbers to initialize Python/dev/urandom (or equivalent) not foundFailed to read %zi bytes from /dev/urandomcpython.PyInterpreterState_Newfailed to get an interpreter IDTimeout larger than PY_TIMEOUT_MAXCouldn't create autoTSSkey mappingPyMUTEX_FINI(gil->mutex) failedPyCOND_FINI(gil->switch_cond) failedPyMUTEX_FINI(gil->switch_mutex) failedCan't initialize threads for pending callsPyMUTEX_INIT(gil->mutex) failedPyMUTEX_INIT(gil->switch_mutex) failedPyCOND_INIT(gil->switch_cond) failedPyMUTEX_LOCK(gil->mutex) failedPyMUTEX_LOCK(gil->switch_mutex) failedPyCOND_SIGNAL(gil->switch_cond) failedPyMUTEX_UNLOCK(gil->switch_mutex) failedPyMUTEX_UNLOCK(gil->mutex) failedCan't initialize callable weakref proxy typeCan't initialize weakref proxy typeCan't initialize bytearray typeCan't initialize NotImplemented typeCan't initialize traceback typeCan't initialize dict keys typeCan't initialize dict values typeCan't initialize dict items typeCan't initialize reversed dict keys typeCan't initialize reversed dict values typeCan't initialize reversed dict items typeCan't initialize OrderedDict typeCan't initialize odict_keys typeCan't initialize odict_items typeCan't initialize odict_values typeCan't initialize odict_keyiterator typeCan't initialize static method typeCan't initialize frozenset typeCan't initialize property typeCan't initialize managed buffer typeCan't initialize memoryview typeCan't initialize enumerate typeCan't initialize reversed typeCan't initialize StdPrinter typeCan't initialize builtin function typeCan't initialize function typeCan't initialize dict proxy typeCan't initialize generator typeCan't initialize get-set descriptor typeCan't initialize method wrapper typeCan't initialize ellipsis typeCan't initialize member descriptor typeCan't initialize namespace typeCan't initialize long range iterator typeCan't initialize instance method typeCan't initialize class method descr typeCan't initialize method descr typeCan't initialize call iter typeCan't initialize sequence iterator typeCan't initialize pickle.PickleBuffer typeCan't initialize coroutine typeCan't initialize coroutine wrapper typeCan't initialize interpreter ID typeType does not define the tp_name field.method cannot be both class and statictype '%.100s' is not dynamically allocated but its base type '%.100s' is dynamically allocatedtype '%.100s' participates in gc and is a base type but has inappropriate tp_free slot/builddir/build/BUILD/Python-3.8.20/Objects/tupleobject.c/builddir/build/BUILD/Python-3.8.20/Modules/gcmodule.cOut of memory interning slotdef namesinvalid maximum character passed to PyUnicode_NewNegative size passed to PyUnicode_New/builddir/build/BUILD/Python-3.8.20/Objects/dictobject.cdeletion of interned string failedImmortal interned string died.Inconsistent interned string state.mro() returned a non-class ('%.500s')mro() returned base with unsuitable layout ('%.500s')Cannot extend an incomplete type '%.100s'/builddir/build/BUILD/Python-3.8.20/Objects/listobject.ccannot create weak reference to '%s' objectobject already tracked by the garbage collectorgc: collecting generation %d... gc: objects in each generation:%s gc: objects in permanent generation: %zd gc: done, %zd unreachable, %zd uncollectable, %.4fs elapsed gc couldn't create gc.garbage listunexpected exception during garbage collectionCan't initialize encoding map typeCan't initialize field name iterator typeCan't initialize formatter iter type/builddir/build/BUILD/Python-3.8.20/Objects/structseq.c_PyInterpreterState_Get(): no current thread state_PyInterpreterState_Get(): no current interpreterexceptions bootstrapping error.Could not preallocate MemoryError objectCannot allocate map from errnos to OSError subclassesfailed to initialize UnraisableHookArgs typefailed to create a module objectmodule %s: PyModule_Create is incompatible with m_slotsPython C API version mismatch for module %.100s: This Python has API version %d, module %.100s has version %d.module functions cannot set METH_CLASS or METH_STATICattribute name must be string, not '%.200s''%.100s' object has no attributes (%s .%U)'%.100s' object has only read-only attributes (%s .%U)'%.100s' object has no attribute '%U''%.50s' object attribute '%U' is read-onlyNot enough memory to allocate new values array/builddir/build/BUILD/Python-3.8.20/Objects/moduleobject.c [GCC 11.5.0 20240719 (Red Hat 11.5.0-14)]PY_SSIZE_T_CLEAN will be required for '#' formatsNULL object passed to Py_BuildValuebad format char passed to Py_BuildValueNegative size passed to PyUnicode_FromStringAndSize/builddir/build/BUILD/Python-3.8.20/Objects/longobject.cPython int too large to convert to C ssize_tcannot add more objects to list/builddir/build/BUILD/Python-3.8.20/Objects/unicodeobject.ccharacter U+%x is not in range [U+0000; U+%x]/builddir/build/BUILD/Python-3.8.20/Python/import.csequence index must be integer, not '%.200s''%.200s' object does not support item assignmentPyState_AddModule called on module with slotslist assignment index out of rangeModule dictionary insertion problem.initializing sys.meta_path, sys.path_hooks, or path_importer_cache failedPython import machinery not initialized_Warnings_GetState: could not identify current interpreterPyModule_AddObject() needs module as first argPyModule_AddObject() needs non-NULL valuecan't import _frozen_importlibcouldn't get _frozen_importlib from sys.modulescan't save _imp to sys.modulesimport _frozen_importlib # frozen Excluded frozen object named %Rfrozen object %R is not a code objectEOF read where object expectedbad marshal data (long size out of range)bad marshal data (unnormalized long data)bad marshal data (digit out of range in long)bad marshal data (bytes object size out of range)bad marshal data (string size out of range)bad marshal data (tuple size out of range)NULL object in marshal data for tuplebad marshal data (list size out of range)NULL object in marshal data for listbad marshal data (set size out of range)NULL object in marshal data for setbad marshal data (invalid reference)bad marshal data (unknown type code)bad marshal data (index list too large)Negative size passed to PyBytes_FromStringAndSizeread() returned too much data: %zd bytes requested, %zd returned/builddir/build/BUILD/Python-3.8.20/Objects/codeobject.cCan't compare %.100s and %.100sPyImport_GetModuleDict: no module dictionary!Loaded module %R not found in sys.modulesPyEval_EvalCodeEx: NULL globals%U() got some positional-only arguments passed as keyword arguments: '%U'%U() got an unexpected keyword argument '%S'%U() got multiple values for argument '%S' positional argument%s (and %zd keyword-only argument%s)%U() takes %U positional argument%s but %zd%U %s givencannot import name %R from partially initialized module %R (most likely due to a circular import) (%S)cannot import name %R from %R (%S)local variable '%.200s' referenced before assignmentNo active exception to reraisecalling %R should have returned an instance of BaseException, not %Rexceptions must derive from BaseExceptionexception causes must derive from BaseException'async for' requires an object with __aiter__ method, got %.100s'async for' received an object from __aiter__ that does not implement __anext__: %.100s'async for' requires an iterator with __anext__ method, got %.100s'async for' received an invalid object from __anext__: %.100s'async with' received an object from __aenter__ that does not implement __await__: %.100s'async with' received an object from __aexit__ that does not implement __await__: %.100scoroutine is being awaited alreadypopped block is not an except handlerno locals found when storing %Rno locals found when setting up annotationsbad BUILD_CONST_KEY_MAP keys argument'%.200s' object is not a mappingcatching classes that do not inherit from BaseException is not allowedno locals found during 'import *'from-import-* object has no __dict__ and no __all__module __name__ must be a string, not %.100s%s in %U.%s must be str, not %.100scannot import name %R from %R (unknown location)cannot 'yield from' a coroutine object in a non-coroutine generatorerror return without exception set while calling a Python object__build_class__: not enough arguments__build_class__: func must be a function__build_class__: name is not a string__mro_entries__ must return a tuple%.200s.__prepare__() must return a mapping, not %.200s__class__ not set defining %.200R as %.200R. Was __classcell__ propagated to type.__new__?__class__ set to %.200R defining %.200R as %.200Rmetaclass conflict: the metaclass of a derived class must be a (non-strict) subclass of the metaclasses of all its basesuninitialized staticmethod objecttype object '%.50s' has no attribute '%U'descriptor '%V' for type '%.100s' needs either an object or a typedescriptor '%V' for type '%.100s' needs a type, not a '%.100s' as arg 2descriptor '%V' requires a subtype of '%.100s' but received '%.100s'%R returned NULL without setting an error%s returned NULL without setting an error%R returned a result with an error set%s returned a result with an error set'%.200s' object is not callablecannot create '%.100s' instancestype() doesn't support MRO entry resolution; use types.new_class()nonempty __slots__ not supported for subtype of '%s'__slots__ items must be strings, not '%.200s'__dict__ slot disallowed: we already got one__weakref__ slot disallowed: either we already got one, or __itemsize__ != 0%R in __slots__ conflicts with class variabletype name must not contain null characterstype __qualname__ must be a str, not %s__classcell__ must be a nonlocal cell, not %.200RError calling __set_name__ on '%.100s' instance %R in '%.100s'new style getargs format but argument is not a tupletoo many tuple nesting levels in argument format string%.200s%s takes at least one argumentold style getargs format uses new features%.150s%s takes %s %d argument%s (%zd given)unsigned byte integer is less than minimumunsigned byte integer is greater than maximumsigned short integer is less than minimumsigned short integer is greater than maximuminteger argument expected, got floatsigned integer is greater than maximumsigned integer is less than minimum(unknown parser marker combination)encoded string too long (%zd, maximum length %zd)encoded string without null bytes(invalid use of 'w' format character)type '%.100s' is not an acceptable base typemultiple bases have instance lay-out conflictsuper(): __class__ is not a type (%s)super(): __class__ cell not foundsuper(type, obj): obj must be an instance or subtype of type'%.50s' object has no attribute '%U'%.200s() takes no arguments (%zd given)%.200s() takes no keyword argumentstype.__init__() takes no keyword argumentstype.__init__() takes 1 or 3 argumentsobject.__init__() takes exactly one argument (the instance to initialize)%.200s.__init__() takes exactly one argument (the instance to initialize)descriptor '%V' for '%.100s' objects doesn't apply to a '%.100s' object%.200s() takes exactly one argument (%zd given)PyArg_UnpackTuple() argument list is not a tuple%.200s expected %s%zd argument%s, got %zdunpacked tuple should have %s%zd element%s, but has %zd'%.200s' object is not iterableiter() returned non-iterator of type '%.100s'hasattr(): attribute name must be stringgetattr(): attribute name must be stringcan't delete numeric/char attributeattribute value type must be boolTruncation of value to unsigned charTruncation of value to unsigned shortWriting negative value into unsigned fieldTruncation of value to unsigned intattribute '%V' of '%.100s' objects is not readableattribute '%V' of '%.100s' objects is not writable__name__ must be set to a string object__qualname__ must be set to a string objectdescriptor '%.200s' of '%.100s' object needs an argumentdescriptor '%.200s' for '%.100s' objects doesn't apply to a '%.100s' objectissubclass() arg 1 must be a classissubclass() arg 2 must be a class or tuple of classesstrings are too large to concatobject.__new__() takes exactly one argument (the type to instantiate)Can't instantiate abstract class %s with abstract methods %Upartially initialized module '%U' has no attribute '%U' (most likely due to a circular import)module '%U' has no attribute '%U'attribute of type '%.200s' is not callable%s() requires a dict argument, not '%s'dictionary changed size during iterationdictionary keys changed during iteration/builddir/build/BUILD/Python-3.8.20/Objects/object.c'%s' not supported between instances of '%.100s' and '%.100s'character argument not in range(0x110000)PyUnicode_FromFormatV() expects an ASCII-encoded format string, got a non-ASCII byte: 0x%02xexception %R not a BaseException subclass/builddir/build/BUILD/Python-3.8.20/Python/traceback.cmaximum recursion depth exceeded while normalizing an exceptionCannot recover from MemoryErrors while normalizing exceptions.Cannot recover from the recursive normalization of an exception.__traceback__ may not be deleted__traceback__ must be a traceback or None__init__() should return None, not '%.200s'type_traverse() called for non-heap type '%.100s''%.200s' object is not subscriptabletuple indices must be integers or slices, not %.200scannot fit '%.200s' into an index-sized integer'%.200s' object cannot be interpreted as an integer__index__ returned non-int (type %.200s)__index__ returned non-int (type %.200s). The ability to return an instance of a strict subclass of int is deprecated, and may be removed in a future version of Python.uninitialized classmethod object/builddir/build/BUILD/Python-3.8.20/Objects/classobject.c'%.200s' object does not support vectorcallimport %U # previously loaded (%R) execution of module %s failed without setting an exceptionexecution of module %s raised unreported exceptionmodule %s initialized with unknown slot %i'import warnings' failed; traceback: Python runtime initialized with LC_CTYPE=C (a locale with default ASCII encoding), which may cause Unicode compatibility problems. Using C.UTF-8, C.utf8, or UTF-8 (if available) as alternative Unicode-compatible locales is recommended. timestamp too large to convert to C _PyTime_tclock_gettime(CLOCK_MONOTONIC)external importer setup failedPython int too large to convert to C int__package__ != __spec__.parent__spec__.parent must be a stringcan't resolve package from __spec__ or __package__, falling back on __name__ and __path__attempted relative import beyond top-level packageattempted relative import with no known parent packageimport time: self [us] | cumulative | imported package import time: %9ld | %10ld | %*s%s %R not in sys.modules as expectedcan't specify a timeout for a non-blocking calltimeout value must be positive/builddir/build/BUILD/Python-3.8.20/Python/getargs.c%.200s%s takes at most %d %sargument%s (%zd given)Invalid format string (| specified twice)Invalid format string ($ before |)Invalid format string ($ specified twice)%.200s%s takes no positional arguments%.200s%s takes %s %d positional argument%s (%zd given)More keyword list entries (%d) than format specifiers (%d)%.200s%s missing required argument '%s' (pos %d)more argument specifiers than keyword list entries (remaining format:'%s')argument for %.200s%s given by name ('%s') and position (%d)'%U' is an invalid keyword argument for %.200s%s'%.200s' object does not support item deletion/builddir/build/BUILD/Python-3.8.20/Objects/weakrefobject.cNo such frozen object named %R/builddir/build/BUILD/Python-3.8.20/Objects/setobject.c__length_hint__ must be an integer, not %.100s__length_hint__() should return >= 0Set changed size during iterationglobals and locals cannot be NULLexec() globals must be a dict, not %.100slocals must be a mapping or None, not %.100scode object passed to exec() may not contain free variablesNegative size passed to _PyUnicode_NewType spec does not define the name field.builtin type %.200s has no __module__ attributeargument should be integer or None, not %.200sasync generator already executingcan't send non-None value to a just-started coroutinecan't send non-None value to a just-started generatorcan't send non-None value to a just-started async generatorcoroutine raised StopIterationgenerator raised StopIterationasync generator raised StopIterationcannot reuse already awaited coroutineasync generator raised StopAsyncIterationPyObject_CallFinalizerFromDealloc called on object with a non-zero refcountlist indices must be integers or slices, not %.200sseparator: expected str instance, %.80s foundsequence item %zd: expected str instance, %.80s foundjoin() result is too long for a Python stringchr() arg not in range(0x110000)can only concatenate tuple (not "%.200s") to tuplebyteorder must be either 'little' or 'big'length argument must be non-negativecan't convert negative int to unsigneda bytes-like object is required, not '%.100s'PyBuffer_FillInfo: view==NULL argument is obsolete__bytes__ returned non-bytes (type %.200s)byte array too long to convert to int/builddir/build/BUILD/Python-3.8.20/Objects/cellobject.ctuple for startswith must only contain str, not %.100sstartswith first arg must be str or a tuple of str, not %.100s%.200s%.200s argument after * must be an iterable, not %.200s# can't import zipimport.zipimporter Python int too large to convert to C longstring indices must be integersslice indices must be integers or None or have an __index__ methodfailed to allocate locks for faulthandlercannot initialize filesystem codecfailed to get the Python codec of the filesystem encodingfailed to get the Python codec name of the stdio encodingunknow filesystem error handlerno codec search functions registered: can't find encodingcodec search functions must return 4-tuplesfile is not a valid file descripterfile.fileno() is not a valid file descriptorcan't initialize codec error registrycan't initialize codec registryunable to get the current thread statestring, bytes, os.PathLike, integer or Nonestring, bytes, os.PathLike or integerstring, bytes, os.PathLike or Noneexpected %.200s.__fspath__() to return str or bytes, not %.200s%s%s%s should be %s, not %.200s%s%sembedded null character in %sexpected str, bytes or os.PathLike object, not %.200s%s: can't specify dir_fd without matching path%s: can't specify both dir_fd and fd%s: cannot use fd and follow_symlinks togetherPyEval_SaveThread: NULL tstatePyCOND_SIGNAL(gil->cond) failedPyCOND_WAIT(gil->switch_cond) failedPyEval_RestoreThread: NULL tstateCannot specify a default for %s() with multiple positional argumentsSignal %i ignored due to race conditionunsupported operand type(s) for %.100s: '%.100s' and '%.100s'. Did you mean "print(, file=)"?Unmatched right paren in format stringUnmatched left paren in format stringtuple for endswith must only contain str, not %.100sendswith first arg must be str or a tuple of str, not %.100s while getting the str of an object__str__ returned non-string (type %.200s)int() base must be >= 2 and <= 36, or 0int() can't convert non-string with explicit base__trunc__ returned non-Integral (type %.200s)int() argument must be a string, a bytes-like object or a number, not '%.200s'an integer is required (got type %.200s)__int__ returned non-int (type %.200s)__int__ returned non-int (type %.200s). The ability to return an instance of a strict subclass of int is deprecated, and may be removed in a future version of Python.isinstance() arg 2 must be a type or tuple of typesmust be real number, not %.50s%.50s.__float__ returned non-float (type %.50s)%.50s.__float__ returned non-float (type %.50s). The ability to return an instance of a strict subclass of float is deprecated, and may be removed in a future version of Python.'path' must be 'str', not '%.200s'mode U cannot be combined with 'x', 'w', 'a', or '+'can't have text and binary mode at oncemust have exactly one of create/read/write/append modebinary mode doesn't take an encoding argumentbinary mode doesn't take an errors argumentbinary mode doesn't take a newline argumentline buffering (buffering=1) isn't supported in binary mode, the default buffer size will be usedcan't have unbuffered text I/OMust have exactly one of create/read/write/append mode and at most one plusCannot use closefd=False with file namean integer is required (got type %.200s). Implicit conversion to integers using __int__ is deprecated, and may be removed in a future version of Python.File or stream is not readable.buffer size must be strictly positiveRaw stream returned invalid position %zdcannot fit '%.200s' into an offset-sized integerI/O operation on uninitialized objectread length must be non-negative or -1unbounded read returned more bytes than a Python bytes object can hold/builddir/build/BUILD/Python-3.8.20/Objects/bytesobject.cbyte indices must be integers or slices, not %.200sComparison between bytes and stringComparison between bytes and intcompile() mode must be 'exec', 'eval', 'single' or 'func_type'compile() mode must be 'exec', 'eval' or 'single'compile(): invalid optimize valuecompile() mode 'func_type' requires flag PyCF_ONLY_AST%.200s%s missing required argument '%U' (pos %d)argument for %.200s%s given by name ('%U') and position (%d)path should be string, bytes, or os.PathLike, not %.200soperation forbidden on released memoryview objectmemoryview: a bytes-like object is required, not '%.200s'memoryview: number of dimensions must not exceed 64can't set attributes of built-in/extension type '%s'Out of memory interning an attribute nameinvalid indexing of 0-dim memorymulti-dimensional slicing is not implemented%s() arg 1 must be a %s objectsource code string cannot contain null bytesmemoryview has %zd exported buffer%s_memory_release(): negative export countmemoryview: underlying buffer is not writablememoryview: underlying buffer is not C-contiguousmemoryview: underlying buffer is not Fortran contiguousmemoryview: underlying buffer is not contiguousmemoryview: underlying buffer requires suboffsetsmemoryview: cannot cast to unsigned bytes if the format flag is presentXXX readobject called with exception set NULL object in marshal data for object/builddir/build/BUILD/Python-3.8.20/Objects/frameobject.cco_varnames must be a tuple, not %sno mem to build parser accelerators XXX too high nonterminal number!no mem to add parser accelerators '%.200s' object does not support indexingtok_backup: beginning of bufferinvalid digit '%c' in octal literalinvalid digit '%c' in binary literalleading zeros in decimal integer literals are not permitted; use an 0o prefix for octal integersclosing parenthesis '%c' does not match opening parenthesis '%c' on line %dclosing parenthesis '%c' does not match opening parenthesis '%c'unknown error handler name '%.400s's_push: parser stack overflow Format string contains positional fieldsReplacement index %zd out of range for positional args tupleUnknown conversion specifier %cUnknown conversion specifier \x%xSingle '}' encountered in format stringSingle '{' encountered in format stringend of string while looking for conversion specifierexpected ':' after conversion specifierexpected '}' before end of stringcannot switch from manual field specification to automatic field numberingcannot switch from automatic field numbering to manual field specificationToo many decimal digits in format stringOnly '.' or '[' may follow ']' in format field specifierEmpty attribute in format stringSign not allowed in string format specifierAlternate form (#) not allowed in string format specifier'=' alignment not allowed in string format specifierinvalid node %d for PyAST_FromNodekeyword list must be a dictionaryillegal expression for augmented assignmentThe '@' operator is only supported in Python 3.5 and greaterVariable annotation syntax is only supported in Python 3.6 and greateronly single target (not list) can be annotatedonly single target (not tuple) can be annotatedassignment to yield expression not possibletrailing comma not allowed without surrounding parenthesesUnexpected node-type in from-importunknown import statement: starts with command '%s'improper number of parts to 'assert' statement: %dunhandled small_stmt: TYPE=%d NCH=%d unexpected token in 'if' statement: %swrong number of tokens for 'while' statement: %dwrong number of children for 'except' clause: %dunhandled compound_stmt: TYPE=%d NCH=%d invalid comp_op: has %d childrenAwait expressions are only supported in Python 3.5 and greaterUnderscores in numeric literals are only supported in Python 3.6 and greater%S - Consider hexadecimal for huge integer literals to avoid decimal conversion limits.dict unpacking cannot be used in dict comprehensionFormat strings are only supported in Python 3.6 and greater/builddir/build/BUILD/Python-3.8.20/Python/ast.cbytes can only contain ASCII literal characters.cannot mix bytes and nonbytes literals'in ' requires string as left operand, not %.100sfield value is required for Constant__new__() called with non-type 'self'%s.__new__(): not enough arguments%s.__new__(X): X is not a type object (%s)%s.__new__(%s): %s is not a subtype of %s%s.__new__(%s) is not safe, use %s.__new__()field value is required for Exprunicodedata.normalize() must return a string, not %.200sfield name is required for aliasfield ctx is required for Namefield value is required for AssignPyErr_NewException: name must be module.classfield ctx is required for ListFailed to initialize __main__.__annotations__Failed to retrieve builtins moduleFailed to initialize __main__.__builtins__Failed to retrieve BuiltinImporterFailed to initialize __main__.__loader__can't initialize sys standard streams is a directory, cannot continueencoder %s returned bytearray instead of bytes; use codecs.encode() to encode to arbitrary types'%.400s' encoder returned '%.400s' instead of 'bytes'; use codecs.encode() to encode to arbitrary typesfield value is required for Attributefield attr is required for Attributefield ctx is required for AttributeGenerator expression must be parenthesizedpositional argument follows keyword argument unpackingpositional argument follows keyword argumentiterable argument unpacking follows keyword argument unpackingexpression cannot contain assignment, perhaps you meant "=="?field func is required for Callfield name is required for ClassDefAsync functions are only supported in Python 3.5 and greaterCannot have two type comments on defnon-default argument follows default argumentnamed arguments must follow bare *bare * has associated type commentunexpected node in varargslist: %d @ %ditems() returned item which size is not 2mappingproxy() argument must be a mapping, not %s%.200s.%U() returned a non-iterable (type %.200s)Async for loops are only supported in Python 3.5 and greaterfield left is required for Comparefield op is required for BoolOpfield target is required for Forfield iter is required for Forfield name is required for FunctionDeffield args is required for FunctionDeffield op is required for UnaryOpfield operand is required for UnaryOpfield left is required for BinOpfield op is required for BinOpfield right is required for BinOpfield value is required for keywordRefusing to create an inheritance cycle__subclasshook__ must return either False, True, or NotImplemented__subclasses__() must return a list_abc_impl is set to a wrong typefield value is required for Indexfield value is required for Subscriptfield slice is required for Subscriptfield ctx is required for Subscriptfield ctx is required for Tuplefield target is required for AugAssignfield op is required for AugAssignfield value is required for AugAssignfield value is required for Starredfield ctx is required for Starredmodule kind %d should not be possiblefrom __future__ imports must occur at the beginning of the filefuture feature %.100s is not defined while getting the repr of an object__repr__ returned non-string (type %.200s)string is too long to generate reprexpected a subclass of ImportErrorTextIOWrapper() argument 'errors' must be str or None, not %.50scould not determine default encoding'%.400s' is not a text encoding; use %s to handle arbitrary codecsthis compiler does not handle Suitesthis compiler does not handle FunctionTypessymtable analysis recursion depth mismatch (before=%d, after=%d)annotated name '%U' can't be globalannotated name '%U' can't be nonlocalname '%U' is parameter and globalname '%U' is used prior to global declarationname '%U' is assigned to before global declarationname '%U' is parameter and nonlocalname '%U' is used prior to nonlocal declarationname '%U' is assigned to before nonlocal declarationmaximum recursion depth exceeded during compilationassignment expression cannot be used in a comprehension iterable expressionassignment expression cannot rebind comprehension iteration variable '%U'assignment expression within a comprehension cannot be used in a class bodyimport * only allowed at module levelduplicate argument '%U' in function definitioncomprehension inner loop cannot rebind assignment expression target '%U'private identifier too large to be mangledFile or stream is not writable.Failed to import the site modulename '%U' is nonlocal and globalnonlocal declaration not allowed at module levelno binding for nonlocal '%U' founditer(v, w): v must be callableencoding without a string argumenterrors without a string argumentstring argument without an encodingcannot convert '%.200s' object to bytearray/builddir/build/BUILD/Python-3.8.20/Objects/bytearrayobject.cdeallocated bytearray object has exported buffers'%.200s' object is not reversibleunary op %d should not be possible'yield from' inside async function'await' outside async function'%.200s' object is not callable; perhaps you missed a comma?Unrecognized conversion character %dparam invalid in attribute expression'%.200s' object is not subscriptable; perhaps you missed a comma?%.200s indices must be integers or slices, not %.200s; perhaps you missed a comma?param invalid in subscript expressionstarred assignment target must be in a list or tuplecan't use starred expression hererange() arg 3 must not be zerorange too large to represent as a range_iteratorparam invalid for deref variableparam invalid for local variableparam invalid for global variableparam invalid for name variable'return' with value in async generatorinvalid node type (%d) for augmented assignmentextended slice invalid in nested sliceinvalid node type (%d) for annotated assignmentassertion is always true, perhaps remove parentheses?'continue' not properly in loop'async for' outside async functioninteger division or modulo by zeroPyCapsule_New called with null pointercoroutine ignored GeneratorExitgenerator ignored GeneratorExitasync generator ignored GeneratorExitdir(): expected keys() of locals to be a list, not '%.200s'object does not provide __dir__%.200s.__dict__ is not a dictionaryPyCapsule_GetPointer called with invalid PyCapsule objectPyCapsule_GetPointer called with incorrect name'%.200s' object doesn't support item deletionlookup %s in %s %d %d freevars of %s: %s map() must have at least two arguments.can't multiply sequence by non-int of type '%.200s'must be str or None, not %.100stoo many statically nested blocks"is" with a literal. Did you mean "=="?"is not" with a literal. Did you mean "!="?must assign iterable to extended sliceattempt to assign sequence of size %zd to extended slice of size %zddefault 'except:' must be last'%.200s' object is not a containerdecoding to str: need a bytes-like object, %.80s found'%.400s' decoder returned '%.400s' instead of 'str'; use codecs.decode() to decode to arbitrary typesFormat specifier must be a string, not %.200sType %.100s doesn't define __format____format__ must return a str, not %.200sinplace binary op %d should not be possibleExceeds the limit (%d) for integer string conversion; use sys.set_int_max_str_digits() to increase the limitnot enough arguments for format string%%%c format: an integer is required, not %.200s%%%c format: a number is required, not %.200sunsupported format character '%c' (0x%x) at index %zdnot all arguments converted during string formattingExisting exports of data: object cannot be re-sizedPyBuffer_ToContiguous: len != view->lenAsync with statements are only supported in Python 3.5 and greaterfield context_expr is required for withitemcan't extend bytearray with %.100scan't set bytearray slice from %.100sunknown Unicode character name\N escapes not supported (can't load unicodedata module)can't convert negative value to unsigned intPython int too large to convert to C unsigned longobject too deeply nested to marshalcould not find io module state (interpreter shutdown?)iterable unpacking cannot be used in comprehensionlogic error in count_comp_forsAsync comprehensions are only supported in Python 3.6 and greaterfield target is required for comprehensionfield iter is required for comprehensionfield elt is required for ListCompf-string: single '}' is not allowedf-string: unexpected end of stringf-string: expressions nested too deeplyf-string expression part cannot include a backslashf-string: too many nested parenthesisf-string expression part cannot include '#'f-string: closing parenthesis '%c' does not match opening parenthesis '%c'f-string: self documenting expressions are only supported in Python 3.8 and greaterf-string: invalid conversion character: expected 's', 'r', or 'a'f-string: empty expression not allowedunderlying buffer has been detachedreadline() should have returned a str object, not '%.200s'illegal decoder state: the first item should be a bytes object, not '%.200s'underlying %s() should have returned a bytes-like object, not '%.200s'field body is required for Expressionraw readinto() returned invalid length %zd (should have been between 0 and %zd)PyMemoryView_FromBuffer(): info->buf must not be NULLfield value is required for FormattedValueIncrementalNewlineDecoder.__init__ not calleddecoder should return a string result, not '%.200s'field test is required for IfExpfield body is required for IfExpfield orelse is required for IfExpPrecision not allowed in integer format specifierSign not allowed with integer format specifier 'c'Alternate form (#) not allowed with integer format specifier 'c'bytearray_getbuffer: view==NULL argument is obsolete%s: src and dst must be the same typeinvalid \x escape at position %zddecoding error; unknown error handling code: %.400sfield test is required for Whilefield key is required for DictCompfield value is required for DictCompbad operand type for unary -: '%.200s''yield' inside list comprehension'yield' inside set comprehension'yield' inside dict comprehension'yield' inside generator expressioncan only concatenate str (not "%.200s") to strtoo many expressions in star-unpacking assignmenttwo starred expressions in assignmentasynchronous comprehension outside of an asynchronous functionunknown scope for %.100s in %.100s(%s) symbols: %s locals: %s globals: %sFailed checking if argv[0] is an import path entry Type "help", "copyright", "credits" or "license" for more information.Unable to decode the command from the command line: %ls: can't open file '%s': [Errno %d] %s %ls: '%ls' is a directory, cannot continue Could not import runpy module Could not access runpy._run_module_as_main Could not convert module name to unicode Could not create arguments for runpy._run_module_as_main /builddir/build/BUILD/Python-3.8.20/Python/ceval.cdynamic module does not define module export function (%s_%s)initialization of %s failed without raising an exceptioninitialization of %s raised unreported exceptioninit function of %s returned uninitialized objectinitialization of * did not return PyModuleDefinitialization of %s did not return an extension module__annotations__ must be set to a dict objectcan only concatenate list (not "%.200s") to listfield args is required for Lambdafield body is required for Lambdafield name is required for AsyncFunctionDeffield args is required for AsyncFunctionDefgc: %zd uncollectable objects at shutdowngc: %zd uncollectable objects at shutdown; use gc.set_debug(gc.DEBUG_UNCOLLECTABLE) to list themCannot write %zi characters at %zi in a string of %zi charactersCannot copy %s characters into a string of %s charactersCannot modify a string currently usedcpython.PyInterpreterState_ClearPyThreadState_Clear: warning: thread still has a frame PyThreadState_Clear: warning: thread still has a generator cpython._PySys_ClearAuditHooksfield test is required for Assertfield value is required for Awaitfield elt is required for GeneratorExpfield value is required for YieldFromint has too many bits to express in a platform size_tPyInterpreterState_Delete: invalid interpPyInterpreterState_Delete: remaining threadsPyInterpreterState_Delete: remaining subinterpreterstype 'partial' takes at least one argumentthe first argument must be callablecan't convert negative value to size_tPython int too large to convert to C size_tPyThreadState_Delete: tstate is still currentPyThreadState_Delete: NULL tstatePyThreadState_Delete: NULL interppopitem(): dictionary is emptywrapper %s() takes no keyword argumentsexpected %d argument%s, got %zdcan't apply this %s to %s objectord() expected string of length 1, but %.200s foundord() expected a character, but string of length %zd founddescriptor '%V' of '%.100s' object needs an argumentdescriptor '%V' requires a '%.100s' object but received a '%.100s'range indices must be integers or slices, not %.200sregular expression code size limit exceededexpected string or bytes-like objectfield elt is required for SetCompcannot use a string pattern on a bytes-like objectcannot use a bytes pattern on a string-like objectmaxsize should be integer or Nonemodule %s: m_size may not be negative for multi-phase initializationmodule %s has multiple create slotsmodule %s uses unknown slot ID %icreation of module %s failed without setting an exceptioncreation of module %s raised unreported exceptionmodule %s is not a module object, but requests module statemodule %s specifies execution slots, but did not create a ModuleType instancemaketrans arguments must have same lengthcan't unpack IEEE 754 special value on non-IEEE platformbad operand type for unary ~: '%.200s'.__class__.__qualname__ is not a unicode objectobject of type '%.200s' has no len()/builddir/build/BUILD/Python-3.8.20/Objects/iterobject.cunsupported operand type(s) for ** or pow(): '%.100s' and '%.100s'unsupported operand type(s) for pow(): '%.100s', '%.100s', '%.100s'pow() 3rd argument cannot be 0base is not invertible for the given modulusbytearray indices must be integers or slices, not %.200scan assign only bytes, buffers, or iterables of ints in range(0, 256)attempt to assign bytes of size %zd to extended slice of size %zdargument should be integer or bytes-like object, not '%.200s'translation table must be 256 characters longFile or stream is not seekable.Negative size passed to PyByteArray_FromStringAndSizeinvalid literal for int() with base %d: %.200Rint() arg 2 must be >= 2 and <= 36int string too large to convertExceeds the limit (%d) for integer string conversion: value has %zd digits; use sys.set_int_max_str_digits() to increase the limitargument should be integer or None, not '%.200s'python: Can't reopen .pyc file python: failed to set __main__.__loader__ float() argument must be a string or a number, not '%.200s'could not convert string to %s: %Rcould not convert string to float: %Rcould not convert string to float: '%.200s'value too large to convert to float: '%.200s'repeat argument cannot be negativeNon-UTF-8 code starting with '\x%.2x' in file %U on line %i, but no encoding declared; see http://python.org/dev/peps/pep-0263/ for detailsbytes object is too large to make reprUn;translating error handler must return (str, int) tupleposition %zd from error handler out of boundssep must be None or a string, not %.200send must be None or a string, not %.200sencoder should return a bytes object, not '%.200s'sequence item %zd: expected a bytes-like object, %.80s foundsequence changed size during iterationcharacter mapping must be in range(0x%x)character mapping must return integer, None or strnull file for PyFile_WriteStringcannot unpack non-iterable %.200s objectnot enough values to unpack (expected %d, got %d)not enough values to unpack (expected at least %d, got %d)too many values to unpack (expected %d)not enough values to unpack (expected at least %d, got %zd)Cannot specify both ',' and '_'.Format specifier missing precisionCannot specify '%c' with '%c'.Cannot specify '%c' with '\x%x'.raw write() returned invalid length %zd (should have been between 0 and %zd)%s first arg must be bytes or a tuple of bytes, not %sPyThreadState_Get: no current threadfloat too large to pack with d formatStop argument for islice() must be None or an integer: 0 <= x <= sys.maxsize.Indices for islice() must be None or an integer: 0 <= x <= sys.maxsize.Step for islice() must be a positive integer or None.At least one argument is required.descriptor for index '%zd' for tuple subclasses doesn't apply to '%s' objectconstructor requires a sequence%.500s() takes a dict as second arg, if any%.500s() takes an at least %zd-sequence (%zd-sequence given)%.500s() takes an at most %zd-sequence (%zd-sequence given)%.500s() takes a %zd-sequence (%zd-sequence given)int too large to convert to floatvars() argument must have __dict__ attributebytes must be in range(0, 256)cannot convert '%.200s' object to bytesmemoryview: format argument must be a stringmemoryview: casts are restricted to C-contiguous viewsshape must be a list or a tuplememoryview: cast must be 1D -> ND or ND -> 1Dmemoryview: destination format must be a native single character format prefixed with an optional '@'memoryview: cannot cast between two non-byte formatsmemoryview: length is not a multiple of itemsizememoryview.cast(): elements of shape must be integersmemoryview.cast(): elements of shape must be integers > 0memoryview.cast(): product(shape) > SSIZE_MAXmemoryview: product(shape) * itemsize != buffer sizememoryview: cannot cast view with zeros in shape or stridesfirst maketrans argument must be a string if there is a second argumentthe first two maketrans arguments must have equal lengthif you give only one argument to maketrans it must be a dictstring keys in translate table must be of length 1keys in translate table must be strings or integersmemoryview: unsupported format %smemoryview: format %s not supportedcannot convert dictionary update sequence element #%zd to a sequencedictionary update sequence element #%zd has length %zd; 2 is requiredInternal lock count overflowedcannot release un-acquired lockregister() takes at least 1 argument (0 given)illegal environment variable namePyBytes_FromFormatV(): %c format expects an integer in range [0; 255]configuration names must be strings or integersunrecognized configuration namePyCapsule_Import could not import module "%s"PyCapsule_Import "%s" is not validInitialization arguments are not supportedCouldn't get thread-state dictionarytuple.index(x): x not in tuple__hash__ method should return an integercan only assign string to %s.__name__, not '%s'co_argcount must be a positive integerco_posonlyargcount must be a positive integerco_kwonlyargcount must be a positive integerco_nlocals must be a positive integerco_stacksize must be a positive integerco_flags must be a positive integerco_firstlineno must be a positive integer__code__ must be set to a code object%U() requires a code object with %zd free vars, not %zdbad operand type for abs(): '%.200s'type %.100s doesn't define __round__ methodrounded value too large to representcannot convert float infinity to integercannot convert float NaN to integerstring too large in _PyUnicode_FormatLongPyNumber_ToBase: base must be 2, 8, 10 or 16audit() missing 1 required positional argument: 'event'expected str for argument 'event'expected str for argument 'event', not %.200spow() 3rd argument not allowed unless all arguments are integers0.0 cannot be raised to a negative power__getformat__() argument 1 must be 'double' or 'float'insane float_format or double_formatUn;decoding error handler must return (str, int) tuplecodec must pass exception instancedeque mutated during iterationdeque mutated during remove().deque.remove(x): x not in deque'%.200s' object is not an iteratoroptional 3rd arg must be a dictionaryPyEval_AcquireThread: NULL new thread statePyEval_AcquireThread: non-NULL old thread statesignal %i cannot be registered, use enable() insteadcould not acquire lock for %A at interpreter shutdown, possibly due to daemon threadsfork not supported for subinterpretersLoad averages are unobtainablefailed releasing import lock after fork/builddir/build/BUILD/Python-3.8.20/Python/pystrtod.cmust be %d-item sequence, not %.50smust be sequence of length %d, not %zdunsupported format string passed to %.200s.__format__fill character is bigger than the string maximum characterInvalid value NaN (not a number)PyThreadState_DeleteCurrent: no current tstateother argument must be K instanceonly classes may be registeredcould not register None for cross-interpreter sharingcould not register int for cross-interpreter sharingcould not register bytes for cross-interpreter sharingcould not register str for cross-interpreter sharingPyState_AddModule: Module Definition is NULLPyState_AddModule: Module already added!'%.200s' object can't be concatenatedcontext variable name must be a strtimestamp out of range for platform time_tcannot clear an executing framefloat too large to pack with f formatreadline() should have returned a bytes object, not '%.200s'%s: cannot use dir_fd and follow_symlinks together%s%s%s unavailable on this platformencoder must return a tuple (object, integer)Error in atexit._run_exitfuncs: code point in surrogate code point range(0xd800, 0xe000)code point not in range(0x110000)bad argument type for built-in operation__getnewargs_ex__ should return a tuple, not '%.200s'__getnewargs_ex__ should return a tuple of length 2, not %zdsecond item of the tuple returned by __getnewargs_ex__ must be a dict, not '%.200s'__getnewargs__ should return a tuple, not '%.200s'%.200s.__slotnames__ should be a list or None, not %.200scopyreg._slotnames didn't return a list or None__slotsname__ changed size during iterationfirst item of the tuple returned by __getnewargs_ex__ must be a tuple, not '%.200s'globals must be a real dict; try eval(expr, {}, mapping)eval must be given globals and locals when called without a framecode object passed to eval() may not contain free variablesType %.100s doesn't define __sizeof____sizeof__() should return >= 0'registry' must be a dict or None_warnings.filters must be a list_warnings.filters item %zd isn't a 5-tupleaction must be a string, not '%.200s'_warnings.defaultaction must be a string, not '%.200s'_warnings.onceregistry must be a dict, not '%.200s'Unrecognized action (%R) in warnings.filters: %Rwarnings._showwarnmsg() must be set to a callableunable to get warnings.WarningMessageweakly-referenced object no longer existsOut of memory and PyExc_MemoryError is not initialized yetComparison between bytearray and stringcategory must be a Warning subclass, not '%s'unsupported operand type(s) for %.100s: '%.100s' and '%.100s'newline must be str or None, not %.200sinitial_value must be str or None, not %.200sstring is longer than the bufferdeallocated BytesIO object has exported buffersstring argument expected, got '%s'fileno() returned a non-integerargument must be an int, or have a fileno() method.file descriptor cannot be a negative integer (%i)Python int too large for C unsigned shortcannot add more objects to bytearrayintermediate overflow during divisioninteger division result too large for a floatrange object index out of range%U() missing %i required %s argument%s: %Ubytearray object is too large to make reprnon-hexadecimal number found in fromhex() arg at position %zdthrow() third argument must be a traceback objectinstance exception may not have a separate valueexceptions must be classes or instances deriving from BaseException, not %s%.200s() %.200s must be %.50s, not %.50s%%b requires a bytes-like object, or an object that implements __bytes__, not '%.100s'%%%c format: %s is required, not %.200s%c requires an integer in range(256) or a single bytenot all arguments converted during bytes formattingattribute name must be a string%.200s() takes no positional argumentscannot modify read-only memorymemoryview slice assignments are currently restricted to ndim = 1memoryview assignment: lvalue and rvalue have different structuresdecoder must return a tuple (object,integer)complex() can't take second arg if first is a stringcomplex() second arg can't be a stringcomplex() first argument must be a string or a number, not '%.200s'complex() second argument must be a number, not '%.200s'__complex__ returned non-complex (type %.200s)__complex__ returned non-complex (type %.200s). The ability to return an instance of a strict subclass of complex is deprecated, and may be removed in a future version of Python.an instance of ContextVar was expectedcan't convert complex to float%.200s attribute must be bytesencoded result is too long for a Python stringOn;encoding error handler must return (str/bytes, int) tuple%.200s attribute must be unicodecharacter mapping must be in range(256)character mapping must return integer, bytes or None, not %.400sABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/partial character in shift sequencenon-zero padding bits in shift sequenceinvalid whence (%i, should be 0, 1 or 2)expected at most 1 arguments, got %zdupdate() takes at most 1 positional argument (%zd given)need more than 0 values to unpackneed more than 1 value to unpacktoo many values to unpack (expected 2)OrderedDict mutated during iterationOrderedDict changed size during iterationcannot use assignment expressions with %sfield target is required for NamedExprfield value is required for NamedExprzip_longest() got an unexpected keyword argumentInvalid whence (%i, should be 0, 1 or 2)Can't do nonzero cur-relative seeksmemoryview: internal error in richcompare__defaults__ must be set to a tuple object__get__(None, None) is invalidsum() can't sum strings [use ''.join(seq) instead]sum() can't sum bytes [use b''.join(seq) instead]sum() can't sum bytearray [use b''.join(seq) instead]__await__() returned a coroutine__await__() returned non-iterator of type '%.100s'object %.100s can't be used in 'await' expressionslice indices must be integers or have an __index__ methodbad operand type for unary +: '%.200s'__bool__ should return bool, returned %s0.0 to a negative or complex powerfield target is required for AnnAssignfield annotation is required for AnnAssignfield target is required for AsyncForfield iter is required for AsyncFor'async with' outside async functioncomplex() arg is a malformed stringhuge integer: number of bits overflows a Py_ssize_tcan't take floor or mod of complex number.can't take floor of complex number.Zero padding is not allowed in complex format specifier'=' alignment flag is not allowed in complex format specifierUnknown format code '%c' for object of type '%.200s'Unknown format code '\x%x' for object of type '%.200s'iiiiiiiii;strftime(): illegal time tuple argumentTuple or struct_time argument requiredcan only assign string to %s.__qualname__, not '%s'cannot re-enter the tee iteratorcannot convert Infinity to integer ratiocannot convert NaN to integer ratioiiiiiiiii;mktime(): illegal time tuple argumentsleep length must be non-negativenon-integer arguments in divisionmaxdigits must be 0 or larger than %dhexadecimal string too long to converthexadecimal value too large to represent as a floatinvalid hexadecimal floating-point stringfirst argument must be callablewith Barry as BDFL, use '<>' instead of '!='EOF while scanning triple-quoted string literalEOL while scanning string literalinconsistent use of tabs and spaces in indentationunindent does not match any outer indentation leveltoo many levels of indentationunexpected character after line continuation characterinvalid character in identifiermultiple statements found while compiling a single statementMissing parentheses in call to 'print'. Did you mean print(%U%s)?Missing parentheses in call to 'exec'required field "body" missing from ModuleModule field "body" must be a list, not a %.200sModule field "body" changed size during iterationrequired field "type_ignores" missing from ModuleModule field "type_ignores" must be a list, not a %.200srequired field "lineno" missing from TypeIgnorerequired field "tag" missing from TypeIgnoreexpected some sort of type_ignore, but got %RModule field "type_ignores" changed size during iterationrequired field "body" missing from InteractiveInteractive field "body" must be a list, not a %.200sInteractive field "body" changed size during iterationrequired field "body" missing from Expressionrequired field "argtypes" missing from FunctionTypeFunctionType field "argtypes" must be a list, not a %.200sFunctionType field "argtypes" changed size during iterationrequired field "returns" missing from FunctionTyperequired field "body" missing from SuiteSuite field "body" must be a list, not a %.200sSuite field "body" changed size during iterationexpected some sort of mod, but got %Rrequired field "lineno" missing from stmtrequired field "col_offset" missing from stmtrequired field "name" missing from FunctionDefrequired field "args" missing from FunctionDefrequired field "body" missing from FunctionDefFunctionDef field "body" must be a list, not a %.200sFunctionDef field "body" changed size during iterationrequired field "decorator_list" missing from FunctionDefFunctionDef field "decorator_list" must be a list, not a %.200sFunctionDef field "decorator_list" changed size during iterationrequired field "name" missing from AsyncFunctionDefrequired field "args" missing from AsyncFunctionDefrequired field "body" missing from AsyncFunctionDefAsyncFunctionDef field "body" must be a list, not a %.200sAsyncFunctionDef field "body" changed size during iterationrequired field "decorator_list" missing from AsyncFunctionDefAsyncFunctionDef field "decorator_list" must be a list, not a %.200sAsyncFunctionDef field "decorator_list" changed size during iterationrequired field "name" missing from ClassDefrequired field "bases" missing from ClassDefClassDef field "bases" must be a list, not a %.200sClassDef field "bases" changed size during iterationrequired field "keywords" missing from ClassDefClassDef field "keywords" must be a list, not a %.200sClassDef field "keywords" changed size during iterationrequired field "body" missing from ClassDefClassDef field "body" must be a list, not a %.200sClassDef field "body" changed size during iterationrequired field "decorator_list" missing from ClassDefClassDef field "decorator_list" must be a list, not a %.200sClassDef field "decorator_list" changed size during iterationrequired field "targets" missing from DeleteDelete field "targets" must be a list, not a %.200sDelete field "targets" changed size during iterationrequired field "targets" missing from AssignAssign field "targets" must be a list, not a %.200sAssign field "targets" changed size during iterationrequired field "value" missing from Assignrequired field "target" missing from AugAssignrequired field "op" missing from AugAssignrequired field "value" missing from AugAssignrequired field "target" missing from AnnAssignrequired field "annotation" missing from AnnAssignrequired field "simple" missing from AnnAssignrequired field "target" missing from Forrequired field "iter" missing from Forrequired field "body" missing from ForFor field "body" must be a list, not a %.200sFor field "body" changed size during iterationrequired field "orelse" missing from ForFor field "orelse" must be a list, not a %.200sFor field "orelse" changed size during iterationrequired field "target" missing from AsyncForrequired field "iter" missing from AsyncForrequired field "body" missing from AsyncForAsyncFor field "body" must be a list, not a %.200sAsyncFor field "body" changed size during iterationrequired field "orelse" missing from AsyncForAsyncFor field "orelse" must be a list, not a %.200sAsyncFor field "orelse" changed size during iterationrequired field "test" missing from Whilerequired field "body" missing from WhileWhile field "body" must be a list, not a %.200sWhile field "body" changed size during iterationrequired field "orelse" missing from WhileWhile field "orelse" must be a list, not a %.200sWhile field "orelse" changed size during iterationrequired field "test" missing from Ifrequired field "body" missing from IfIf field "body" must be a list, not a %.200sIf field "body" changed size during iterationrequired field "orelse" missing from IfIf field "orelse" must be a list, not a %.200sIf field "orelse" changed size during iterationrequired field "items" missing from WithWith field "items" must be a list, not a %.200sWith field "items" changed size during iterationrequired field "body" missing from WithWith field "body" must be a list, not a %.200sWith field "body" changed size during iterationrequired field "items" missing from AsyncWithAsyncWith field "items" must be a list, not a %.200sAsyncWith field "items" changed size during iterationrequired field "body" missing from AsyncWithAsyncWith field "body" must be a list, not a %.200sAsyncWith field "body" changed size during iterationrequired field "body" missing from TryTry field "body" must be a list, not a %.200sTry field "body" changed size during iterationrequired field "handlers" missing from TryTry field "handlers" must be a list, not a %.200srequired field "lineno" missing from excepthandlerrequired field "col_offset" missing from excepthandlerrequired field "body" missing from ExceptHandlerExceptHandler field "body" must be a list, not a %.200sExceptHandler field "body" changed size during iterationexpected some sort of excepthandler, but got %RTry field "handlers" changed size during iterationrequired field "orelse" missing from TryTry field "orelse" must be a list, not a %.200sTry field "orelse" changed size during iterationrequired field "finalbody" missing from TryTry field "finalbody" must be a list, not a %.200sTry field "finalbody" changed size during iterationrequired field "test" missing from Assertrequired field "names" missing from ImportImport field "names" must be a list, not a %.200sImport field "names" changed size during iterationrequired field "names" missing from ImportFromImportFrom field "names" must be a list, not a %.200sImportFrom field "names" changed size during iterationrequired field "names" missing from GlobalGlobal field "names" must be a list, not a %.200sGlobal field "names" changed size during iterationrequired field "names" missing from NonlocalNonlocal field "names" must be a list, not a %.200sNonlocal field "names" changed size during iterationrequired field "value" missing from Exprexpected some sort of stmt, but got %Rrequired field "lineno" missing from exprrequired field "col_offset" missing from exprrequired field "op" missing from BoolOpexpected some sort of boolop, but got %Rrequired field "values" missing from BoolOpBoolOp field "values" must be a list, not a %.200sBoolOp field "values" changed size during iterationrequired field "target" missing from NamedExprrequired field "value" missing from NamedExprrequired field "left" missing from BinOprequired field "op" missing from BinOprequired field "right" missing from BinOprequired field "op" missing from UnaryOpexpected some sort of unaryop, but got %Rrequired field "operand" missing from UnaryOprequired field "args" missing from Lambdarequired field "body" missing from Lambdarequired field "test" missing from IfExprequired field "body" missing from IfExprequired field "orelse" missing from IfExprequired field "keys" missing from DictDict field "keys" must be a list, not a %.200sDict field "keys" changed size during iterationrequired field "values" missing from DictDict field "values" must be a list, not a %.200sDict field "values" changed size during iterationrequired field "elts" missing from SetSet field "elts" must be a list, not a %.200sSet field "elts" changed size during iterationrequired field "elt" missing from ListComprequired field "generators" missing from ListCompListComp field "generators" must be a list, not a %.200sListComp field "generators" changed size during iterationrequired field "elt" missing from SetComprequired field "generators" missing from SetCompSetComp field "generators" must be a list, not a %.200sSetComp field "generators" changed size during iterationrequired field "key" missing from DictComprequired field "value" missing from DictComprequired field "generators" missing from DictCompDictComp field "generators" must be a list, not a %.200sDictComp field "generators" changed size during iterationrequired field "elt" missing from GeneratorExprequired field "generators" missing from GeneratorExpGeneratorExp field "generators" must be a list, not a %.200sGeneratorExp field "generators" changed size during iterationrequired field "value" missing from Awaitrequired field "value" missing from YieldFromrequired field "left" missing from Comparerequired field "ops" missing from CompareCompare field "ops" must be a list, not a %.200sexpected some sort of cmpop, but got %RCompare field "ops" changed size during iterationrequired field "comparators" missing from CompareCompare field "comparators" must be a list, not a %.200sCompare field "comparators" changed size during iterationrequired field "func" missing from Callrequired field "args" missing from CallCall field "args" must be a list, not a %.200sCall field "args" changed size during iterationrequired field "keywords" missing from CallCall field "keywords" must be a list, not a %.200sCall field "keywords" changed size during iterationrequired field "value" missing from FormattedValuerequired field "values" missing from JoinedStrJoinedStr field "values" must be a list, not a %.200sJoinedStr field "values" changed size during iterationrequired field "value" missing from Constantrequired field "value" missing from Attributerequired field "attr" missing from Attributerequired field "ctx" missing from Attributerequired field "value" missing from Subscriptrequired field "slice" missing from Subscriptrequired field "ctx" missing from Subscriptrequired field "value" missing from Starredrequired field "ctx" missing from Starredrequired field "id" missing from Namerequired field "ctx" missing from Namerequired field "elts" missing from ListList field "elts" must be a list, not a %.200sList field "elts" changed size during iterationrequired field "ctx" missing from Listrequired field "elts" missing from TupleTuple field "elts" must be a list, not a %.200sTuple field "elts" changed size during iterationrequired field "ctx" missing from Tupleexpected some sort of expr, but got %RAST identifier must be of type strexpected some sort of expr_context, but got %Rexpected some sort of operator, but got %RSuite is not valid in the CPython compilerAnnAssign with simple non-Name targetRaise with cause but no exceptionTry has neither except handlers nor finalbodyTry has orelse but no except handlersNone disallowed in statement listNone disallowed in expression listName node can't be used with '%s' constantexpression which can't be assigned to in %s contextexpression must have %s context but has %s insteadBoolOp with less than 2 valuesDict doesn't have the same number of keys as valuesCompare has a different number of comparators and operandsgot an invalid type in Constant: %srequired field "dims" missing from ExtSliceExtSlice field "dims" must be a list, not a %.200sExtSlice field "dims" changed size during iterationrequired field "value" missing from Indexexpected some sort of slice, but got %R'%U' codec can't decode byte 0x%02x in position %zd: %U'%U' codec can't decode bytes in position %zd-%zd: %Uswitch interval must be strictly positive__dict__ must be set to a dictionary, not a '%.200s'Cannot recover from stack overflow.maximum recursion depth exceeded%sreduce() arg 2 must support iterationreduce() of empty sequence with no initial valuefirst argument must be callable or None'%.200s' object is unsliceableunexpected expression in assignment %d (line %d)Exception ignored on building sys.unraisablehook argumentsException ignored in audit hookException ignored in sys.unraisablehookclock_gettime(CLOCK_PROCESS_CPUTIME_ID)the processor time used is not available or its value cannot be represented/builddir/build/BUILD/Python-3.8.20/Objects/methodobject.cinteger argument expected, got '%s'multi-dimensional sub-views are not implementedindex out of bounds on dimension %dcannot hash writable memoryview objectmemoryview: hashing is restricted to formats 'B', 'b' or 'c'memoryview: invalid type for format '%s'memoryview: invalid value for format '%s'cannot index %zd-dimension view with %zd-element tuplemethodcaller needs at least one argument, the method namekeywords dict changed size during iterationargument of type '%.200s' is not iterablesequence.index(x): x not in sequencebytesiobuf_getbuffer: view==NULL argument is obsoleteoperation forbidden on released PickleBuffer objectcannot extract raw buffer from non-contiguous buffer%.200s%.200s argument after ** must be a mapping, not %.200s%.200s%.200s keywords must be strings%.200s%.200s got multiple values for keyword argument '%U'In structseq_repr(), member %zd name is NULL for type %.500scan only assign tuple to %s.__bases__, not %scan only assign non-empty tuple to %s.__bases__, not ()%s.__bases__ must be tuple of classes, not '%s'a __bases__ item causes an inheritance cycle%s assignment: '%s' deallocator differs from '%s'%s assignment: '%s' object layout differs from '%s'expected PickleBuffer, %.200s found<%s object; span=(%zd, %zd), match=%.50R>tuple assignment index out of rangeCouldn't create thread-state for new threadauto-releasing thread-state, but no thread-state for this threadThis thread state must be current when releasingfloat too large to pack with e formatstrerror() argument out of rangeiiiiiiiii;asctime(): illegal time tuple argumentclock_gettime(CLOCK_THREAD_CPUTIME_ID)The fill character must be a unicode character, not %.100sThe fill character must be exactly one character long%s:%d: bad argument to internal functioninvalid decimal Unicode string'%U' codec can't encode character '\x%02x' in position %zd: %U'%U' codec can't encode character '\u%04x' in position %zd: %U'%U' codec can't encode character '\U%08x' in position %zd: %U'%U' codec can't encode characters in position %zd-%zd: %Ufree variable '%.200s' referenced before assignment in enclosing scopetimeout must be greater than 0Timeout (%lu:%02lu:%02lu.%06u)! unable to start watchdog threadSmall block threshold = %d, in %u size classes. class size num pools blocks in use avail blocks ----- ---- --------- ------------- ------------ # bytes lost to arena alignmentEnable tracemalloc to get the memory block allocation traceback Memory block allocated at (most recent call first): ((((((PyObject*)(op))->ob_type))->tp_flags & ((1UL << 29))) != 0)0 <= mp->ma_used && mp->ma_used <= usable(((keys->dk_size) & (keys->dk_size-1)) == 0)0 <= keys->dk_usable && keys->dk_usable <= usable0 <= keys->dk_nentries && keys->dk_nentries <= usablekeys->dk_usable + keys->dk_nentries <= usableentry->me_value != ((void *)0)entry->me_value == ((void *)0)mp->ma_values[i] != ((void *)0)/builddir/build/BUILD/Python-3.8.20/Objects/typeobject.c!_PyObject_IsFreed((PyObject *)type)(((PyObject*)(type))->ob_refcnt) >= 1((((((PyObject*)(type))->ob_type))->tp_flags & ((1UL << 31))) != 0)!(type->tp_flags & (1UL << 13))((((((PyObject*)(op))->ob_type))->tp_flags & ((1UL << 28))) != 0)kind == PyUnicode_1BYTE_KIND || kind == PyUnicode_2BYTE_KIND || kind == PyUnicode_4BYTE_KINDcompact->utf8_length == ascii->lengthcompact->wstr_length == ascii->length((Py_UCS4) ((kind) == PyUnicode_1BYTE_KIND ? ((const Py_UCS1 *)(data))[(ascii->length)] : ((kind) == PyUnicode_2BYTE_KIND ? ((const Py_UCS2 *)(data))[(ascii->length)] : ((const Py_UCS4 *)(data))[(ascii->length)] ) )) == 0(((PyObject*)(op))->ob_refcnt) >= 1sys.set_asyncgen_hook_finalizersys.set_asyncgen_hook_firstiterPython memory allocator called without holding the GILPyEval_ReleaseThread: NULL thread statePyEval_ReleaseThread: wrong thread statePyEval_AcquireLock: current thread state is NULL_Py_SetProgramFullPath() failed: out of memoryPy_SetProgramName() failed: out of memoryPy_SetPythonHome() failed: out of memoryCan't initialize lock for runtime interpretersCan't initialize ID lock for main interpreterCan't initialize lock for cross-interpreter data registry, <%s object>><%s %s object owner=%ld count=%lu at %p>Stack (most recent call first): unable to get the interpreter stateunable to get the thread head statea ContextVar key was expected, got %Rcan't delete tb_next attributeexpected traceback object, got '%s'unable to raise a stack overflow (allocated %zu bytes on the stack, %zu recursive calls)don't know how to handle %.200s in error callbackthis __dict__ descriptor does not support '%.200s' objectsCannot create a consistent method resolution order (MRO) for basesnull argument to internal routineexpected a writable bytes-like objectPyCapsule_GetName called with invalid PyCapsule objectPyCapsule_GetDestructor called with invalid PyCapsule objectPyCapsule_GetContext called with invalid PyCapsule objectPyCapsule_SetPointer called with null pointerPyCapsule_SetPointer called with invalid PyCapsule objectPyCapsule_SetName called with invalid PyCapsule objectPyCapsule_SetDestructor called with invalid PyCapsule objectPyCapsule_SetContext called with invalid PyCapsule object__context__ may not be deletedexception context must be None or derive from BaseExceptionexception cause must be None or derive from BaseExceptionfailed to change existing open_code hookcannot create 'stderrprinter' instances__kwdefaults__ must be set to a dict objectNotImplementedType takes no argumentsEllipsisType takes no argumentsThis object has no __weakref__an instance of Context was expectedcannot exit context: %R has not been enteredcannot exit context: thread state references a different context objectcannot enter context: %R is already enteredTokens can only be created by ContextVarsfailed to create init interpreter ID mutex__setformat__() argument 1 must be 'double' or 'float'__setformat__() argument 2 must be 'unknown', 'IEEE, little-endian' or 'IEEE, big-endian'can only set %s format to 'unknown' or the detected platform valuerun() missing 1 required positional argument/builddir/build/BUILD/Python-3.8.20/Objects/funcobject.cexpected tuple for closure, got '%.100s'non-dict keyword only default argsPyState_RemoveModule called on module with slotsPyState_RemoveModule: Module index invalid.PyState_RemoveModule: Interpreters module-list not accessible.PyState_RemoveModule: Module index out of bounds.Python int too large for C unsigned inta strictly positive integer is requiredcan't delete __class__ attribute__class__ must be set to a class, not '%s' object__class__ assignment only supported for heap types or ModuleType subclassesboth destination and source must be bytes-like objectsdestination is too small to receive data from sourceBad call flags in _PyMethodDef_RawFastCallDict. METH_OLDARGS is no longer supported!field tag is required for TypeIgnorefield returns is required for FunctionTypemaximum recursion limit exceededinternal error in regular expression enginedeque already at its maximum sizeAST string must be of type strbad argument to internal functionPyImport_ReInitLock failed to create a new lock%S does not support cross-interpreter dataunrecognized interpreter ID %lld'%.200s' object can't be repeatedcomprehension with no generatorsmore positional defaults than args on argumentslength of kwonlyargs is not the same as kw_defaults on arguments'%.200s' object doesn't support slice deletion'%.200s' object doesn't support slice assignmentCan't convert '%.100s' object to str implicitlyname tuples must contain only strings, not '%.500s'the BufferedRWPair object is being garbage-collectedunderlying buffer is not writablewritable contiguous buffer requested for a non-contiguous object.required field "name" missing from alias.__name__ is not a unicode object.__objclass__.__qualname__ is not a unicode objectcan't prepend path0 to sys.pathPy_HasFileSystemDefaultEncodingPy_FileSystemDefaultEncodeErrors_Py_HasFileSystemDefaultEncodeErrorsfloat argument required, not %.200s%.400s constructor takes at most %zd positional argument%s%.400s got multiple values for argument '%U'Bad call flags in _PyMethodDef_RawFastCallKeywords. METH_OLDARGS is no longer supported!/builddir/build/BUILD/Python-3.8.20/Objects/fileobject.cobject.readline() returned non-stringException ignored when trying to write to the signal wakeup fd: the tracemalloc module has been unloadedthe number of frames must be in range [1; %i]could not allocate a large enough CPU setwrite could not complete without blockingPyUnicode_AsEncodedUnicode() is deprecated; use PyCodec_Encode() to encode from str to str'%.400s' encoder returned '%.400s' instead of 'str'; use codecs.encode() to encode to arbitrary typesPyUnicode_AsEncodedObject() is deprecated; use PyUnicode_AsEncodedString() to encode from str to bytes or PyCodec_Encode() for generic encodingPyUnicode_AsDecodedUnicode() is deprecated; use PyCodec_Decode() to decode from str to strPyUnicode_AsDecodedObject() is deprecated; use PyCodec_Decode() to decode from strpeek() should have returned a bytes object, not '%.200s'read() should have returned a bytes object, not '%.200s'<_io.FileIO fd=%d mode='%s' closefd=%s><_io.FileIO name=%R mode='%s' closefd=%s>reentrant call inside %s.__repr__%.200s() must return a deque, not %.200scan only concatenate deque (not "%.200s") to dequeimport: deleting existing key in sys.modules failedno positional arguments expected%.200s.__setstate__ argument should be 3-tuple, got %.200ssecond item of state must be an integer, not %.200sposition value cannot be negativethird item of state should be a dict, got a %.200sobject %.50s does not have __anext__ methodobject %.50s does not have __aiter__ methodobject %.50s does not have __await__ methoddescriptor '%V' requires a type but received a '%.100s' instancecannot reuse already awaited __anext__()/asend()anext(): asynchronous generator is already runningcannot reuse already awaited aclose()/athrow()aclose(): asynchronous generator is already runningathrow(): asynchronous generator is already runningmust have a sched_param objectIt is not possible to set the encoding or newline of stream after the first readexpected an iterator of ints, but iterator yielded %Rrecursion limit must be greater or equal than 1cannot set the recursion limit to %i at the recursion depth %i: the limit is too lownegative value for 'count' not allowedreadv() arg 2 must be a sequencepreadv2() arg 2 must be a sequencewritev() arg 2 must be a sequencepwritev() arg 2 must be a sequencesignal only works in main threadsignal handler must be signal.SIG_IGN, signal.SIG_DFL, or a callable objectrequired field "value" missing from keywordrequired field "arg" missing from argrequired field "lineno" missing from argrequired field "col_offset" missing from argrequired field "posonlyargs" missing from argumentsarguments field "posonlyargs" must be a list, not a %.200sarguments field "posonlyargs" changed size during iterationrequired field "args" missing from argumentsarguments field "args" must be a list, not a %.200sarguments field "args" changed size during iterationrequired field "kwonlyargs" missing from argumentsarguments field "kwonlyargs" must be a list, not a %.200sarguments field "kwonlyargs" changed size during iterationrequired field "kw_defaults" missing from argumentsarguments field "kw_defaults" must be a list, not a %.200sarguments field "kw_defaults" changed size during iterationrequired field "defaults" missing from argumentsarguments field "defaults" must be a list, not a %.200sarguments field "defaults" changed size during iterationrequired field "target" missing from comprehensionrequired field "iter" missing from comprehensionrequired field "ifs" missing from comprehensioncomprehension field "ifs" must be a list, not a %.200scomprehension field "ifs" changed size during iterationrequired field "is_async" missing from comprehensionrequired field "context_expr" missing from withitemcan't jump from the 'call' trace event of a new framef_lineno can only be set by a trace functioncan only jump from a 'line' trace eventline %d comes before the current code blockline %d comes after the current code blockcan't jump from a yield statementcan't jump to 'except' line as there's no exceptioncan't jump into the middle of a blocksignal number %ld out of rangeinvalid signal number %ld, please use valid_signals()uid should be integer, not %.200sgid should be integer, not %.200ssetgroups argument must be a sequenceinterpreter ID must be a non-negative int, got %Rinterpreter ID must be an int, got %.100s%.200s.__divmod__() must return a 2-tuple, not %.200scan't translate character '\x%02x' in position %zd: %Ucan't translate character '\u%04x' in position %zd: %Ucan't translate character '\U%08x' in position %zd: %Ucan't translate characters in position %zd-%zd: %U [Previous line repeated %ld more times] [Previous line repeated %ld more time] unable to determine login nameunderlying stream is not seekablecan't do nonzero cur-relative seekscan't do nonzero end-relative seeksinvalid whence (%d, should be %d, %d or %d)underlying read() should have returned a bytes object, not '%.200s'can't restore logical file position%.200s.__setstate__ argument should be 4-tuple, got %.200sthird item of state must be an integer, got %.200sfourth item of state should be a dict, got a %.200scomparing strings with non-ASCII characters is not supportedunsupported operand types(s) or combination of types: '%.100s' and '%.100s'Buffer must be single dimensionenv.keys() or env.values() is not a listgetpwnam(): name not found: %Rstr() or repr() returned '%.100s'domain must be a non-empty stringtelling position disabled by next() callcan't reconstruct logical file positionstate argument must be a tupleOK;setstate(): illegal state argumentcode: argcount must not be negativecode: posonlyargcount must not be negativecode: kwonlyargcount must not be negativecode: nlocals must not be negativesize must be 0 or a positive valuesetting stack size not supportedmodule_globals must be a dict, not '%.200s'callable finalizer expected, got %.50scallable firstiter expected, got %.50sset_wakeup_fd only works in main threadthe fd %i must be in non-blocking modePyImport_ExecCodeModuleWithPathnames: no interpreter!unknown f-value conversion kindunknown expression kind inside f-stringTraceback (most recent call last): sys.unraisablehook argument type must be UnraisableHookArgsTypeError: print_exception(): Exception expected for value, _thread.excepthook argument type must be ExceptHookArgsPy_ExitStatusException() must not be called on successsys.getcheckinterval() and sys.setcheckinterval() are deprecated. Use sys.setswitchinterval() instead.sys.getcheckinterval() and sys.setcheckinterval() are deprecated. Use sys.getswitchinterval() instead.sys.callstats() has been deprecated in Python 3.7 and will be removed in the futurecoroutine '%.50S' was never awaitedIgnoring unimportable $PYTHONBREAKPOINT: "%s"file.read() returned not bytes but %.100sPyInterpreterState_DeleteExceptMain: not main interpreterPyInterpreterState_DeleteExceptMain: missing mainBUG: internal directive bookkeeping brokensymtable() arg 3 must be 'exec' or 'eval' or 'single'Py_SetPath() failed: out of memory%s: argv must be a tuple or list%s: environment must be a mapping object%s: argv first element cannot be emptyfile_actions must be a sequence or NoneEach file_actions element must be a non-empty tupleOiO&ik;A open file_action tuple must have 5 elementsOi;A close file_action tuple must have 2 elementsOii;A dup2 file_action tuple must have 3 elementsUnknown file_actions identifierOO&;A scheduler tuple must have two elementsutime: you may specify either 'times' or 'ns' but not bothutime: 'times' must be either a tuple of two ints or Noneutime: 'ns' must be a tuple of two intsexecve: argv must be a tuple or listexecve: argv must not be emptyexecve: environment must be a mapping objectexecve: argv first element cannot be emptylink: src and dst must be the same typesymlink: src and dst must be the same typeexecv() arg 2 must be a tuple or listexecv() arg 2 must not be emptyexecv() arg 2 first element cannot be emptygeneration parameter must be less than the number of available generations (%i)generation parameter cannot be negativearg 3 (name) must be None or stringarg 4 (defaults) must be None or tuplearg 5 (closure) must be None or tuple%U requires closure of length %zd, not %zdarg 5 (closure) expected cell, found %sContext() does not accept any argumentsan instance of Token was expected%R was created by a different ContextVar%R was created in a different Contextexpected an instance of Token, got %RPy_EndInterpreter: thread is not currentPy_EndInterpreter: thread still has a framePy_EndInterpreter: not the last threadexpected traceback object or None, got '%s'bad ID: Allocated using API '%c', verified using API '%c'Debug memory block at address p=%p: %zu bytes originally requested The %d pad bytes at p-%d are Because memory is corrupted at the start, the count of bytes requested may be bogus, and checking the trailing pad bytes may segfault. The %d pad bytes at tail=%p are not all FORBIDDENBYTE (0x%02x): Failed calling sys.__interactivehook__ Py_Initialize must be called firstPy_AddPendingCall: cannot add pending calls (Python shutting down)Unable to decode the command line argument #%i an int variable for demonstration purposesenable(file=sys.stderr, all_threads=True): enable the fault handlerdisable(): disable the fault handleris_enabled()->bool: check if the handler is enableddump_traceback(file=sys.stderr, all_threads=True): dump the traceback of the current thread, or of all threads if all_threads is True, into filedump_traceback_later(timeout, repeat=False, file=sys.stderrn, exit=False): dump the traceback of all threads in timeout seconds, or each timeout seconds if repeat is True. If exit is True, call _exit(1) which is not safe.cancel_dump_traceback_later(): cancel the previous call to dump_traceback_later().register(signum, file=sys.stderr, all_threads=True, chain=False): register a handler for the signal 'signum': dump the traceback of the current thread, or of all threads if all_threads is True, into fileunregister(signum): unregister the handler of the signal 'signum' registered by register()_read_null(): read from NULL, raise a SIGSEGV or SIGBUS signal depending on the platform_sigsegv(release_gil=False): raise a SIGSEGV signalfatal_error_c_thread(): call Py_FatalError() in a new C thread._sigabrt(): raise a SIGABRT signal_sigfpe(): raise a SIGFPE signal_fatal_error(message): call Py_FatalError(message)_stack_overflow(): recursive call to raise a stack overflowTrue if the file descriptor will be closed by close().day of week, range [0, 6], Monday is 01 if summer time is in effect, 0 if not, and -1 if unknownThe time value as returned by gmtime(), localtime(), and strptime(), and accepted by asctime(), mktime() and strftime(). May be considered as a sequence of 9 integers. Note that several fields' values are not the same as those defined by the C language standard for struct tm. For example, the value of the field tm_year is the actual year, not year - 1900. See individual fields' descriptions for details.errno associated with this signalreal user ID of sending processitertools.combinations_with_replacementmaximum size of a deque or None if unboundedFactory for default value called by __missing__()._collections._deque_reverse_iteratorfunction object to use in future partial callstuple of arguments to future partial callsdictionary of keyword arguments to future partial callsValue wrapped by a key function.Weak-reference support module.A dictionary mapping group names to group numbers.The pattern string from which the RE object was compiled.The number of capturing groups in the pattern.The integer index of the last matched capturing group.The name of the last matched capturing group.The string passed to match() or search().The regular expression object.The index into the string at which the RE engine started looking for a match.The index into the string beyond which the RE engine will not go.integer time of last modificationtime of last access in nanosecondstime of last modification in nanosecondstime of last change in nanosecondsname of machine on network (implementation-defined)elapsed time since an arbitrary point in the pastwidth of the terminal window in charactersheight of the terminal window in charactersthe entry's base filename, relative to scandir() "path" argumentthe entry's full path name; equivalent to os.path.join(scandir_path, entry.name)CS_XBS5_ILP32_OFFBIG_LINTFLAGSCS_XBS5_LPBIG_OFFBIG_LINTFLAGSSC_THREAD_DESTRUCTOR_ITERATIONS.cpython-38-x86_64-linux-gnu.soname of the thread implementationname of the lock implementationname and version of the thread libraryHook to intercept first iterationHook to intercept finalizationwidth of the type used for hashing, in bitsprime number giving the modulus on which the hash function is basedvalue to be used for hash of a positive infinityvalue to be used for hash of a nanmultiplier used for the imaginary part of a complex numbername of the algorithm for hashing of str, bytes and memoryviewsinternal output size of hash algorithmsmall string optimization cutoff'alpha', 'beta', 'candidate', or 'final'set_coroutine_origin_tracking_depthget_coroutine_origin_tracking_depthImplements the 'strict' error handling, which raises a UnicodeError on coding errors.Implements the 'ignore' error handling, which ignores malformed data and continues.Implements the 'replace' error handling, which replaces malformed data with a replacement marker.Implements the 'xmlcharrefreplace' error handling, which replaces an unencodable character with the appropriate XML character reference.Implements the 'backslashreplace' error handling, which replaces malformed data with a backslashed escape sequence.Implements the 'namereplace' error handling, which replaces an unencodable character with a \N{...} escape sequence.Return the size (in bytes) of this objectsplit the argument as a field nameparse the argument as a format string__prepare__() -> dict used to create the namespace for the class statementthe instance invoking super(); may be Nonethe type of the instance invoking super(); may be Nonedictionary for instance variables (if defined)list of weak references to the object (if defined)__new__($type, *args, **kwargs) -- Create and return a new object. See help(type) for accurate signature.__repr__($self, /) -- Return repr(self).__hash__($self, /) -- Return hash(self).__call__($self, /, *args, **kwargs) -- Call self as a function.__str__($self, /) -- Return str(self).__getattribute__($self, name, /) -- Return getattr(self, name).__setattr__($self, name, value, /) -- Implement setattr(self, name, value).__delattr__($self, name, /) -- Implement delattr(self, name).__lt__($self, value, /) -- Return selfvalue.__ge__($self, value, /) -- Return self>=value.__iter__($self, /) -- Implement iter(self).__next__($self, /) -- Implement next(self).__get__($self, instance, owner, /) -- Return an attribute of instance, which is of type owner.__set__($self, instance, value, /) -- Set an attribute of instance to value.__delete__($self, instance, /) -- Delete an attribute of instance.__init__($self, /, *args, **kwargs) -- Initialize self. See help(type(self)) for accurate signature.__new__(type, /, *args, **kwargs) -- Create and return new object. See help(type) for accurate signature.__await__($self, /) -- Return an iterator to be used in await expression.__aiter__($self, /) -- Return an awaitable, that resolves in asynchronous iterator.__anext__($self, /) -- Return a value or raise StopAsyncIteration.__add__($self, value, /) -- Return self+value.__radd__($self, value, /) -- Return value+self.__sub__($self, value, /) -- Return self-value.__rsub__($self, value, /) -- Return value-self.__mul__($self, value, /) -- Return self*value.__rmul__($self, value, /) -- Return value*self.__mod__($self, value, /) -- Return self%value.__rmod__($self, value, /) -- Return value%self.__divmod__($self, value, /) -- Return divmod(self, value).__rdivmod__($self, value, /) -- Return divmod(value, self).__pow__($self, value, mod=None, /) -- Return pow(self, value, mod).__rpow__($self, value, mod=None, /) -- Return pow(value, self, mod).__abs__($self, /) -- abs(self)__bool__($self, /) -- self != 0__invert__($self, /) -- ~self__lshift__($self, value, /) -- Return self<>value.__rrshift__($self, value, /) -- Return value>>self.__and__($self, value, /) -- Return self&value.__rand__($self, value, /) -- Return value&self.__xor__($self, value, /) -- Return self^value.__rxor__($self, value, /) -- Return value^self.__or__($self, value, /) -- Return self|value.__ror__($self, value, /) -- Return value|self.__int__($self, /) -- int(self)__float__($self, /) -- float(self)__iadd__($self, value, /) -- Return self+=value.__isub__($self, value, /) -- Return self-=value.__imul__($self, value, /) -- Return self*=value.__imod__($self, value, /) -- Return self%=value.__ipow__($self, value, /) -- Return self**=value.__ilshift__($self, value, /) -- Return self<<=value.__irshift__($self, value, /) -- Return self>>=value.__iand__($self, value, /) -- Return self&=value.__ixor__($self, value, /) -- Return self^=value.__ior__($self, value, /) -- Return self|=value.__floordiv__($self, value, /) -- Return self//value.__rfloordiv__($self, value, /) -- Return value//self.__truediv__($self, value, /) -- Return self/value.__rtruediv__($self, value, /) -- Return value/self.__ifloordiv__($self, value, /) -- Return self//=value.__itruediv__($self, value, /) -- Return self/=value.__index__($self, /) -- Return self converted to an integer, if self is suitable for use as an index into a list.__matmul__($self, value, /) -- Return self@value.__rmatmul__($self, value, /) -- Return value@self.__imatmul__($self, value, /) -- Return self@=value.__len__($self, /) -- Return len(self).__getitem__($self, key, /) -- Return self[key].__setitem__($self, key, value, /) -- Set self[key] to value.__delitem__($self, key, /) -- Delete self[key].__contains__($self, key, /) -- Return key in self.__iadd__($self, value, /) -- Implement self+=value.__imul__($self, value, /) -- Implement self*=value.Wrapper for potentially out-of-band buffers__dir__() -> list specialized dir() implementationthe real part of a complex numberthe imaginary part of a complex numberthe numerator of a rational number in lowest termsthe denominator of a rational number in lowest termsReturns self, the complex conjugate of any int.Truncating an Integral returns itself.Flooring an Integral returns itself.Ceiling of an Integral returns itself.Rounding an Integral returns itself. Rounding with an ndigits argument also returns an integer.size in bytes of the C type used to represent a digitmaximum string conversion digits limitationminimum positive value for int_max_str_digitsDBL_MAX -- maximum representable finite floatDBL_MAX_EXP -- maximum int e such that radix**(e-1) is representableDBL_MAX_10_EXP -- maximum int e such that 10**e is representableDBL_MIN -- Minimum positive normalized floatDBL_MIN_EXP -- minimum int e such that radix**(e-1) is a normalized floatDBL_MIN_10_EXP -- minimum int e such that 10**e is a normalizedDBL_MANT_DIG -- mantissa digitsDBL_EPSILON -- Difference between 1 and the next representable floatFLT_RADIX -- radix of exponentqualified name of the generatorobject being iterated by yield from, or Nonequalified name of the coroutineobject being awaited on, or Nonequalified name of the async generatorA wrapper object implementing __await__ for coroutines.Operation only works on directories.Operation doesn't work on directories.Base class for warnings about resource usage.Base class for warnings about bytes and buffer related problems, mostly related to conversion from str or comparing to str.Base class for warnings about Unicode related problems, mostly related to conversion problems.Base class for warnings about probable mistakes in module importsBase class for warnings about constructs that will change semantically in the future.Base class for warnings about dubious runtime behavior.Base class for warnings about dubious syntax.Base class for warnings about features which will be deprecated in the future.Base class for warnings about deprecated features.Base class for warnings generated by user code.Base class for warning categories.Weak ref proxy used after referent went away.Internal error in the Python interpreter. Please report this to the Python maintainer, along with the traceback, the Python version, and the hardware/OS platform and version.Second argument to a division or modulo operation was zero.Result too large to be represented.Floating point operation failed.Base class for arithmetic errors.Inappropriate argument value (of correct type).Improper mixture of spaces and tabs.Local name referenced but not bound to a value.Method or function hasn't been implemented yet.Base class for I/O related errors.Import can't find module, or can't find name in module.Request to exit from the interpreter.Request that a generator exit.Signal the end from iterator.__next__().Signal the end from iterator.__anext__().Common base class for all non-exit exceptions.Common base class for all exceptionsD.get(k[,d]) -> D[k] if k in D, else d. d defaults to None.D.values() -> list of D's valuesD.items() -> list of D's (key, value) pairs, as 2-tuplesD.copy() -> a shallow copy of Dthe function (or other callable) implementing a methodthe instance to which a method is boundsem_initinvalid -X utf8 option valuefailed to LC_CTYPE localememory allocation failedPYTHONCOERCECLOCALEPYTHONUTF8POSIXPYTHONMALLOC646ansi_x3.4_1968ansi_x3.4_1986ansi_x3_4_1968cp367csasciiibm367iso646_usiso_646.irv_1991iso_ir_6us_asciidecoding errorPYTHONDEVMODEexpected long option unknown option %ls -J is reserved for Jython Unknown option: -%c LC_ALLLC_CTYPEfailed to read thread statecan't make main interpretercan't initialize warningscan't init contextcan't init floatcan't init longscan't initialize structseqcan't make first threadinitialization config is NULLunexpected end of datainvalid start byteinvalid continuation byte3.8.20strict/lib/pythonX.XPython %s cannot decode PYTHONWARNINGSPYTHONDEBUGPYTHONVERBOSEPYTHONOPTIMIZEPYTHONINSPECTPYTHONDONTWRITEBYTECODEPYTHONNOUSERSITEPYTHONUNBUFFEREDPYTHONDUMPREFSPYTHONMALLOCSTATScannot decode PYTHONPATHPYTHONHASHSEEDPYTHONFAULTHANDLERPYTHONPROFILEIMPORTTIMEPYTHONTRACEMALLOCPYTHONINTMAXSTRDIGITSPYTHONPYCACHEPREFIXcannot decode PYTHONHOMEPYTHONIOENCODINGcannot decode PREFIX define/opt/alt/python38lib64/python3.8cannot decode pybuilddir.txtencoding erroruuiopennegative argument not allowed/dev/urandomsem_timedwaitsem_trywaitsem_waitsem_postPyCOND_FINI(gil->cond) failedCould not allocate TSS entryPyCOND_INIT(gil->cond) failedtake_gil: NULL tstatePyCOND_WAIT(gil->cond) failedCan't initialize object typeCan't initialize type typeCan't initialize weakref typeCan't initialize int typeCan't initialize bool typeCan't initialize str typeCan't initialize list typeCan't initialize None typeCan't initialize super typeCan't initialize range typeCan't initialize dict typeCan't initialize set typeCan't initialize slice typeCan't initialize complex typeCan't initialize float typeCan't initialize tuple typeCan't initialize code typeCan't initialize frame typeCan't initialize method typeCan't initialize wrapper typeCan't initialize capsule typeCan't initialize cell typeutf-8%s() method: bad call flagsduplicate base class %Uduplicate base class) -- too many digits in integeruncollectablecollected{sisnsn}gc: %s <%s %p> in tp_clear ofgarbage collectionCan't initialize unicode typeCan't create empty stringerrmap insertion problem.can't initialize sys modulefailed to initialize a typecan't make modules dictionarycan't initialize sys dictmodules__displayhook____excepthook____breakpointhook____unraisablehook__hexversionCPython(szz)_git_frameworkapi_versioncopyrightplatformmaxsizemaxunicodebuiltin_module_nameslittlebyteorderabiflagsfinalcache_tagx86_64-linux-gnu_multiarchimplementationfloat_repr_stylenameless moduleassign tocan't set preliminary stderr__stderr__%.80s (%.80s) %.80s%s%s%s, %.20s, %.9s00:00:00Oct 26 2026unmatched paren in formatUnmatched paren in formatBad dict formatlinuxan integer is requiredlist modified during sortdict mutated during updatepthreadsemaphoreembedded null bytesy#nnsunsupported error handlerEllipsisFalseTrueboolclassmethodcomplexenumeratefilterfrozensetpropertyreversedstaticmethodzip__debug__BaseExceptionTypeErrorStopAsyncIterationStopIterationGeneratorExitSystemExitKeyboardInterruptModuleNotFoundErrorOSErrorEnvironmentErrorEOFErrorRuntimeErrorRecursionErrorNotImplementedErrorNameErrorUnboundLocalErrorAttributeErrorSyntaxErrorIndentationErrorTabErrorIndexErrorKeyErrorValueErrorUnicodeErrorUnicodeEncodeErrorUnicodeDecodeErrorUnicodeTranslateErrorAssertionErrorArithmeticErrorFloatingPointErrorOverflowErrorZeroDivisionErrorSystemErrorReferenceErrorMemoryErrorBufferErrorUserWarningPendingDeprecationWarningSyntaxWarningRuntimeWarningFutureWarningImportWarningUnicodeWarningBytesWarningResourceWarningConnectionErrorBlockingIOErrorBrokenPipeErrorChildProcessErrorConnectionAbortedErrorConnectionRefusedErrorConnectionResetErrorFileExistsErrorFileNotFoundErrorIsADirectoryErrorNotADirectoryErrorInterruptedErrorPermissionErrorProcessLookupErrorTimeoutErrorCan't backup builtins dictmeta_pathpath_importer_cache__main__filters_onceregistry_defaultactionmodule '%s' has no __dict____import__ not foundcan't import _impimportlib install failed_frozen_importlibimport _imp # builtin _install__path__recursion limit exceededmarshal data too shortsurrogatepassOOOiiiiiicode.__new__EOF read where not expectedbyte string is too largesize must be positiveinvalid kindcode: varnames is too smallnon-string found in code slotwaswere%U() keywords must be strings, from %zd to %zdKey__all__Itemceval: tstate mix-upceval: orphan tstatelost sys.displayhookbad RAISE_VARARGS oparg__build_class__ not foundno locals when deleting %Rname '%.200s' is not definedno locals when loading %R%U.%UXXX lineno: %d, opcode: %d unknown opcodePyEval_EvalFrameEx__name__tuple index out of range__orig_bases__type() takes 1 or 3 argumentsUO!O!:type.__new____slots__ must be identifiers__weakref__exactlyat leastat mostexcess ')' in getargs formatmissing ')' in getargs format%.200s%s takes no argumentsbad format string: %.200sstr or Nonestr, bytes or bytearraya byte string of length 1a unicode charactersize does not fit in an int(unicode conversion error)embedded null character(buffer is NULL)(encoding failed)(buffer_len is NULL)(unspecified)read-write bytes-like objectcontiguous buffer(impossible)bases must be types|O!O:supersuper(): no current framesuper(): no code objectsuper(): no argumentssuper(): arg[0] deletedsuper(): bad __class__ cellsuper(): empty __class__ cellOsobject.__getattr__bad memberdescr typeat least at most hasattrgetattrsetattrreadonly attributeTruncation of value to charTruncation of value to shortTruncation of value to intbad memberdescr type for %sThis object has no __dict__%.200s() takes no argumentscheck_hash_based_pycsmodule has no attribute '%U'isinstance in __instancecheck__ in comparisonXXX block stack overflowXXX block stack underflowwidth too bigprecision too big%lu%llu%zu%u%li%lli%zi%iexpected bytes, %.200s foundcan't delete attributecan't set attributeunreadable attributeempty separatormust be str, not %.100sis_frozenis_builtinTIMEOUT_MAXLockType_ExceptHookArgsReferenceTypeCallableProxyTyperuntime core not initializedfail to set sys.argvcan't initialize timecan't finish initializing syscan't initialize signalscan't initialize tracemallocwarnoptionsclock_gettime(CLOCK_REALTIME)_base_executablebase_prefixbase_exec_prefixpycache_prefix_xoptionsdont_write_bytecode_install_external_importersEmpty module namemodule name must be a stringlevel must be >= 0'__name__' not in globalsglobals must be a dictpackage must be a string__name__ must be a stringOOOOO_call_with_frames_removedcan't allocate locknot holding the import lockno current thread identtimeout|iO:acquiretimeout value is too largekeyword this functionEmpty keyword parameter nameEmpty parameter name after $%s: '%s'+=release unlocked lockis_frozen_packageargument 'name'get_frozen_objectstring, bytes or codeDEFAULT_BUFFER_SIZEUnsupportedOperations(OO){}filenoflushisattynewlinespeekread1readallreadintoresetseekabletell-=sem_destroyHAVE_FACCESSATF_OKR_OKW_OKTMP_MAXWCONTINUEDWNOHANGWUNTRACEDO_RDONLYO_WRONLYO_RDWRO_NDELAYO_NONBLOCKO_APPENDO_DSYNCO_RSYNCO_SYNCO_NOCTTYO_CREATO_EXCLO_LARGEFILEO_PATHO_TMPFILEPRIO_PROCESSPRIO_PGRPPRIO_USERO_CLOEXECO_ACCMODESEEK_HOLESEEK_DATAO_ASYNCO_DIRECTO_DIRECTORYO_NOFOLLOWO_NOATIMEEX_OKEX_USAGEEX_DATAERREX_NOINPUTEX_NOUSEREX_NOHOSTEX_UNAVAILABLEEX_SOFTWAREEX_OSERREX_OSFILEEX_CANTCREATEX_IOERREX_TEMPFAILEX_PROTOCOLEX_NOPERMEX_CONFIGST_RDONLYST_NOSUIDST_NODEVST_NOEXECST_SYNCHRONOUSST_MANDLOCKST_WRITEST_APPENDST_NOATIMEST_NODIRATIMEST_RELATIMEPOSIX_FADV_NORMALPOSIX_FADV_SEQUENTIALPOSIX_FADV_RANDOMPOSIX_FADV_NOREUSEPOSIX_FADV_WILLNEEDPOSIX_FADV_DONTNEEDP_PIDP_PGIDP_ALLWEXITEDWNOWAITWSTOPPEDCLD_EXITEDCLD_DUMPEDCLD_TRAPPEDCLD_CONTINUEDF_LOCKF_TLOCKF_ULOCKF_TESTRWF_DSYNCRWF_HIPRIRWF_SYNCRWF_NOWAITPOSIX_SPAWN_OPENPOSIX_SPAWN_CLOSEPOSIX_SPAWN_DUP2SCHED_OTHERSCHED_FIFOSCHED_RRSCHED_BATCHSCHED_IDLESCHED_RESET_ON_FORKXATTR_CREATEXATTR_REPLACEXATTR_SIZE_MAXRTLD_LAZYRTLD_NOWRTLD_GLOBALRTLD_LOCALRTLD_NODELETERTLD_NOLOADRTLD_DEEPBINDGRND_RANDOMGRND_NONBLOCKMFD_CLOEXECMFD_ALLOW_SEALINGMFD_HUGETLBMFD_HUGE_SHIFTMFD_HUGE_MASKMFD_HUGE_64KBMFD_HUGE_512KBMFD_HUGE_1MBMFD_HUGE_2MBMFD_HUGE_8MBMFD_HUGE_16MBMFD_HUGE_32MBMFD_HUGE_256MBMFD_HUGE_512MBMFD_HUGE_1GBMFD_HUGE_2GBMFD_HUGE_16GBconfstr_namessysconf_namesposix.times_resultposix.waitid_resultos.stat_resultos.statvfs_resultposix.sched_paramposix.uname_result_have_functionspathconf_namesenvironPy_tp_bases is not a tupleinvalid slot offsetordinal not in range(128)coroutine already executinggenerator already executinglist index out of rangecan only join an iterable__code__argument 'byteorder'to_bytesint too big to convertcan't concat %.100s to %.100sObject is not writable.from_bytesargument must be iterableinitializing zipimport failedunable to get sys.path_hooks# installing zipimport hook zipimport# installed zipimport hook # can't import zipimport __builtins__{OO}OOOOiU|OOOi:__import__CLOCK_REALTIMECLOCK_MONOTONICCLOCK_MONOTONIC_RAWCLOCK_PROCESS_CPUTIME_IDCLOCK_THREAD_CPUTIME_IDCLOCK_BOOTTIME_STRUCT_TM_ITEMSinvalid GMT offsettimezonealtzonedaylight(zz)tznameslice step cannot be zerofailed to enable faulthandlerfilesystem_encodingfilesystem_errorsstdio_encodingcannot decode %s|Oi:enableunknown encoding: %sunable to get sys.stderrsys.stderr is Noneencodingshandler must be callablestring, bytes or os.PathLikesOnnsbyte string is too longdrop_gil: GIL is not lockedsurrogateescape(iOOiO)(iOO)(iO)backslashreplacexmlcharrefreplace in __subclasscheck__|$OO:min|$OO:max%s() arg is an empty sequencestring index out of range&|$OO:ImportErrorimpossibleos.listdirrstrip%s arg must be None or strendswith|Oss:strint() missing string argumentargument 'path'open_code_iorbargument 'mode'argument 'encoding'argument 'errors'argument 'newline'invalid file: %Rinvalid mode: '%s''U' mode is deprecatedOsiOinvalid buffering sizeunknown mode: '%s'Osssinegative file descriptorinvalid mode: %.200sOsiexpected integer from openeropener returned %dI/O operation on closed filecan't allocate read lockI/O operation on closed file.raw stream has been detachedread of closed filereadall() should return bytesread() should return bytescompilecompile(): unrecognised flagsevalsinglefunc_typestring, bytes or ASTO:memoryviewModuleInteractiveExpressionFunctionTypeSuiteAsyncFunctionDefClassDefReturnDeleteAugAssignAnnAssignAsyncForWhileAsyncWithRaiseTryAssertImportImportFromGlobalNonlocalPassBreakContinueBoolOpNamedExprBinOpUnaryOpLambdaIfExpSetListCompSetCompDictCompGeneratorExpAwaitYieldYieldFromCompareCallFormattedValueJoinedStrConstantAttributeSubscriptStarredListTupleexpr_contextDelAugLoadAugStoreParamExtSliceIndexboolopMatMultModPowLShiftRShiftBitOrBitXorBitAndFloorDivunaryopInvertUAddUSubcmpopNotEqLtLtEGtGtEIsIsNotNotInexcepthandlerExceptHandlerkeywordaliaswithitemtype_ignoreTypeIgnores(O){OOOO}sub-views are not implementedmemoryview: invalid slice keyloadsyO_fix_co_filenameargument 1argument 2iso-8859-1utf-8-iso-latin-1iso-8859-1-iso-latin-1-encoding problem: %sencoding problem: %s with BOM!=<>XXX too many states!XXX ambiguity!%.200s is not a sequence# type: invalid hexadecimal literalinvalid octal literalinvalid binary literalinvalid decimal literaltoo many nested parentheseslookup_error:__call__Max string recursion exceededunexpected '{' in field nameunmatched '{' in format specMissing ']' in format stringNon-statement found: %d %dargument must be callableargument list must be a tupleinvalid augassign: %sillegal target for annotationunexpected flow_stmt: %dfinallymalformed 'try' statementinvalid async stament: %sunicode errorvalue errorinvalid comp_op: %sinvalid comp_op: %s %sunhandled factor: %d(%s) %U(%s) unknown errorunhandled atom %dunhandled expr: %dstring to parse is too longreplace string is too longunexpected import name: %dunicodedatanormalizecannot assign to %Ufield id is required for Namedeletecannot %s %sSIG_DFLSIG_IGNNSIGSIG_BLOCKSIG_UNBLOCKSIG_SETMASKdefault_int_handlerSIGHUPSIGINTSIGQUITSIGILLSIGTRAPSIGIOTSIGABRTSIGFPESIGKILLSIGBUSSIGSEGVSIGSYSSIGPIPESIGALRMSIGTERMSIGUSR1SIGUSR2SIGCLDSIGCHLDSIGPWRSIGIOSIGURGSIGWINCHSIGSTOPSIGTSTPSIGCONTSIGTTINSIGTTOUSIGVTALRMSIGPROFSIGXCPUSIGXFSZSIGRTMINSIGRTMAXITIMER_REALITIMER_VIRTUALITIMER_PROFsignal.ItimerErrorcan't create __main__ module__annotations____loader__BuiltinImporterencodings.utf_8encodings.latin_1OpenWrapper__stdin____stdout__iso_8859_1iso8859_1invalid syntaxkeyword argument repeateditems() returned non-iterable__bases__ is not tuplefield arg is required for argfield test is required for If__module__can't set %s.%scan't delete %s.%sOsOobject.__setattr___abc_registerCan only register classes_abc_subclasscheck__subclasses__weak object has gone away__doc__no symtablesuite should not be possible__future__nested_scopesgeneratorsdivisionabsolute_importwith_statementprint_functionunicode_literalsbarry_as_FLUFLgenerator_stopbracesnot a chancemodule filename missing<%s object at %p>expected a message argumentwbOOOsOOisiOOOicodecs.open()illegal newline value: %sincrementaldecoderlambdagenexprlistcompsetcompdictcomp__class__can only assign an iterableincrementalencoder|S_IFDIRS_IFCHRS_IFBLKS_IFREGS_IFIFOS_IFLNKS_IFSOCKS_IFDOORS_IFPORTS_IFWHTS_ISUIDS_ISGIDS_ISVTXS_ENFMTS_IREADS_IWRITES_IEXECS_IRWXUS_IRUSRS_IWUSRS_IXUSRS_IRWXGS_IRGRPS_IWGRPS_IXGRPS_IRWXOS_IROTHS_IWOTHS_IXOTHUF_NODUMPUF_IMMUTABLEUF_APPENDUF_OPAQUEUF_NOUNLINKUF_COMPRESSEDUF_HIDDENSF_ARCHIVEDSF_IMMUTABLESF_APPENDSF_NOUNLINKSF_SNAPSHOTST_MODEST_INOST_DEVST_NLINKST_UIDST_GIDST_SIZEST_ATIMEST_MTIMEST_CTIME|=|Oss:bytearraynegative countbyte must be in range(0, 256)compile.c compiler unitunknown symbol table entry'yield' outside function'await' outside function<<negative shift count__qualname____classcell__'return' outside functioninvalid subscript kind %d'break' outside loop//OiOopcode = %d PyCompile_OpcodeStackEffect()identifier not readytoo many constantscompiler_exit_scope()compiler_make_closure()repeated string is too longdecoding str is not supportedformat requires a mappingincomplete format key* wants int%c arg not in range(0x110000)%c requires int or charincomplete format\U%08xtruncated \UXXXXXXXX escapetruncated \xXX escapetruncated \uXXXX escape\ at end of stringillegal Unicode charactermalformed \N character escapeunicodedata.ucnhash_CAPImode out of rangesorteddumpsunmarshallable objectlstattoo many objects_bootlocalef-string: expecting '}'LC_TIMELC_COLLATELC_MONETARYLC_MESSAGESLC_NUMERIClocale.Errori:nl_langinfounsupported langinfo constantf-string: unmatched '%c'f-string: unterminated stringnot readableOO;illegal decoder stateos.mkdirbuiltins.idutf_8_decodeNnframe does not existwritingOOiios.renameTrailing \ in stringunexpected node.%d(Nii)Python %s on %s cpython.run_commandcpython.run_filePYTHONSTARTUPcpython.run_startupCould not open PYTHONSTARTUP cpython.run_stdinunable to get sys.pathcpython.run_modulerunpy_run_module_as_mainsys.excepthookin audit hookError in sys.excepthook: Original exception was: sys.excepthook is missing flush of closed filecreate_dynamicPyInitPyInitUspec.name must be a stringpunycodecc__file__replace bytes is too longunknown dlopen() error./%-.255s%.20s_%.200s_deque_reverse_iterator# clear builtins._ # clear sys.%s # restore sys.%s # cleanup[2] removing %U # cleanup[3] wiping %U # cleanup[3] wiping sys # cleanup[3] wiping builtins # destroy %S interncan't intern %.400s,)gc %s # clear[1] %s # clear[2] %s unclosed file %Rhow_many cannot be negative# clear sys.audit hooks sys._getframecall stack is not deep enougha number is requiredsetdefaultissubclassMAGICCODESIZEMAXREPEATMAXGROUPS__len__() should return >= 0argument 'code'argument 'groupindex'argument 'indexgroup'invalid SRE codeBuffer is NULLOOpO:lru_cachemaketransfromkeys%S.%s&=%.200s is not a mappingiter index too largebytearray index out of rangewhence value %d unsupportedseek of closed filerfind???Expected int as rr must be non-negative__cached__.pycSourcelessFileLoaderBad magic number in .pyc fileBad code object in .pyc fileSourceFileLoader_bootstrap_external_RAW_MAGIC_NUMBER|n:productrepeat argument too largeinfnancharacter maps to readline of closed filewriteobject with NULL filewrite to closed filenot writablejoin() result is too longInvalid format specifierint too large to formatstartswithnon-ascii grouped digiterrorcodeENODEVENOCSIEHOSTUNREACHENOMSGEUCLEANEL2NSYNCEL2HLTENODATAENOTBLKENOSYSEPIPEEINVALEOVERFLOWEADVEINTREUSERSENOTEMPTYENOBUFSEPROTOEREMOTEENAVAILECHILDELOOPEXDEVE2BIGESRCHEMSGSIZEEAFNOSUPPORTEBADREHOSTDOWNEPFNOSUPPORTENOPROTOOPTEBUSYEWOULDBLOCKEBADFDEDOTDOTEISCONNENOANOESHUTDOWNECHRNGELIBBADENONETEBADEEBADFEMULTIHOPEUNATCHEPROTOTYPEENOSPCENOEXECEALREADYENETDOWNENOTNAMEACCESELNRNGEILSEQENOTDIRENOTUNIQEPERMEDOMEXFULLECONNREFUSEDEISDIREPROTONOSUPPORTEROFSEADDRNOTAVAILEIDRMECOMMESRMNTEREMOTEIOEL3RSTEBADMSGENFILEELIBMAXESPIPEENOLINKENETRESETETIMEDOUTENOENTEEXISTEDQUOTENOSTREBADSLTEBADRQCELIBACCEFAULTEFBIGEDEADLKENOTCONNEDESTADDRREQELIBSCNENOLCKEISNAMECONNABORTEDENETUNREACHESTALEENOSRENOMEMENOTSOCKESTRPIPEEMLINKERANGEELIBEXECEL3HLTECONNRESETEADDRINUSEEOPNOTSUPPEREMCHGEAGAINENAMETOOLONGENOTTYERESTARTESOCKTNOSUPPORTETIMEEBFONTEDEADLOCKETOOMANYREFSEMFILEETXTBSYEINPROGRESSENXIOENOPKGENOMEDIUMEMEDIUMTYPEECANCELEDENOKEYEKEYEXPIREDEKEYREVOKEDEKEYREJECTEDEOWNERDEADENOTRECOVERABLEERFKILLENOTSUPOK;illegal decoder statemaxlen|OO:dequemaxlen must be non-negativefrexp() result out of rangespanno such group%S (%U, line %ld)%S (%U)%S (line %ld)repeated bytes are too longbeforeafter_in_childafter_in_parent'%s' must be callable, not %slstriplist.remove(x): x not in list_subxnew string is too longpop from empty listpop index out of rangereadlinessurrogates not allowedsubstring not found|Oss:bytes@?@d@f@N@n@Q@q@L@l@I@i@H@h@B@b@c@PO|Omemoryview: internal errorargument 3os.putenv%s=%s%ldthread.local.%pargument 'co_code'argument 'co_consts'argument 'co_names'argument 'co_varnames'argument 'co_freevars'argument 'co_cellvars'argument 'co_filename'argument 'co_name'argument 'co_lnotab'os.system>>garbageDEBUG_STATSDEBUG_COLLECTABLEDEBUG_UNCOLLECTABLEDEBUG_SAVEALLDEBUG_LEAKunlinkos.removedivmod__round__%s0%se%dprecision too largeos.scandirunclosed scandir iterator %Rfloat division by zero__getformat__doubleunknownIEEE, little-endianIEEE, big-endianUOnnUpop from an empty dequeos.chdirstart_new_threadfirst arg must be callable2nd arg must be a tuplecan't start new threadin thread started byi|Oii:registersignal number out of rangesys.addaudithookreentrant call inside %Ros.forkdddii:waitpidNi%+.02dInfinityNaNkk%R is not in list(kk):_acquire_restorecouldn't acquire lockis not retrievableinvalid generationi|z:setlocaleunsupported locale settinglocale query failedO:cmp_to_keyO:Kmissing 'getdata' func%[][...]os.chmodfollow_symlinkscodecs.encode()%s with '%s' codec failedutf_16_le_encodeutf-16-leutf-16-beutf-16truncated dataillegal encodingillegal UTF-16 surrogateutf_16_be_encodeutf_32_le_encodeutf-32-leutf-32-beutf-32utf_32_be_encode|zorder must be 'C', 'F' or 'A'imul*=setitemdelitem%.200s() argument %zd, item %d %.256scannot pickle '%.200s' objectN(Os)\Uxxxxxxxx out of rangerawunicodeescapelocals must be a mappingO|O:getsizeof_bootstrapalwayslost sys.stderr must be %.50s, not %.50sinvalid widening attempt_abc_instancechecksep must be length 1.sep must be ASCII.sep must be str or bytes.<<= ordinal not in range(256)UUnnUnew buffer size too largeillegal newline value: %Rnew position too large(ii)value must be positive(%s%s%sj%s{...}_module_reprpositionalkeyword-only%U and %U, %U, and %Ustr() on a bytes instancestr() on a bytearray instance(b(OiiN)centerresult too longsubsection not foundljustrindexrjust__reduce_ex__(O(Ns)N)(O(y#)N)(O()N)fromhexreadinto of closed filepop from empty bytearray%=a numberprec too big%c arg not in range(256)N(O)nN(())latin_1_encodeunhashable type: '%.200s'value not found in bytearray_reduce_ex(y#)charmap_buildcharmap_encodecharmap&#%d;rpartition^cannot delete memorypeek of closed file[Errno %S] %S: %R -> %R[Errno %S] %S: %R[Errno %S] %Ssys.settracein PyEval_SetTracecodecs.decode()decodingutf_16_le_decodeascii_decodeabsolute value too large//=(Nn)%.200s attribute not setlookupcharmap_decodelatin_1_decoderaw_unicode_escape_decodeutf_16_decodeutf_16_be_decodeutf_7_decodeascii_encoderaw_unicode_escape_encodeutf_16_encodeutf_7_encodeutf_8_encodeinvalid escape sequence '\%c'utf_16_ex_decodeNniill-formed sequenceunexpected special characterutf7unterminated shift sequencenegative seek value %zdutf_32_encodeutf_32_ex_decodeutf_32_le_decodeutf_32_be_decode(Cn)_count_elements%U (%s: %S)__defaults____kwdefaults__PyCF_ALLOW_TOP_LEVEL_AWAITPyCF_ONLY_ASTPyCF_TYPE_COMMENTSO|n:repeatunknown boolop foundunknown unaryop foundunknown cmpop founddelattrstring is too large to encode_forget_codecread-only bytes-like objectCP_UTF8readbuffer_encodeNegative seek position %zdutf_32_decodesearchobject.__delattr__(O(nO))Negative size value %zdlost builtins modulegtor_and_^=can't mod complex numbers.complex division by zerocomplex modulocomplex exponentiationfloat modulounexpected slice kindcan't convert complex to intU:__format__(dd)<%U.%U object at %p>mappingproxy(%R){{}} and or + - * @ / % << >> | ^ & // ** ~lambda == != < <= > >= is is not not in .unknown binary operatorunknown unary operator, /** if else [(yield)(yield (yield from await unexpected comparison kind,:=unknown expression kindU|O:strftimeday of month out of rangehour out of rangeminute out of rangeseconds out of rangeday of week out of rangeday of year out of rangen must be >= 0|O:gmtime|O:localtimeos.unsetenvfloat divmod()mktime argument out of range|O:ctime%s %s%3d %.2d:%.2d:%.2d %dcharacter out of rangeO|$O:ContextVarfailed to get LC_CTYPE localeint_curr_symbolcurrency_symbolmon_decimal_pointmon_thousands_sepmon_groupingpositive_signnegative_signint_frac_digitsp_cs_precedesp_sep_by_spacen_cs_precedesn_sep_by_spacep_sign_posnn_sign_posn>>=-0x0.0p+0-0x%sp%c%dself must not be Noneinvalid tokenexpected an indented blockunexpected indentunexpected unindentunexpected EOF while parsingexpression too longunknown decode errorunknown parsing errorerror=%d (sO) end=" "print exec unknown expr_context foundunknown operator foundexpected %s node, got %.400sinvalid integer value: %Rimpossible module nodeNegative ImportFrom levelunexpected statementtargetsempty %s on %sCompare with no comparatorsunexpected expressiondimsunknown slice nodeinvalid escape sequence \%cnnOnnnnncannot delete __dict__O(O)(OOOO)invalid partial state%U, %R%U, %S=%R%s(%R%U)reduce(OiiO)(zO)subscriptstarredfunction callgenerator expressionyield expressionawait expressionlist comprehensionset comprehensiondict comprehensiondict displayset displayf-string expressionconditional expressionnamed expressionException ignored %ssys.unraisablehookgetrusage(RUSAGE_SELF)_SC_CLK_TCK is too largetimes()clock()(O)OO(NO)OO(NiO)O(OO)ON(N)i(O(OOO))O()(OO)O()(O)O()state is not a tupleArguments must be iterators.N(N)O(On)O(()n)O(On)Ninvalid argumentsO(OO)%s(%zd)%s(%R)%s(%R, %R)O(n)O(N)(Oi)O(O)(Oi)O!iO(OO)lO(OO)(OOO)O(Nn)nO(OnNn)nO(On)(NN)O!O!O(())OONlen() of unsized object%s(%R, %zd)O(O)O(())(Oi)O(ONO)teedataobjectInvalid argumentsIndex out of rangeONOlength_hintis_%s(...)%s%Rmethod name must be a string%U=%R%s(%R, %U)containscount exceeds C integer sizeindex exceeds C integer sizecountOfgetitemindexOfiaddiandifloordivilshiftimodimatmul@=ioripowirshiftisubitruedivixoriconcatis_not@O|O:popdictionary is empty%s()O:PickleBufferN(ON)fd is greater than maximumfd is less than minimumos.rmdirN(OO)%s({%U}){%U}(d)(O(OO))__bases__negative size value %zd%s(%U, %U)%s(%R, maxlen=%zd)range(%R, %R)range(%R, %R, %R)0x%xre.compile(%.200R, %S)re.compile(%.200R)_expandpop from an empty setasctimeexpect int, got %s_strptimei:clock_getresi:clock_gettimeiO:clock_settimes:get_clock_infomonotonicperf_counterprocess_timethread_timeunknown clockadjustableresolutionk:pthread_getcpuclockidpadded string is too longwstrlegacy UCS2legacy asciilegacy latin1legacy UCS4expected str, got %sO|iOi:dump_traceback_laterTimeout (%lu:%02lu:%02lu)! %s xb+xbab+rb+pymallocpymalloc_debugRUNNING_ON_VALGRIND%5u %6u %11zu %15zu %13zu # arenas allocated total# arenas reclaimed# arenas highwater mark# arenas allocated current%zu arenas * %d bytes/arena# bytes in allocated blocks# bytes in available blocks%u unused pools * %d bytes# bytes lost to pool headers# bytes lost to quantizationTotal%d %ss * %zd bytes each%48s free PyMethodObjectfree PyFloatObjectfree PyFrameObjectfree PyListObjectfree PyDictObjectfree PyCFunctionObjectfree %d-sized PyTupleObject\x\u\U File "", line %s:%d: %s: Assertion "%s" failedAssertion failed _PyObject_AssertFailedkeys->dk_refcnt == 1(-2) <= ix && ix <= usableentry->me_hash == hashentry->me_hash != -1type->tp_dict != ((void *)0)kind == PyUnicode_1BYTE_KINDascii->state.ready == 1ascii->state.ascii == 0compact->utf8 != dataascii->length == 0ascii->hash == -1ascii->state.ready == 0ascii->state.interned == 0ascii->wstr != ((void *)0)data == ((void *)0)compact->utf8 == ((void *)0)data != ((void *)0)compact->utf8 == dataascii->wstr == dataascii->wstr != datacompact->utf8_length == 0compact->wstr_length == 0maxchar >= 128maxchar <= 255maxchar < 128maxchar >= 0x100maxchar <= 0xFFFFmaxchar >= 0x10000maxchar <= 0x10ffff!_PyObject_IsFreed(op)op->ob_type != ((void *)0)sys.setprofilein PyEval_SetProfilesu#nnsFatal Python error: Python runtime state: finalizing (tstate=%p)core initializedpreinitializedpreinitializingNT%d%.32s(%.32s)invalid labeldeallocating Nonedeallocating NotImplementeddeallocating cannot decode stringin new thread%s(%ld)slice(%R, %R, %R), NULL>unlocked<%s %s object at %p> ... File Current thread 0xThread 0x (most recent call first): traceback loop detectedCell is empty__cause__ may not be deletedsetopencodehookNoneType takes no argumentsO(O)nO(OOO)tb_linenotb_lastitb_nexttb_frame[ssss](iii) sssno interpreter providednot a weakrefdeque index out of range__set_format__non-dict annotationsnon-tuple default argstry sending as bytescharacters_writtencannot delete attributecall_tracing|n:rotatenO:insertdetachFile not open for %s_remove_dead_weakrefmissing interpmissing new_object funcunable to start the threadlength should not be negative(NNN)O|O&O&:index%R is not in dequeinstancemethod%R is not in range{snsnsn}can't create sys.pathcan't assign sys.pathO()NO()NNO(()n)NNisisssireadinto1%S.%SNNNKno mem for sys.argvcan't assign sys.argvcan't compute path0 from argv_config_initparse_argvisolateduse_environmentconfigure_localecoerce_c_localecoerce_c_locale_warnutf8_modedev_modeallocatorPy_FileSystemDefaultEncodingPy_UTF8ModePy_DebugFlagPy_VerboseFlagPy_QuietFlagPy_InteractiveFlagPy_InspectFlagPy_OptimizeFlagPy_NoSiteFlagPy_BytesWarningFlagPy_FrozenFlagPy_IgnoreEnvironmentFlagPy_DontWriteBytecodeFlagPy_NoUserSiteDirectoryPy_UnbufferedStdioFlagPy_HashRandomizationFlagPy_IsolatedFlagpre_configinstall_signal_handlersuse_hash_seedimport_timeshow_ref_countshow_alloc_countdump_refsmalloc_statsprogram_namepythonpath_envhomemodule_search_pathssite_importbytes_warninginspectinteractiveoptimization_levelparser_debugverbosequietuser_site_directoryconfigure_c_stdiobuffered_stdiostdio_errorsskip_source_first_linerun_filename_install_importlibcheck_hash_pycs_modepathconfig_warnings_init_mainglobal_configstate is not a dictionaryinput line too longcan't re-enter readlinestructStructunpack_from... truncated(not set)\'\x%02x\u%04xPython path configuration: PYTHONHOME = PYTHONPATH = program name = isolated = %i environment = %i user site = %i import site = %i sys.%s = %A sys.path = [ %A, ] EOF when reading a line((yi))resourceNiNcannot allocate lockiii:waitidi:sched_getaffinityi:sched_getparami:sched_getscheduleri:sched_rr_get_intervaliO&:sched_setparamiiO&:sched_setscheduleri:getsidii:setpgidii:tcsetpgrpisnN(N)Oargs may not be deleted<_io.FileIO [closed]><%s><%s name=%R><_io.TextIOWrapper name=%R%U encoding=%R> mode=%Rnamespace%s(%S)interpreter not initialized(OnN)(OOnN)lost sys.breakpointhookbuiltins.breakpointargument 'source'source_hashsched_priority out of rangeiO:sched_setaffinitynegative CPU numberCPU number too largedepth must be >= 0lseekpreadpreadvpwritepwritevposix_fallocateposix_fadvisefpathconfset_inheritableset_blockingcloserangemakedevUnknown signalsiginterruptan 'except'a 'finally'out oflineno must be an integerlineno out of rangecan't jump %s %s blockpthread_sigmaskuid is less than minimumuid is greater than maximumsetresuidsetreuidgid is less than minimumgid is greater than maximumsetresgidsetregidtoo many groupsgroups must be integerssigtimedwaittimeout must be non-negativeisisOOOgetpwuid(): uid not foundgetpwuid(): uid not found: %S(O(OiiN))DEF_GLOBALDEF_NONLOCALDEF_LOCALDEF_PARAMDEF_FREEDEF_FREE_CLASSDEF_IMPORTDEF_BOUNDDEF_ANNOTTYPE_FUNCTIONTYPE_CLASSTYPE_MODULEGLOBAL_EXPLICITGLOBAL_IMPLICITCELLSCOPE_OFFSCOPE_MASKobject address : %p object refcount : %ld object type : %p object type name: %s object repr : sO&:getgrouplistO&O&:initgroupsUU:strcollU:strxfrmzszsiszy#Oi;illegal decoder stateyi((OK))iiiiiiSO!O!O!UUiS|O!O!:codei|ii:set_threshold|n:stack_sizesize not valid: %zd bytesi:unregister|i:_sigsegvy|i:fatal_errorOU|i:getstatei:setstateOOUi|OOOO:warn_explicit|OOi|$p:set_wakeup_fd|Oi:dump_tracebackiiOn:sendfileregister_error{ !a!r!s async for tracebacklimit File "%U", line %d, in %U Exception ignored in: found File "%S", line %d ^ : _stderrException in thread pdb.set_tracePYTHONBREAKPOINTinit_frozensys._current_framesstring or bytesgc.get_referrersgc.get_referentskisignal.pthread_killposix_spawnp%s: argv must not be emptyos.posix_spawnos.forkpty(Ni)os.utimeOIIios.chownos.getxattrargument 'value'OOy#ios.setxattros.removexattros.listxattrexecveos.execiIIilchownos.linkos.symlinkexecvin:killos.killii:killpgos.killpgiiLos.lockfos.truncateftruncate(i)gc.get_objectsinput(): lost sys.stdininput(): lost sys.stdoutinput(): lost sys.stderrbuiltins.inputbuiltins.input/resultargument 'globals'arg 5 (closure) must be tuplefunction.__new__setitimer%R has already been used onceO&|$p:InterpreterID.__init__argument 'tb_frame'TracebackTypeO!|ndidn't expect a NULL pointerbad leading pad bytebad trailing pad byte API '%c' at p-%d: 0x%02x *** OUCH at tail+%d: 0x%02x Data at p: %02x ...FORBIDDENBYTE, as expected. __interactivehook__cpython.run_interactivehook>>> ... out of memory Python %s %s __main__ not frozen_frozen_importlib_external__hello____phello____phello__.spamgetstate() -> statesetstate(state)classmethclassmeth(*args, **kw)staticmethstaticmeth(*args, **kw)benchxxsubtypexxsubtype.spamlistxxsubtype.spamdict_symtableis_tracingclear_traces_get_traces_get_object_tracebackget_traceback_limitget_tracemalloc_memoryget_traced_memory_tracemallocdisableis_enabledcancel_dump_traceback_later_read_null_fatal_error_c_thread_sigabrt_sigfpe_fatal_error_stack_overflowall_threadssignumBus errorIllegal instructionFloating point exceptionAbortedSegmentation faultline_bufferinggetvalue__getstate____setstate__initial_valuenewline_io.StringIO_io._TextIOBase_CHUNK_SIZEwrite_throughreconfiguretranslate_dealloc_warnrawgetpreferredencodingiso8859-1_io.IncrementalNewlineDecoder_io._BufferedIOBase__sizeof__buffer_size_io.BufferedRandom_io.BufferedRWPair_io.BufferedWriter_io.BufferedReaderTrue if the file is closed.writelinesgetbuffer_io.BytesIOinitial_bytes_io._BytesIOBuffer_io.FileIOTrue if the file is closedclosefdString giving the file mode_checkClosed_checkSeekable_checkReadable_checkWritable__enter____exit___io._IOBase_io._RawIOBase__IOBase_closedextendlocaleconvdgettextdcgettextbindtextdomainbind_textdomain_codesetABDAY_1ABDAY_2ABDAY_3ABDAY_4ABDAY_5ABDAY_6ABDAY_7ABMON_1ABMON_2ABMON_3ABMON_4ABMON_5ABMON_6ABMON_7ABMON_8ABMON_9ABMON_10ABMON_11ABMON_12RADIXCHARTHOUSEPCRNCYSTRAM_STRPM_STRCODESETT_FMT_AMPMERAERA_D_FMTERA_D_T_FMTERA_T_FMTALT_DIGITSYESEXPRNOEXPR_DATE_FMTacquire_lockrelease_locklocked_lock_is_owned_release_saveexc_typeException typeexc_valueException valueexc_tracebackException tracebackThreadstart_newallocate_lockexit_threadinterrupt_mainget_identget_native_id_set_sentinel_excepthook_thread.ExceptHookArgs_thread.RLock_thread.lock_localdummy_destroyed_thread._localThread-local data_thread._localdummyThread-local dummytm_yearyear, for example, 1993tm_monmonth of year, range [1, 12]tm_mdayday of month, range [1, 31]tm_hourhours, range [0, 23]tm_minminutes, range [0, 59]tm_secseconds, range [0, 61])tm_wdaytm_ydayday of year, range [1, 366]tm_isdsttm_zoneabbreviation of timezone nametm_gmtoffoffset from UTC in secondsclock_gettime_nsclock_settime_nssleepmktimetzsetmonotonic_nsprocess_time_nsthread_time_nsperf_counter_nstime.struct_time_strptime_timeS_ISDIRS_ISCHRS_ISBLKS_ISREGS_ISFIFOS_ISLNKS_ISSOCKS_ISDOORS_ISPORTS_ISWHTS_IMODES_IFMTfilemode_statsi_signosignal numbersi_codesignal codesi_errnosi_pidsending process IDsi_uidsi_statusexit value or signalsi_bandband event for SIGPOLLalarmgetitimerraise_signalstrsignalgetsignalpausesigpendingsigwaitsigwaitinfovalid_signalssignal.struct_siginfowarn_on_full_buffer_run_exitfuncs_ncallbacksatexit__reduce____copy__from_iterable__length_hint__stepselectorsinitialitertoolsitertools.repeatitertools.productitertools.permutationsitertools.zip_longestitertools.countitertools.compressitertools.combinationsitertools.accumulatecombinations_with_replacementitertools.chainitertools.islicefillvaluetimesitertools.cycleitertools.groupbyitertools.dropwhileitertools.takewhileitertools.starmapitertools.filterfalseitertools._grouperitertools._tee_dataobjectitertools._teeget_cache_token_abc_init_reset_registry_reset_caches_get_dump_abc__abstractmethods____subclasshook___abc_data_abc_implappendappendleftcopyextendleftpopleft__reversed__reverse__missing__default_factorycollections.defaultdict_collections__setitem___collections._deque_iteratorcollections.deque_collections._tuplegettertruthneginvinvertnot__operatoroperator.itemgetteroperator.attrgetteroperator.methodcallerkeywordsobjcache_infocache_clear__deepcopy___functoolsfunctools._lru_cache_wrapperfunctools.partialfunctools._lru_list_elemuser_functiontypedcache_info_typefunctools.KeyWrappermycmpgetweakrefcountgetweakrefs_codecsfullmatchsubnfindallfinditerscannergroupindexpatternThe regex matching flags.groupdictlastindexlastgroupregsendposgetcodesizeascii_iscasedunicode_iscasedascii_tolowerunicode_tolowerindexgrouptemplatemaxsplitrepl_sre_sre.SRE_Scannerre.Matchre.TEMPLATEre.IGNORECASEre.LOCALEre.MULTILINEre.DOTALLre.UNICODEre.VERBOSEre.DEBUGre.ASCIIre.Patternpw_nameuser namepw_passwdpasswordpw_uiduser idpw_gidgroup idpw_gecosreal namepw_dirhome directorypw_shellshell programgetpwuidgetpwallpwd.struct_passwdpwdst_modeprotection bitsst_inoinodest_devdevicest_nlinknumber of hard linksst_uiduser ID of ownerst_gidgroup ID of ownerst_sizetotal size, in bytesinteger time of last accessinteger time of last changest_atimest_mtimetime of last modificationst_ctimest_atime_nsst_mtime_nsst_ctime_nsst_blksizeblocksize for filesystem I/Ost_blocksnumber of blocks allocatedst_rdevdevice type (if inode device)f_bsizef_frsizef_blocksf_bfreef_bavailf_filesf_ffreef_favailf_flagf_namemaxf_fsidsysnameoperating system namenodenameoperating system releaseoperating system versionmachinehardware identifiersched_prioritythe scheduling priorityuser timesystem timechildren_useruser time of childrenchildren_systemsystem time of childrenelapsedcolumnsis_diris_fileis_symlink__fspath__ttynamefchmodfchownctermidgetcwdgetcwdbnicegetprioritysetprioritycopy_file_rangeumaskuname_exitregister_at_forksched_get_priority_maxsched_get_priority_minsched_yieldopenptygetegidgeteuidgetgidgetgroupsgetpidgetppidgetuidgetloginsetuidseteuidsetgidsetegidsetgroupswait3setsidtcgetpgrpdevice_encodingdupdup2fstatpipepipe2majorminorfchdirfsyncfdatasyncWCOREDUMPWIFCONTINUEDWIFSTOPPEDWIFSIGNALEDWIFEXITEDWEXITSTATUSWTERMSIGWSTOPSIGfstatvfsconfstrsysconfabortgetloadavggetresuidgetresgidget_terminal_sizecpu_countget_inheritableget_blockingfspathgetrandommemfd_createfd2policytarget_is_directorysrc_dir_fddst_dir_fdoffset_srcoffset_dstfile_actionssetpgroupresetidssetsigmasksetsigdefwhichwhoeffective_idsHAVE_FCHDIRHAVE_FCHMODHAVE_FCHMODATHAVE_FCHOWNHAVE_FCHOWNATHAVE_FEXECVEHAVE_FDOPENDIRHAVE_FPATHCONFHAVE_FSTATATHAVE_FSTATVFSHAVE_FTRUNCATEHAVE_FUTIMENSHAVE_FUTIMESHAVE_FUTIMESATHAVE_LINKATHAVE_LCHOWNHAVE_LSTATHAVE_LUTIMESHAVE_MEMFD_CREATEHAVE_MKDIRATHAVE_MKFIFOATHAVE_MKNODATHAVE_OPENATHAVE_READLINKATHAVE_RENAMEATHAVE_SYMLINKATHAVE_UNLINKATHAVE_UTIMENSATos.terminal_sizeposixposix.DirEntryi:getpgidii:wait4struct_rusageCS_GNU_LIBC_VERSIONCS_GNU_LIBPTHREAD_VERSIONCS_LFS64_CFLAGSCS_LFS64_LDFLAGSCS_LFS64_LIBSCS_LFS64_LINTFLAGSCS_LFS_CFLAGSCS_LFS_LDFLAGSCS_LFS_LIBSCS_LFS_LINTFLAGSCS_PATHCS_XBS5_ILP32_OFF32_CFLAGSCS_XBS5_ILP32_OFF32_LDFLAGSCS_XBS5_ILP32_OFF32_LIBSCS_XBS5_ILP32_OFF32_LINTFLAGSCS_XBS5_ILP32_OFFBIG_CFLAGSCS_XBS5_ILP32_OFFBIG_LDFLAGSCS_XBS5_ILP32_OFFBIG_LIBSCS_XBS5_LP64_OFF64_CFLAGSCS_XBS5_LP64_OFF64_LDFLAGSCS_XBS5_LP64_OFF64_LIBSCS_XBS5_LP64_OFF64_LINTFLAGSCS_XBS5_LPBIG_OFFBIG_CFLAGSCS_XBS5_LPBIG_OFFBIG_LDFLAGSCS_XBS5_LPBIG_OFFBIG_LIBSPC_ASYNC_IOPC_CHOWN_RESTRICTEDPC_FILESIZEBITSPC_LINK_MAXPC_MAX_CANONPC_MAX_INPUTPC_NAME_MAXPC_NO_TRUNCPC_PATH_MAXPC_PIPE_BUFPC_PRIO_IOPC_SOCK_MAXBUFPC_SYNC_IOPC_VDISABLEPC_ALLOC_SIZE_MINPC_REC_INCR_XFER_SIZEPC_REC_MAX_XFER_SIZEPC_REC_MIN_XFER_SIZEPC_REC_XFER_ALIGNPC_SYMLINK_MAXSC_2_CHAR_TERMSC_2_C_BINDSC_2_C_DEVSC_2_C_VERSIONSC_2_FORT_DEVSC_2_FORT_RUNSC_2_LOCALEDEFSC_2_SW_DEVSC_2_UPESC_2_VERSIONSC_AIO_LISTIO_MAXSC_AIO_MAXSC_AIO_PRIO_DELTA_MAXSC_ARG_MAXSC_ASYNCHRONOUS_IOSC_ATEXIT_MAXSC_AVPHYS_PAGESSC_BC_BASE_MAXSC_BC_DIM_MAXSC_BC_SCALE_MAXSC_BC_STRING_MAXSC_CHARCLASS_NAME_MAXSC_CHAR_BITSC_CHAR_MAXSC_CHAR_MINSC_CHILD_MAXSC_CLK_TCKSC_COLL_WEIGHTS_MAXSC_DELAYTIMER_MAXSC_EQUIV_CLASS_MAXSC_EXPR_NEST_MAXSC_FSYNCSC_GETGR_R_SIZE_MAXSC_GETPW_R_SIZE_MAXSC_INT_MAXSC_INT_MINSC_IOV_MAXSC_JOB_CONTROLSC_LINE_MAXSC_LOGIN_NAME_MAXSC_LONG_BITSC_MAPPED_FILESSC_MB_LEN_MAXSC_MEMLOCKSC_MEMLOCK_RANGESC_MEMORY_PROTECTIONSC_MESSAGE_PASSINGSC_MQ_OPEN_MAXSC_MQ_PRIO_MAXSC_NGROUPS_MAXSC_NL_ARGMAXSC_NL_LANGMAXSC_NL_MSGMAXSC_NL_NMAXSC_NL_SETMAXSC_NL_TEXTMAXSC_NPROCESSORS_CONFSC_NPROCESSORS_ONLNSC_NZEROSC_OPEN_MAXSC_PAGESIZESC_PAGE_SIZESC_PASS_MAXSC_PHYS_PAGESSC_PIISC_PII_INTERNETSC_PII_INTERNET_DGRAMSC_PII_INTERNET_STREAMSC_PII_OSISC_PII_OSI_CLTSSC_PII_OSI_COTSSC_PII_OSI_MSC_PII_SOCKETSC_PII_XTISC_POLLSC_PRIORITIZED_IOSC_PRIORITY_SCHEDULINGSC_REALTIME_SIGNALSSC_RE_DUP_MAXSC_RTSIG_MAXSC_SAVED_IDSSC_SCHAR_MAXSC_SCHAR_MINSC_SELECTSC_SEMAPHORESSC_SEM_NSEMS_MAXSC_SEM_VALUE_MAXSC_SHARED_MEMORY_OBJECTSSC_SHRT_MAXSC_SHRT_MINSC_SIGQUEUE_MAXSC_SSIZE_MAXSC_STREAM_MAXSC_SYNCHRONIZED_IOSC_THREADSSC_THREAD_ATTR_STACKADDRSC_THREAD_ATTR_STACKSIZESC_THREAD_KEYS_MAXSC_THREAD_PRIORITY_SCHEDULINGSC_THREAD_PRIO_INHERITSC_THREAD_PRIO_PROTECTSC_THREAD_PROCESS_SHAREDSC_THREAD_SAFE_FUNCTIONSSC_THREAD_STACK_MINSC_THREAD_THREADS_MAXSC_TIMERSSC_TIMER_MAXSC_TTY_NAME_MAXSC_TZNAME_MAXSC_T_IOV_MAXSC_UCHAR_MAXSC_UINT_MAXSC_UIO_MAXIOVSC_ULONG_MAXSC_USHRT_MAXSC_VERSIONSC_WORD_BITSC_XBS5_ILP32_OFF32SC_XBS5_ILP32_OFFBIGSC_XBS5_LP64_OFF64SC_XBS5_LPBIG_OFFBIGSC_XOPEN_CRYPTSC_XOPEN_ENH_I18NSC_XOPEN_LEGACYSC_XOPEN_REALTIMESC_XOPEN_REALTIME_THREADSSC_XOPEN_SHMSC_XOPEN_UNIXSC_XOPEN_VERSIONSC_XOPEN_XCU_VERSIONSC_XOPEN_XPG2SC_XOPEN_XPG3SC_XOPEN_XPG4posix.ScandirIteratorisenabledset_debugget_debugget_countget_thresholdcollectget_statsis_trackedunfreezeget_freeze_countmarshal_ast_string.abi3.soINFNAN__dir__sys.thread_infofirstiterfinalizerwidthmodulusimaghash_bitsseed_bitsseed size of hash algorithmcutoff-d-ioptimize-O or -OO-Bno_user_site-sno_site-Signore_environment-E-v-b-qhash_randomization-R-I-X dev-X utf8-X int_max_str_digitsMajor release numberMinor release numbermicroPatch release numberreleaselevelserialSerial release numberauditcallstats_clear_type_cacheexc_infogetdefaultencodinggetdlopenflagsgetallocatedblocksgetfilesystemencodinggetfilesystemencodeerrorsgetrefcountgetrecursionlimitis_finalizingsetcheckintervalgetcheckintervalsetswitchintervalgetswitchintervalsetdlopenflagsgetprofilesetrecursionlimitgettrace_debugmallocstatsset_asyncgen_hooksget_asyncgen_hooksget_int_max_str_digitsset_int_max_str_digitsmaxdigitsdepth__cantrace__sys.flagssys.version_infosys.hash_infocpython-38cpythonc_callc_exceptionc_returnsymbolsnestedsymtable entryps2ps1last_tracebacklast_valuelast_typeC.UTF-8C.utf8_shutdownthreadingsiphash24extension_suffixeslock_heldcreate_builtinexec_dynamicexec_builtinzipimporterreload_handle_fromlist_lock_unlock_module__spec___get_sourcefile_fix_up_module_find_and_load__package__hamthamt_collision_nodehamt_array_nodehamt_bitmap_nodesingle_inputfile_inputeval_inputdecoratordecoratorsdecoratedasync_funcdefparameterstypedargslisttfpdefvarargslistvfpdefsimple_stmtsmall_stmtexpr_stmtannassigntestlist_star_expraugassigndel_stmtpass_stmtflow_stmtbreak_stmtcontinue_stmtreturn_stmtyield_stmtraise_stmtimport_stmtimport_nameimport_fromimport_as_namedotted_as_nameimport_as_namesdotted_as_namesdotted_nameglobal_stmtnonlocal_stmtassert_stmtcompound_stmtasync_stmtif_stmtwhile_stmtfor_stmttry_stmtwith_stmtwith_itemexcept_clausenamedexpr_testtest_nocondlambdeflambdef_nocondor_testand_testnot_testcomp_opxor_exprand_exprshift_exprarith_exprtermfactorpoweratom_expratomtestlist_comptrailersubscriptlistsliceopexprlisttestlistdictorsetmakerclassdefarglistcomp_itersync_comp_forcomp_ifencoding_declyield_expryield_argfunc_body_suitefunc_type_inputtypelistassertbreakcontinueglobalnonlocalraiseelifexcepterr_msgError messageObject causing the exceptionUnraisableHookArgsrun__class_getitem__varold_valueToken.MISSINGContext.0123456789abcdef_is_text_encodingstrict_errorsignore_errorsxmlcharrefreplace_errorsbackslashreplace_errorsnamereplacenamereplace_errors__aenter____aexit____build_class__anybinchroctroundsumndigitsbasedont_inherit_feature_version__prepare__metaclass__mro_entries__|OOOO:printNFKCargtypestype_ignoresfinalbodyexcsimplebasesreturnsdecorator_listis_asyncifsoptional_varscontext_exprctxformat_specconversionopselteltsorelseoperandtargetkwargkw_defaultskwonlyargsvarargposonlyargsend_col_offsetend_linenotype_commentasname_attributes_ast.AST_filters_mutatedcategorystacklevel_warn_unawaited_coroutinemodule_globalsget_sourceWarningMessage_showwarnmsg__warningregistry____callback____bytes__weakcallableproxyweakproxyrsplitjoincapitalizecasefoldexpandtabssplitlinesswapcaseisasciiislowerisupperistitleisspaceisdecimalisdigitisnumericisalphaisalnumisidentifierisprintablezfillformat_map__getnewargs__formatter_field_name_splitformatter_parserkeependstabsizestring helper modulefieldnameiteratorformatteriteratorstr_iteratorEncodingMap__text_signature____basicsize____itemsize____flags____weakrefoffset____base____dictoffset____mro__mrothe object's class__init_subclass____thisclass__the class invoking super()__self____self_class____slots____newobj_ex____newobj____getnewargs_ex____set_name____pow____getitem____delitem____neg____pos____abs____index____invert____int____float____iadd____isub____imul____imatmul____imod____ipow____ilshift____irshift____iand____ixor____ior____ifloordiv____itruediv____str____getattribute____next____set____delete____repr____add____radd____sub____rsub____mul____rmul____matmul____rmatmul____mod____rmod____divmod____rdivmod____rpow____lshift____rlshift____rshift____rrshift____and____rand____xor____rxor____or____ror____floordiv____rfloordiv____truediv____rtruediv____contains____len____bool____lt____le____eq____ne____gt____ge____iter____del____await____aiter____anext____get____hash___slotnames__slotnames__copyreg__neg__($self, /) -- -self__pos__($self, /) -- +selftuple_iteratorn_sequence_fieldsn_unnamed_fieldsn_fieldsunnamed fieldellipsisindicesdiscardintersectionintersection_updateisdisjointissubsetissupersetsymmetric_differencesymmetric_difference_updateunion typeset_iteratorlongrange_iteratorpickle.PickleBufferPy_ReprNotImplementedTypeNoneType__isabstractmethod__==types.SimpleNamespacedoc_initializingmoduledefbuiltin_function_or_methodnbytesitemsizendimshapestridessuboffsetsc_contiguousf_contiguoustobytestolistcasttoreadonlybytes_per_sepmanagedbufferpopitemmove_to_endlastcollections.OrderedDictodict_keysodict_itemsodict_valuesodict_iteratordict_valueiteratordict_keyiteratordict_itemiteratordict_reversevalueiteratordict_reverseitemiteratordict_reversekeyiteratorrealnumeratordenominatorconjugatebit_lengthas_integer_ratio__trunc____floor____ceil__bits_per_digitsize of a digit in bitssizeof_digitdefault_max_str_digitsstr_digits_check_thresholdsignedsys.int_infox.__getitem__(y) <==> x[y]list_reverseiteratorlist_iteratorcallable_iteratorforceInterpreterID__closure____globals____func__argdefsclosuref_localsf_linenof_tracef_backf_codef_builtinsf_globalsf_lastif_trace_linesf_trace_opcodesmax_expmax_10_expmin_expmin_10_expDBL_DIG -- digitsmant_digepsilonradixroundsFLT_ROUNDS -- rounding modeis_integersys.float_infoEncoding of the filestderrprintername of the generatorgi_yieldfromgi_framegi_runninggi_codename of the coroutinecr_awaitcr_framecr_runningcr_codecr_originname of the async generatorag_awaitag_frameag_runningag_codeacloseasync_generator_wrapped_valueasync_generatorasync_generator_asendcoroutine_wrapperasync_generator_athrow__traceback____context__exception context__cause__exception cause__suppress_context__with_tracebackgenerator return valueexception messagemodule pathPOSIX exception codeexception strerrorfilename2second exception filenameexception msgexception linenoexception offsetexception textexception print_file_and_lineexception encodingexception objectexception startexception endexception reasonTimeout expired.Process not found.Not enough permissions.Interrupted by signal.File not found.File already exists.Connection reset.Connection refused.Connection aborted.Child process error.Broken pipe.I/O operation would block.Connection error.Buffer error.Out of memory.Assertion failed.Unicode translation error.Unicode decoding error.Unicode encoding error.Unicode related error.Mapping key not found.Sequence index out of range.Base class for lookup errors.Improper indentation.Invalid syntax.Attribute not found.Name not found globally.Recursion limit exceeded.Unspecified run-time error.Read beyond end of file.Module not found.Program interrupted by user.Inappropriate argument type.__objclass__D.keys() -> list of D's keysfgetfdelsetterdeleterwrapper_descriptorgetset_descriptormember_descriptorclassmethod_descriptormappingproxymethod-wrapper__complex__co_argcountco_posonlyargcountco_kwonlyargcountco_nlocalsco_stacksizeco_flagsco_codeco_constsco_namesco_varnamesco_freevarsco_cellvarsco_nameco_firstlinenoco_lnotabcell_contentsPyCapsulebytes_iterator__alloc__bytearray_iteratorENDMARKERNAMESTRINGNEWLINEINDENTDEDENTLPARRPARLSQBRSQBCOLONCOMMASEMIPLUSMINUSVBARAMPERLESSGREATERPERCENTLBRACERBRACEEQEQUALNOTEQUALLESSEQUALGREATEREQUALTILDECIRCUMFLEXLEFTSHIFTRIGHTSHIFTDOUBLESTARPLUSEQUALMINEQUALPERCENTEQUALAMPEREQUALVBAREQUALCIRCUMFLEXEQUALLEFTSHIFTEQUALRIGHTSHIFTEQUALDOUBLESTAREQUALDOUBLESLASHDOUBLESLASHEQUALATEQUALRARROWELLIPSISCOLONEQUALTYPE_IGNORETYPE_COMMENTutf810dev----help-c-mstrictalwaysnever,utf-8asciihomeLibos.pyrbignore =--versionbBc:dEhiIJm:OqRsStuvVW:xX:?error::BytesWarningdefault::BytesWarningsurrogateescapepython3defaultshowrefcountshowalloccountfaulthandlerimporttimetracemallocint_max_str_digitspycache_prefixpyvenv.cfgModules/Setup.locallib64/python00.zippybuilddir.txtlib64/lib-dynloadbackslashreplacesurrogatepassxmlcharrefreplace__main__check-hash-based-pycs ҖȖ_bU 2%OQUPLPlQN|QN]\\\T`±\\\̮̮\\\̮\̯\\\\\_\\\\\\\\\\\,\,\\\\̯\]\\\Q̯ڰï\[[[l_ڰ[.[[[[[[[[[[[_[[[[[[t[t[[D[D[[[[[\[[[iK>-|-|-|-|-|-|-|-|-|-|-|-|-|-|-|-|p-|p-|-|-|-|-|-|-|-|K|-|-|-|-| -|-|-|-|y-|-|-|-|-||v-|-|-|-|-|-|G-|-|{-|-|-|y-|-|-|-|-|-|-|Qv| b16.(H.fɢ0_#cH^ )G9?"0=3mTKRW'UR]FUXPRLBV'SUKKKK޷KKKKKdK KKK )KKKKKKKijb5ӵKK!K&KKKpK)KsKOp9l(TDax,FxJ kc[l ^9!JJJJJJJJJJJJJJJJ+ JP JJJJJJJJJJJJ fDfDf f fDfeffgf,feffeefeeeeee"|j" rf0!! "","#d4D64I4\4DkMMMMMMMMMMMM ;MMMMMMMMMMMMMMMMKNMM^*QQQQQQQQQQQQQQQQQQQ'DbߊuŠ!ӊF:҉UJ2HHHHHHHHHHH?xHHHHHHHHHHHHHHHHHHHHHHHHؕ  =jԈԈԈԈԈԈԈԈԈԈԈԈԈԈԈԈԈԈԈԈԈԈԈԈԈԈԈԈԈԈԈԈԈա6^O&y5ˉˉˉ.ˉˉ<ˉˉˉˉˉˉˉˉˉˉˉˉ]ˉuˉdˉˉˉˉˉˉˉˉˉˉˉˉˉˉˉˉˉˉˉˉˉˉˉˉˉˉˉˉˉVˉˉˉˉˉˉˉˉˉˉˉˉˉˉˉˉˉˉˉˉˉˉˉˉˉˉˉˉˉOC7ʈLWW֊֊44T֊& ֊֊֊֊֊֊֊֊֊֊֊֊֊֊֊֊֊֊¯vòŽ`UkmWAUUU+UUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUU;;H  o o e;z;s;;;;EEEEl;EEEEEEE;;;EEEEEEEEEEEE;E;_fdhzm + -____ %  g=/    & lI8 vY0 bffejWzKn !2 <x; uO %b(+z'I()*(+c)+M+W**)**+' &&)%c%'J)%('^)KihZOSLN PIQM(SOSISQ*RORLI(JXNIJ5M[\IUMLlJSSWJSNS$LCNOPMR OESRtQQFO4RKHIIMIJLHL|LzS T=TqTTihj}ij`j)p1pyrp3woHuxqzLvIp u{ttw"uu)p)pzo)plwy `````````````````I```````kkkk9999999999999999+99999999OOccccTTw7+7Y7g+TT'TeeTTNNqTTC4+TSTCBYUAuž͞^>%ƶgorooooofoooorz}$$l$$$$$$$[$$$ 6 6 6 6 6 6 6 6 6 l6 6 6 6 6 6 6 ' $HH~HHHHHHHrHHH]L;n!X"        "3! y#!! D! $"x!WYYYYYYYYYYYYYYYYYYYYYYYHYYYYYVYYYYYYYYYXXXXXXXXYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYY:YYYYY33YYYrYYYYYYYYXYYYXYYYdYY Xcccc.g.ggdfcccc dth,ddccdcccccgece+­٧xȠx{xx2ؗBxx((xߣ,[zԩݫ|6yzҥؕҥKh04OOPPPPPPPP`ϱPPPPP@PPPP±PPPPPPPPPPPPPPPP |ԟ|1vw]}ܞP-̚Ҵ!zҴҴd ,T׫ҴҴ||Ҵ3Ny(n1Щͥx)@^VOO{OOOOOOOOOO OO OOOOOOOOOOOOOw?OOO|?  B tT $ \ D  r  zGGGGGGGG\GGGGGsGGGGGGGGGGGGGGGGGGGGG+*)O*"*+*)d+T))|)c*got2/W a f%hfTh .(s``]VoT* I ! o)!C!UqW&[&[&&[&[&[&[&[&&&[&[&&[&&[&&&[&[&[&[&[&[&[&[&[&[&[&[&[&[&[&[&&&'''\ld}t'T/.H0H0H0H0}0H0H0H0H0H0H00H0H01.H0@/H0H0Q2c cc00000000000000000000000000000bvbb0000000000^v8@t@vt>ppqqpMp=pƽJ u>>>>>>>>>>>>$ҭҭҭS?S?S?S?S?S?S?S?S?S?S?S?S?S?S?S?AS?S?S?S?S?S?S?S?A?.Aҭҭҭ'Adddd'AdddddVAddddd'AddL) ^ \8U=  Q~c [x%-,+){#'$S,%$'&/)m&q(o.w-'~/.",++++*****<+]mshEs[:QNQNQNQNQNQNQNQ$Q NQNQARNQARNQ/RARNQNQNQNQNQNQNQNQNQNQNQNQNQQNQNQQQQNQlQNQ$Q NQNQARNQARNQNQARvu.qpslbkjmlVmj&jIu[op}j,syu?s<5,#.}C1( }tkbY4|sjaXO>>>>>>>|sjaXOF=4+"wne\SJA?6-$ Gypg^U5NE<3*!zqhg^ULC:1(g^ULC:1( f{ri`WNE<3XOF=4+"x`4si=|r F{OvqV3`4si=|r F{OVH?6-$ Lyyypypypgpyyyypp  "^U^^L Cy}tkbYPGxof]TKB90' xo|sj|sj|sj|sj|sj{ri`WNE<3*!^( ypg^ULiZ2%d3 D D%DDAD]DyDDcncc&cYcc c@sRdZddlZddlmZmZddlZddlZddlZddl Z ddl Z ddl Z ddgZ ej Z ejddZGdddeZiZee ZdZd Zd ZGd ddZe d d d fe ddd fddfZddZddZddZddZdZdaddZ ddZ!dd Z"d!d"Z#ee#j$Z%d#d$Z&d%d&Z'd'd(Z(d)d*Z)d+d,Z*d-d.Z+Gd/d0d0Z,dS)1aPzipimport provides support for importing Python modules from Zip archives. This module exports three objects: - zipimporter: a class; its constructor takes a path to a Zip archive. - ZipImportError: exception raised by zipimporter objects. It's a subclass of ImportError, so it can be caught as ImportError, too. - _zip_directory_cache: a dict, mapping archive paths to zip directory info dicts, as used in zipimporter._files. It is usually not needed to use the zipimport module explicitly; it is used by the builtin import mechanism for sys.path items that are paths to Zip archives. N)_unpack_uint16_unpack_uint32ZipImportError zipimporterc@s eZdZdS)rN)__name__ __module__ __qualname__r r r!ssPKic@sleZdZdZddZdddZdddZd d Zd d Zd dZ ddZ ddZ ddZ ddZ ddZdS)razipimporter(archivepath) -> zipimporter object Create a new zipimporter instance. 'archivepath' must be a path to a zipfile, or to a specific path inside a zipfile. For example, it can be '/tmp/myimport.zip', or '/tmp/myimport.zip/mydirectory', if mydirectory is a valid directory inside the archive. 'ZipImportError is raised if 'archivepath' doesn't point to a valid Zip archive. The 'archive' attribute of zipimporter objects contains the name of the zipfile targeted. c Cs$t|tsddl}||}|s,td|dtr<|tt}g}zt |}WnHt t fk rt |\}}||krtd|d|}| |Yq@X|jd@dkrtd|dqq@z t|}Wn$tk rt|}|t|<YnX||_||_tj|ddd|_|jr |jt7_dS)Nrzarchive path is emptypathznot a Zip fileii) isinstancestrosZfsdecoder alt_path_sepreplacepath_sep_bootstrap_externalZ _path_statOSError ValueErrorZ _path_splitappendZst_mode_zip_directory_cacheKeyError_read_directory_filesarchive _path_joinprefix)selfr rrZstZdirnameZbasenamefilesr r r __init__?s:       zzipimporter.__init__NcCsNt||}|dk r|gfSt||}t||rFd|jt|gfSdgfS)afind_loader(fullname, path=None) -> self, str or None. Search for a module specified by 'fullname'. 'fullname' must be the fully qualified (dotted) module name. It returns the zipimporter instance itself if the module was found, a string containing the full path name if it's possibly a portion of a namespace package, or None otherwise. The optional 'path' argument is ignored -- it's there for compatibility with the importer protocol. N)_get_module_info_get_module_path_is_dirrr)r fullnamer mimodpathr r r find_loaderms   zzipimporter.find_loadercCs|||dS)afind_module(fullname, path=None) -> self or None. Search for a module specified by 'fullname'. 'fullname' must be the fully qualified (dotted) module name. It returns the zipimporter instance itself if the module was found, or None if it wasn't. The optional 'path' argument is ignored -- it's there for compatibility with the importer protocol. r)r))r r&r r r r find_modules zzipimporter.find_modulecCst||\}}}|S)zget_code(fullname) -> code object. Return the code object for the specified module. Raise ZipImportError if the module couldn't be found. _get_module_coder r&code ispackager(r r r get_codeszzipimporter.get_codecCsvtr|tt}|}||jtr:|t|jtd}z|j|}Wn tk rhtdd|YnXt |j|S)zget_data(pathname) -> string with file data. Return the data associated with 'pathname'. Raise OSError if the file wasn't found. Nr) rrr startswithrlenrrr _get_data)r pathnameZkey toc_entryr r r get_datas zzipimporter.get_datacCst||\}}}|S)zjget_filename(fullname) -> filename string. Return the filename for the specified module. r+r-r r r get_filenameszzipimporter.get_filenamecCst||}|dkr$td||dt||}|r@t|d}n |d}z|j|}Wntk rnYdSXt|j| S)zget_source(fullname) -> source string. Return the source code for the specified module. Raise ZipImportError if the module couldn't be found, return None if the archive does contain the module, but has no source for it. Ncan't find module name __init__.py.py) r#rr$rrrrr4rdecode)r r&r'r fullpathr6r r r get_sources   zzipimporter.get_sourcecCs(t||}|dkr$td||d|S)zis_package(fullname) -> bool. Return True if the module specified by fullname is a package. Raise ZipImportError if the module couldn't be found. Nr9r:)r#r)r r&r'r r r is_packages zzipimporter.is_packagecCst||\}}}tj|}|dks.t|ts@t|}|tj|<||_zT|rlt||}t |j |}|g|_ t |ds|t |_ t|j||t||jWntj|=YnXztj|}Wn$tk rtd|dYnXtd|||S)zload_module(fullname) -> module. Load the module specified by 'fullname'. 'fullname' must be the fully qualified (dotted) module name. It returns the imported module, or raises ZipImportError if it wasn't found. N __builtins__zLoaded module z not found in sys.moduleszimport {} # loaded from Zip {})r,sysmodulesgetr _module_type __loader__r$rrrZ__path__hasattrrBZ_fix_up_module__dict__execr ImportError _bootstrap_verbose_message)r r&r.r/r(Zmodr r?r r r load_modules0    zzipimporter.load_modulecCsXz||sWdSWntk r*YdSXtjsNddlm}|tdt_t||S)zReturn the ResourceReader for a package in a zip file. If 'fullname' is a package within the zip file, return the 'ResourceReader' object for the package. Otherwise return None. Nr)ResourceReaderT)rAr_ZipImportResourceReader _registeredZ importlib.abcrOZregister)r r&rOr r r get_resource_readers    zzipimporter.get_resource_readercCsd|jt|jdS)Nz)rrr)r r r r __repr__"szzipimporter.__repr__)N)N)rrr__doc__r"r)r*r0r7r8r@rArNrRrSr r r r r-s.    &z __init__.pycTr<F)z.pycTF)r=FFcCs|j|ddS)N.)r rpartition)r r&r r r r$4sr$cCs|t}||jkSN)rr)r r Zdirpathr r r r%8sr%cCs8t||}tD]$\}}}||}||jkr|SqdSrX)r$_zip_searchorderr)r r&r suffix isbytecoder/r?r r r r#As    r#c Cszt|}Wn&tk r4td||dYnX|z$|t d|}|t}Wn&tk rtd||dYnXt|tkrtd||d|ddt krz|dd|}Wn&tk rtd||dYnXt |t td}z|||}Wn(tk rJtd||dYnX| t }|dkrrtd||d|||t}t|tkrtd||d|t||}t |d d }t |d d } ||krtd ||d|| kr td ||d||8}|| } | dkr6td||di} d} z||Wn(tk rttd||dYnX|d}t|dkrtd|dddkrqt|dkrtdt|dd} t|dd }t|d d}t|dd }t |d d }t |d d}t |dd}t|dd}t|dd}t|dd}t |dd}|||}|| krtd||d|| 7}z||}Wn(tk rtd||dYnXt||krtd||dz2t|||||kr*td||dWn(tk rTtd||dYnX| d@rj|}n6z|d}Wn&tk r|dt}YnX|dt}t||}||||||||f}|| |<| d 7} qvW5QRXtd!| || S)"Nzcan't open Zip file: r rVcan't read Zip file: rznot a Zip file: zcorrupt Zip file: zbad central directory size: zbad central directory offset: z&bad central directory size or offset: .EOF read where not expectedsPK  "*zbad local header offset: iasciiZlatin1/rz!zipimport: found {} names in {!r})_io open_coderrseekEND_CENTRAL_DIR_SIZEZtellreadr3STRING_END_ARCHIVEmaxMAX_COMMENT_LENrfindrEOFErrorrr>UnicodeDecodeError translate cp437_tablerrrrrLrM)rfpZheader_positionbuffer file_sizeZmax_comment_startdataZpos header_sizeZ header_offsetZ arc_offsetr!countflagscompresstimedatecrc data_size name_size extra_sizeZ comment_size file_offsetr;r tr r r r`s                       ru  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ÇüéâäàåçêëèïîìÄÅÉæÆôöòûùÿÖÜ¢£¥₧ƒáíóúñѪº¿⌐¬½¼¡«»░▒▓│┤╡╢╖╕╣║╗╝╜╛┐└┴┬├─┼╞╟╚╔╩╦╠═╬╧╨╤╥╙╘╒╓╫╪┘┌█▄▌▐▀αßΓπΣσµτΦΘΩδ∞φε∩≡±≥≤⌠⌡÷≈°∙·√ⁿ²■ cCsltrtdtddaz      r4cCst||dkS)Nr)abs)Zt1Zt2r r r _eq_mtimeAsrcCs<||d}zt|||}Wntk r2YdSX|d@dk}|r|d@dk}tjdkr|shtjdkrt||} | dk rttj| } zt|| ||Wntk rYdSXnTt ||\} } | r t t |dd| rt |dd | kr t d |dSt|d d} t| ts8td |d | S) N)r;r rrrVZneverZalwaysrcr^r_zbytecode is stale for zcompiled module z is not a code object)rZ _classify_pycrK_impZcheck_hash_based_pycs_get_pyc_source source_hashZ_RAW_MAGIC_NUMBERZ_validate_hash_pyc_get_mtime_and_size_of_sourcerrrLrMmarshalZloadsr _code_type TypeError)r r5r?r&r~Z exc_detailsrZ hash_basedZ check_sourceZ source_bytesrZ source_mtimeZ source_sizer.r r r _unmarshal_codeKsX      rcCs|dd}|dd}|S)Ns   )r)sourcer r r _normalize_line_endings~s  rcCst|}t||dddS)NrJT)Z dont_inherit)rcompile)r5rr r r _compile_sourcesrc CsDt|d?d|d?d@|d@|d?|d?d@|d@dd d d f S) N i ?rVr)rZmktime)drr r r _parse_dostimes    rc CstzR|dddkst|dd}|j|}|d}|d}|d}t|||fWStttfk rnYdSXdS)Nrcor)rr)AssertionErrorrrr IndexErrorr)r r r6rrZuncompressed_sizer r r rs  rcCsV|dddkst|dd}z|j|}Wntk rDYdSXt|j|SdS)Nrr)rrrr4r)r r r6r r r rs rc Cst||}tD]\}}}||}tjd|jt|ddz|j|}Wntk rXYqX|d}t|j|} |rt ||||| } n t || } | dkrq|d}| ||fSqt d||ddS)Nz trying {}{}{}rV)Z verbosityrr9r:) r$rYrLrMrrrrr4rrr) r r&r rZr[r/r?r6r(r~r.r r r r,s$   r,c@s<eZdZdZdZddZddZddZd d Zd d Z d S)rPzPrivate class used to support ZipImport.get_resource_reader(). This class is allowed to reference all the innards and private parts of the zipimporter. FcCs||_||_dSrX)rr&)r rr&r r r r"sz!_ZipImportResourceReader.__init__cCs\|jdd}|d|}ddlm}z||j|WStk rVt|YnXdS)NrUrmr)BytesIO)r&rZiorrr7rFileNotFoundError)r resourcefullname_as_pathr rr r r open_resources z&_ZipImportResourceReader.open_resourcecCstdSrX)r)r rr r r resource_pathsz&_ZipImportResourceReader.resource_pathcCsH|jdd}|d|}z|j|Wntk rBYdSXdS)NrUrmFT)r&rrr7r)r r;rr r r r is_resourcesz$_ZipImportResourceReader.is_resourcec csddlm}||j|j}||jj}|jdks:t|j }t }|jj D]f}z|||}Wnt k r|YqNYnX|j j}t |dkr|jVqN||krN|||VqNdS)Nr)Pathr<)Zpathlibrrr8r&Z relative_torr;rZparentsetrrr3add) r rZ fullname_pathZ relative_pathZ package_pathZ subdirs_seenfilenameZrelativeZ parent_namer r r contentss"      z!_ZipImportResourceReader.contentsN) rrrrTrQr"rrrrr r r r rPs  rP)-rTZ_frozen_importlib_externalrrrZ_frozen_importlibrLrrnrrCrZ__all__rZpath_separatorsrrKrrtyperFrqrsrurrYr$r%r#rrzrrr4rr__code__rrrrrrr,rPr r r r sX    ~. .  c@sdZddladdlZddladdlZddlZtjdkZerLddlZ ddl Z nddl Z erbddgZ ndgZ e dde Ds~te dZee Zde Z d d e DZd Zd ZeeZd dZddZddZddZerddZnddZddZddZddZddZd d!Z er$d"d#Z!nd$d#Z!dod&d'Z"e#e"j$Z%d(&d)d*d+Z'e()e'd*Z*d,Z+d-Z,d.gZ-d/gZ.e.Z/Z0dpdd0d1d2Z1d3d4Z2d5d6Z3d7d8Z4d9d:Z5d;d<Z6d=d>Z7d?d@Z8dAdBZ9dCdDZ:dqdEdFZ;drdGdHZe?Z@dtde@dNdOdPZAGdQdRdRZBGdSdTdTZCGdUdVdVeCZDGdWdXdXZEGdYdZdZeEeDZFGd[d\d\eEeCZGgZHGd]d^d^eEeCZIGd_d`d`ZJGdadbdbZKGdcddddZLGdedfdfZMdudgdhZNdidjZOdkdlZPdmdnZQdS)va^Core implementation of path-based import. This module is NOT meant to be directly imported! It has been designed such that it can be bootstrapped into Python as the implementation of import. As such it requires the injection of specific modules and attributes in order to work. One should use importlib as the public-facing version of this module. NZwin32\/ccs|]}t|dkVqdSNlen.0sepr & +sr cCsh|]}d|qS:r rsr r r /sr)win)ZcygwinZdarwincs<tjtr0tjtrdndfdd}ndd}|S)NZ PYTHONCASEOKs PYTHONCASEOKcs tjkS)5True if filenames must be checked case-insensitively.)_osZenvironr keyr r _relax_case@sz%_make_relax_case.._relax_casecSsdS)rFr r r r r rDs)sysplatform startswith_CASE_INSENSITIVE_PLATFORMS#_CASE_INSENSITIVE_PLATFORMS_STR_KEY)rr rr _make_relax_case9s  rcCst|d@ddS)z*Convert a 32-bit integer to little-endian.little)intto_bytes)xr r r _pack_uint32Jsr%cCst|dkstt|dS)z/Convert 4 bytes in little-endian to an integer.r r!rAssertionErrorr" from_bytesdatar r r _unpack_uint32Osr+cCst|dkstt|dS)z/Convert 2 bytes in little-endian to an integer.r!r&r)r r r _unpack_uint16Tsr-cGs|sdSt|dkr|dSd}g}ttj|D]z\}}|tsL|trf|tpX|}t |g}q0|dr| | kr|}|g}q| |q0|p|}| |q0dd|D}t|dkr|ds|t S|t |S)Replacement for os.path.join().r rrrcSsg|]}|r|tqSr rstrippath_separatorsrpr r r rs_path_join..) rmapr_path_splitrootrpath_sep_tupleendswithr0r1path_sepcasefoldappendjoin) path_partsrootpathZnew_roottailr r r _path_join[s*     rBcGstdd|DS)r.cSsg|]}|r|tqSr r/)rpartr r r r4{sr5)r:r=)r>r r r rBys csBtfddtD}|dkr&dfSd||ddfS)z Replacement for os.path.split().c3s|]}|VqdSN)rfindr2r@r r r sz_path_split..rr Nr)maxr1)r@ir rFr _path_splitsrIcCs t|S)z~Stat the path. Made a separate function to make it easier to override in experiments (e.g. cache stat results). )rZstatrFr r r _path_statsrJcCs2z t|}Wntk r"YdSX|jd@|kS)z1Test whether the path is the specified mode type.Fi)rJOSErrorst_mode)r@modeZ stat_infor r r _path_is_mode_types  rNcCs t|dS)zReplacement for os.path.isfile.i)rNrFr r r _path_isfilesrOcCs|s t}t|dS)zReplacement for os.path.isdir.i@)rgetcwdrNrFr r r _path_isdirsrQcCs>|sdSt|ddd}t|dko<|dp<|dS)Replacement for os.path.isabs.Frrrrz\\)rr7replacerrr9)r@r?r r r _path_isabssrTcCs |tS)rR)rr1rFr r r rTsc Csd|t|}t|tjtjBtjB|d@}z2t|d}| |W5QRXt ||Wn:t k rzt |Wnt k rYnXYnXdS)zBest-effort function to write data to a path atomically. Be prepared to handle a FileExistsError if concurrent writing of the temporary file is attempted.{}.{}rUZwbN) formatidrZopenZO_EXCLZO_CREATZO_WRONLY_ioFileIOwriterSrKZunlink)r@r*rMZpath_tmpZfdfiler r r _write_atomicsr]iU r,r!s Z __pycache__zopt-z.pyz.pyc) optimizationc CsX|dk r4tdt|dk r(d}t||r0dnd}t|}t|\}}|d\}}}tj j } | dkrrt dd |r~|n||| g} |dkrtj jdkrd}ntj j}t|}|dkr|std |d | t|} | td} tjdk rLt|stt|}|dd kr8|dtkr8|d d}ttj|t| St|t| S) aGiven the path to a .py file, return the path to its .pyc file. The .py file does not need to exist; this simply returns the path to the .pyc file calculated as if the .py file were imported. The 'optimization' parameter controls the presumed optimization level of the bytecode file. If 'optimization' is not None, the string representation of the argument is taken and verified to be alphanumeric (else ValueError is raised). The debug_override parameter is deprecated. If debug_override is not None, a True value is the same as setting 'optimization' to the empty string while a False value is equivalent to setting 'optimization' to '1'. If sys.implementation.cache_tag is None then NotImplementedError is raised. NzFthe debug_override parameter is deprecated; use 'optimization' insteadz2debug_override or optimization must be set to Noner r.$sys.implementation.cache_tag is Nonerz{!r} is not alphanumericz{}.{}{}rr,) _warningswarnDeprecationWarning TypeErrorrfspathrI rpartitionrimplementation cache_tagNotImplementedErrorr=flagsoptimizestrisalnum ValueErrorrW_OPTBYTECODE_SUFFIXESpycache_prefixrTrBrPr1lstrip_PYCACHE) r@Zdebug_overrider^messageheadrAZbaser restZtagZalmost_filenamefilenamer r r cache_from_sourcebsH       rxc Cs.tjjdkrtdt|}t|\}}d}tjdk rftjt }| |t rf|t |d}d}|st|\}}|t krtt d||d}|dkrtd|n\|d kr|dd d }| tstd t|t td}|std |d|dd} t|| tdS)anGiven the path to a .pyc. file, return the path to its .py file. The .pyc file does not need to exist; this simply returns the path to the .py file calculated to correspond to the .pyc file. If path does not conform to PEP 3147/488 format, ValueError will be raised. If sys.implementation.cache_tag is None then NotImplementedError is raised. Nr`FTz not bottom-level directory in r_>r,zexpected only 2 or 3 dots in ryr,z5optimization portion of filename does not start with zoptimization level z is not an alphanumeric valuer)rrgrhrirrerIrqr0r1rr:rrsrncountrsplitrorm partitionrBSOURCE_SUFFIXES) r@ruZpycache_filenameZfound_in_pycache_prefixZ stripped_pathZpycacheZ dot_countr^Z opt_levelZ base_filenamer r r source_from_caches4          rc Cs~t|dkrdS|d\}}}|r8|dddkr<|Sz t|}Wn$ttfk rl|dd}YnXt|rz|S|S)zConvert a bytecode file path to a source path (if possible). This function exists purely for backwards-compatibility for PyImport_ExecCodeModuleWithFilenames() in the C API. rNr_Zpy)rrflowerrrirnrO) bytecode_pathrv_Z extension source_pathr r r _get_sourcefiles  rcCsJ|ttr0z t|WStk r,YqFXn|ttrB|SdSdSrD)r9tupler~rxrirp)rwr r r _get_cacheds rcCs4zt|j}Wntk r&d}YnX|dO}|S)z3Calculate the mode permissions for a bytecode file.rU)rJrLrK)r@rMr r r _calc_modes  rcsDdfdd }z tj}Wntk r4dd}YnX|||S)zDecorator to verify that the module being requested matches the one the loader can handle. The first argument (self) must define _name which the second argument is compared against. If the comparison fails then ImportError is raised. NcsB|dkr|j}n |j|kr0td|j|f|d||f||S)Nzloader for %s cannot handle %sname)r ImportError)selfrargskwargsmethodr r _check_name_wrappers z(_check_name.._check_name_wrappercSs8dD] }t||rt||t||q|j|jdS)N) __module____name__ __qualname____doc__)hasattrsetattrgetattr__dict__update)ZnewZoldrSr r r _wraps z_check_name.._wrap)N) _bootstrapr NameError)rrrr rr _check_names  rcCs<||\}}|dkr8t|r8d}t||dt|S)zTry to find a loader for the specified module by delegating to self.find_loader(). This method is deprecated in favor of finder.find_spec(). Nz,Not importing directory {}: missing __init__r) find_loaderrrarbrW ImportWarning)rfullnameloaderportionsmsgr r r _find_module_shims rcCs|dd}|tkrB}|t|t|dks2t|||t||S)z&Produce the data for a hash-based pyc.rr)rrrr%rr'rr)rrZcheckedr*rjr r r _code_to_hash_pycs  rcCs>ddl}t|j}||}tdd}|||dS)zyDecode bytes representing source code and return the string. Universal newline support is used in the decoding. rNT)tokenizerYZBytesIOZreadlineZdetect_encodingZIncrementalNewlineDecoderdecode) source_bytesrZsource_bytes_readlineencodingZnewline_decoderr r r decode_sources    rrsubmodule_search_locationsc Cs|dkr get_filenameoriginT is_packager)rrrrrer ModuleSpecZ _set_fileattr_get_supported_file_loadersr9rr _POPULATErrrIr<) rZlocationrrspec loader_classsuffixesrZdirnamer r r spec_from_file_locations>        rc@sPeZdZdZdZdZdZeddZeddZ edd d Z edd d Z d S)WindowsRegistryFinderz>Meta path finder for modules declared in the Windows registry.z;Software\Python\PythonCore\{sys_version}\Modules\{fullname}zASoftware\Python\PythonCore\{sys_version}\Modules\{fullname}\DebugFcCs8zttj|WStk r2ttj|YSXdSrD)_winregZOpenKeyZHKEY_CURRENT_USERrKZHKEY_LOCAL_MACHINE)clsrr r r _open_registrysz$WindowsRegistryFinder._open_registryc Csr|jr|j}n|j}|j|dtjddd}z&||}t|d}W5QRXWnt k rlYdSX|S)Nz%d.%dr,)rZ sys_versionr ) DEBUG_BUILDREGISTRY_KEY_DEBUG REGISTRY_KEYrWr version_inforrZ QueryValuerK)rrZ registry_keyrZhkeyfilepathr r r _search_registrys z&WindowsRegistryFinder._search_registryNcCsz||}|dkrdSz t|Wntk r8YdSXtD]4\}}|t|r@tj|||||d}|Sq@dS)Nr)rrJrKrr9rrspec_from_loader)rrr@targetrrrrr r r find_specs  zWindowsRegistryFinder.find_speccCs"|||}|dk r|jSdSdS)zlFind module named in the registry. This method is deprecated. Use exec_module() instead. Nrrrrr@rr r r find_module's z!WindowsRegistryFinder.find_module)NN)N) rrrrrrr classmethodrrrrr r r r rs   rc@s0eZdZdZddZddZddZdd Zd S) _LoaderBasicszSBase class of common code needed by both SourceLoader and SourcelessFileLoader.cCs@t||d}|ddd}|dd}|dko>|dkS)zConcrete implementation of InspectLoader.is_package by checking if the path returned by get_filename has a filename of '__init__.py'.rr_rr,__init__)rIrr|rf)rrrwZ filename_baseZ tail_namer r r r:sz_LoaderBasics.is_packagecCsdSz*Use default semantics for module creation.Nr rrr r r create_moduleBsz_LoaderBasics.create_modulecCs8||j}|dkr$td|jtt||jdS)zExecute the module.Nz4cannot load module {!r} when get_code() returns None)get_coderrrWr_call_with_frames_removedexecr)rmodulerr r r exec_moduleEs  z_LoaderBasics.exec_modulecCs t||S)zThis module is deprecated.)r_load_module_shimrrr r r load_moduleMsz_LoaderBasics.load_moduleN)rrrrrrrrr r r r r5s rc@sJeZdZddZddZddZddZd d Zd d d dZddZ dS) SourceLoadercCstdS)zOptional method that returns the modification time (an int) for the specified path (a str). Raises OSError when the path cannot be handled. N)rKrr@r r r path_mtimeTszSourceLoader.path_mtimecCsd||iS)aOptional method returning a metadata dict for the specified path (a str). Possible keys: - 'mtime' (mandatory) is the numeric timestamp of last source code modification; - 'size' (optional) is the size in bytes of the source code. Implementing this method allows the loader to read bytecode files. Raises OSError when the path cannot be handled. r)rrr r r path_stats\s zSourceLoader.path_statscCs |||S)zOptional method which writes data (bytes) to a file path (a str). Implementing this method allows for the writing of bytecode files. The source path is needed in order to correctly transfer permissions )set_data)rrZ cache_pathr*r r r _cache_bytecodejszSourceLoader._cache_bytecodecCsdS)zOptional method which writes data (bytes) to a file path (a str). Implementing this method allows for the writing of bytecode files. Nr )rr@r*r r r rtszSourceLoader.set_datac CsR||}z||}Wn0tk rH}ztd|d|W5d}~XYnXt|S)z4Concrete implementation of InspectLoader.get_source.z'source not available through get_data()rN)rget_datarKrr)rrr@rexcr r r get_source{s zSourceLoader.get_sourcer) _optimizecCstjt||dd|dS)zReturn the code object compiled from source. The 'data' argument can be any object type that compile() supports. rT) dont_inheritrk)rrcompile)rr*r@rr r r source_to_codes zSourceLoader.source_to_codec Cs"||}d}d}d}d}d}z t|}Wntk rDd}Yn0Xz||} Wntk rjYn Xt| d}z||} Wntk rYnX||d} zt| || } t| dd} | d@dk}|r$| d @dk}t j d kr8|st j d kr8||}t t |}t | ||| nt| || d || Wnttfk rTYn Xtd ||t| |||dS|dkr||}|||}td|tjs|dk r|dk r|r|dkrt |}t|||} nt||t|} z|||| Wntk rYnX|S)zConcrete implementation of InspectLoader.get_code. Reading of bytecode requires path_stats to be implemented. To write bytecode, set_data must also be implemented. NFTrrrrrr,ZneverZalwayssizez {} matches {})rrrzcode object from {})rrxrirrKr"rr memoryviewrZcheck_hash_based_pycsr_RAW_MAGIC_NUMBERrrrrrrrrrdont_write_bytecoderrrr)rrrrrrZ hash_basedZ check_sourcerstr*rrjZ bytes_dataZ code_objectr r r rs               zSourceLoader.get_codeN) rrrrrrrrrrr r r r rRs  rcs|eZdZdZddZddZddZefdd Zed d Z d d Z eddZ ddZ ddZ ddZddZZS) FileLoaderzgBase file loader class which implements the loader protocol methods that require file system usage.cCs||_||_dS)zKCache the module name and the path to the file found by the finder.Nr)rrr@r r r rszFileLoader.__init__cCs|j|jko|j|jkSrD __class__rrZotherr r r __eq__s  zFileLoader.__eq__cCst|jt|jASrDhashrr@rr r r __hash__szFileLoader.__hash__cstt||S)zdLoad a module from a file. This method is deprecated. Use exec_module() instead. )superrrrrr r rs zFileLoader.load_modulecCs|jSz:Return the path to the source file as found by the finder.rFrr r r rszFileLoader.get_filenamec Csht|tttfrConcrete implementation of SourceLoader using the file system.cCst|}|j|jdS)z!Return the metadata for the path.)rr)rJst_mtimeZst_size)rr@rr r r r.szSourceFileLoader.path_statscCst|}|j|||dS)N_mode)rr)rrrr*rMr r r r3sz SourceFileLoader._cache_bytecoderUr#c Cst|\}}g}|r4t|s4t|\}}||qt|D]l}t||}zt|Wq<tk rpYqrCrr r r r8s0       zSourceFileLoader.set_dataN)rrrrrrrr r r r r!*sr!c@s eZdZdZddZddZdS)rz-Loader which handles sourceless file imports.cCsD||}||}||d}t|||tt|dd||dS)Nrr)rr)rrrrr)rrr@r*rr r r r[s   zSourcelessFileLoader.get_codecCsdS)z'Return None as there is no source code.Nr rr r r rkszSourcelessFileLoader.get_sourceN)rrrrrrr r r r rWsrc@s\eZdZdZddZddZddZdd Zd d Zd d Z ddZ ddZ e ddZ dS)rz]Loader for extension modules. The constructor is designed to work with FileFinder. cCs@||_t|s6ztt|}Wntk r4YnX||_dSrD)rrTrBrrPrKr@rr r r r|szExtensionFileLoader.__init__cCs|j|jko|j|jkSrDrr r r r r s  zExtensionFileLoader.__eq__cCst|jt|jASrDr r r r r rszExtensionFileLoader.__hash__cCs$ttj|}td|j|j|S)z&Create an unitialized extension modulez&extension module {!r} loaded from {!r})rrrZcreate_dynamicrrr@)rrrr r r rsz!ExtensionFileLoader.create_modulecCs$ttj|td|j|jdS)zInitialize an extension modulez(extension module {!r} executed from {!r}N)rrrZ exec_dynamicrrr@rr r r rs zExtensionFileLoader.exec_modulecs$t|jdtfddtDS)z1Return True if the extension module is a package.rc3s|]}d|kVqdS)rNr rsuffixZ file_namer r r sz1ExtensionFileLoader.is_package..)rIr@anyEXTENSION_SUFFIXESrr r*r rs zExtensionFileLoader.is_packagecCsdS)z?Return None as an extension module cannot create a code object.Nr rr r r rszExtensionFileLoader.get_codecCsdS)z5Return None as extension modules have no source code.Nr rr r r rszExtensionFileLoader.get_sourcecCs|jSrrFrr r r rsz ExtensionFileLoader.get_filenameN)rrrrrr rrrrrrrrr r r r rts rc@sheZdZdZddZddZddZdd Zd d Zd d Z ddZ ddZ ddZ ddZ ddZdS)_NamespacePatha&Represents a namespace package's path. It uses the module name to find its parent module, and from there it looks up the parent's __path__. When this changes, the module's own path is recomputed, using path_finder. For top-level modules, the parent module's path is sys.path.cCs$||_||_t||_||_dSrD)_name_pathr_get_parent_path_last_parent_path _path_finderrrr@Z path_finderr r r rsz_NamespacePath.__init__cCs&|jd\}}}|dkrdS|dfS)z>Returns a tuple of (parent-module-name, parent-path-attr-name)r_r )rr@Z__path__)r.rf)rr'dotZmer r r _find_parent_path_namessz&_NamespacePath._find_parent_path_namescCs|\}}ttj||SrD)r5rrmodules)rZparent_module_nameZpath_attr_namer r r r0s z_NamespacePath._get_parent_pathcCsPt|}||jkrJ||j|}|dk rD|jdkrD|jrD|j|_||_|jSrD)rr0r1r2r.rrr/)rZ parent_pathrr r r _recalculates  z_NamespacePath._recalculatecCs t|SrD)rr7r r r r __iter__sz_NamespacePath.__iter__cCs ||SrDr7)rindexr r r __getitem__sz_NamespacePath.__getitem__cCs||j|<dSrD)r/)rr:r@r r r __setitem__sz_NamespacePath.__setitem__cCs t|SrD)rr7r r r r __len__sz_NamespacePath.__len__cCs d|jS)Nz_NamespacePath({!r}))rWr/r r r r __repr__sz_NamespacePath.__repr__cCs ||kSrDr9ritemr r r __contains__sz_NamespacePath.__contains__cCs|j|dSrD)r/r<r?r r r r<sz_NamespacePath.appendN)rrrrrr5r0r7r8r;r<r=r>rAr<r r r r r-s  r-c@sPeZdZddZeddZddZddZd d Zd d Z d dZ ddZ dS)_NamespaceLoadercCst||||_dSrD)r-r/r3r r r rsz_NamespaceLoader.__init__cCs d|jS)zsReturn repr for the module. The method is deprecated. The import machinery does the job itself. z)rWr)rrr r r module_reprsz_NamespaceLoader.module_reprcCsdS)NTr rr r r rsz_NamespaceLoader.is_packagecCsdS)Nr r rr r r rsz_NamespaceLoader.get_sourcecCstdddddS)Nr zrT)r)rrr r r rsz_NamespaceLoader.get_codecCsdSrr rr r r rsz_NamespaceLoader.create_modulecCsdSrDr rr r r rsz_NamespaceLoader.exec_modulecCstd|jt||S)zbLoad a namespace module. This method is deprecated. Use exec_module() instead. z&namespace module loaded with path {!r})rrr/rrr r r r sz_NamespaceLoader.load_moduleN) rrrrrrCrrrrrrr r r r rBs rBc@sveZdZdZeddZeddZeddZedd Zedd d Z edd dZ edddZ eddZ d S) PathFinderz>Meta path finder for sys.path and package __path__ attributes.cCs@ttjD],\}}|dkr(tj|=qt|dr|qdS)z}Call the invalidate_caches() method on all path entry finders stored in sys.path_importer_caches (where implemented).Ninvalidate_caches)listrpath_importer_cacheitemsrrE)rrfinderr r r rEs   zPathFinder.invalidate_cachesc CsTtjdk rtjstdttjD],}z||WStk rLYq"Yq"Xq"dS)z.Search sys.path_hooks for a finder for 'path'.Nzsys.path_hooks is empty)r path_hooksrarbrr)rr@Zhookr r r _path_hooks%s   zPathFinder._path_hookscCsh|dkr,z t}Wntk r*YdSXztj|}Wn(tk rb||}|tj|<YnX|S)zGet the finder for the path entry from sys.path_importer_cache. If the path entry is not in the cache, find the appropriate finder and cache it. If no finder is available, store None. r N)rrPrrrGKeyErrorrK)rr@rIr r r _path_importer_cache2s  zPathFinder._path_importer_cachecCsRt|dr||\}}n||}g}|dk r.r_rN) r_loadersr@rTrBrrP _path_mtimeset _path_cache_relaxed_path_cache)rr@loader_detailsZloadersrr rUr rs   zFileFinder.__init__cCs d|_dS)zInvalidate the directory mtime.rN)rWr r r r rEszFileFinder.invalidate_cachescCs*||}|dkrdgfS|j|jp&gfS)zTry to find a loader for the specified module, or the namespace package portions. Returns (loader, list-of-portions). This method is deprecated. Use find_spec() instead. N)rrr)rrrr r r rs zFileFinder.find_loadercCs|||}t||||dS)Nr)r)rrrr@Zsmslrrr r r rQs zFileFinder._get_specNc Csd}|dd}zt|jp"tj}Wntk rBd}YnX||jkr\|||_t rr|j }| }n |j }|}||krt |j|}|jD]:\} } d| } t || } t| r|| || |g|Sqt|}|jD]r\} } zt |j|| } Wntk rYdSXtjd| dd|| |krt| r|| || d|Sq|r~td |t|d} |g| _| SdS) zoTry to find a spec for the specified module. Returns the matching spec, or None if not found. Fr_r,rrNz trying {})Z verbosityzpossible namespace for {})rfrJr@rrPr"rKrW _fill_cacherrZrrYrBrVrOrQrQrnrrrr)rrrZ is_namespaceZ tail_modulerZcacheZ cache_moduleZ base_pathr)rZ init_filenameZ full_pathrr r r rsP           zFileFinder.find_specc Cs|j}zt|pt}Wntttfk r:g}YnXtj dsTt ||_ nJt }|D]8}| d\}}}|rd ||}n|}||q^||_ tj trdd|D|_dS)zDFill the cache of potential modules and packages for this directory.rr_rVcSsh|] }|qSr )r)rZfnr r r r*sz)FileFinder._fill_cache..N)r@rrrPrPermissionErrorNotADirectoryErrorrrrrXrYr}rWraddrrZ) rr@r Zlower_suffix_contentsr@rr4r)Znew_namer r r r\ s"     zFileFinder._fill_cachecsfdd}|S)aA class method which returns a closure to use on sys.path_hook which will return an instance using the specified loaders and the path called on the closure. If the path called on the closure is not a directory, ImportError is raised. cs"t|std|d|fS)z-Path hook for importlib.machinery.FileFinder.zonly directories are supportedrF)rQrrFrr[r r path_hook_for_FileFinder6s z6FileFinder.path_hook..path_hook_for_FileFinderr )rr[rar r`r path_hook,s zFileFinder.path_hookcCs d|jS)NzFileFinder({!r}))rWr@r r r r r>>szFileFinder.__repr__)N)rrrrrrErrrrQrr\rrbr>r r r r rTs  3 rTcCs|d}|d}|sB|r$|j}n||kr8t||}n t||}|sTt|||d}z$||d<||d<||d<||d<Wntk rYnXdS)N __loader____spec__rUZ__file__Z __cached__)getrrr!r Exception)ZnsrZpathnameZ cpathnamerrr r r _fix_up_moduleDs"     rgcCs&ttf}ttf}ttf}|||gS)z_Returns a list of file-based module loaders. Each item is a tuple (loader, suffixes). )rrextension_suffixesr!r~rrp)Z extensionsZsourceZbytecoder r r r[s rc Cs|atjatjatjt}dD]0}|tjkr8t|}n tj|}t|||qddgfdddgff}|D]n\}}tdd|Dst|d}|tjkrtj|}qqjzt|}WqWqjt k rYqjYqjXqjt d t|d |t|d |t|d d |t|ddd|Dtd} t|d| td} t|d| |dkrntd} t|d| t|dt t t|dkrtddt krdt_dS)zSetup the path-based importers for importlib by importing needed built-in modules and injecting them into the global namespace. Other components are extracted from the core bootstrap module. )rYrabuiltinsrposixrntrcss|]}t|dkVqdSrrrr r r r sz_setup..rzimportlib requires posix or ntrr:r1r _pathseps_with_coloncSsh|]}d|qSrr rr r r rsz_setup..Z_threadZ_weakrefwinregrrz.pywz_d.pydTN)rrrr6rZ_builtin_from_namerallr'rr=rr,rrhr~r<rr) _bootstrap_moduleZ self_moduleZ builtin_nameZbuiltin_moduleZ os_detailsZ builtin_osr1r:Z os_moduleZ thread_moduleZweakref_moduleZ winreg_moduler r r _setupfsN                      rpcCs2t|t}tjtj|gtjt dS)z)Install the path-based import components.N) rprrrJrrTrb meta_pathr<rD)roZsupported_loadersr r r _installsrr)rU)N)NNN)rr)T)N)N)RrrrYrrarrZ _MS_WINDOWSrkrrmrjr1rnr'r:rr8r=rlrZ%_CASE_INSENSITIVE_PLATFORMS_BYTES_KEYrrr%r+r-rBrIrJrNrOrQrTr]type__code__rr#rr"r(rrsror~rpZDEBUG_BYTECODE_SUFFIXESZOPTIMIZED_BYTECODE_SUFFIXESrxrrrrrrrrrrrrrobjectrrrrrrr!rr,rr-rBrDrTrgrrprrr r r r s            G(  !  D@H-:?*  Ac@sdZdaddZddZiZiZGdddeZGdd d ZGd d d Z Gd d d Z ddZ ddZ ddZ ddddZddZddZddZddZGd d!d!Zddd"d#d$Zd^d%d&Zd'd(d)d*Zd+d,Zd-d.Zd/d0Zd1d2Zd3d4Zd5d6ZGd7d8d8ZGd9d:d:ZGd;d<d<Zd=d>Z d?d@Z!d_dAdBZ"dCdDZ#dEZ$e$dFZ%dGdHZ&e'Z(dIdJZ)d`dLdMZ*d'dNdOdPZ+dQdRZ,dadTdUZ-dVdWZ.dXdYZ/dZd[Z0d\d]Z1dS)baSCore implementation of import. This module is NOT meant to be directly imported! It has been designed such that it can be bootstrapped into Python as the implementation of import. As such it requires the injection of specific modules and attributes in order to work. One should use importlib as the public-facing version of this module. NcCs8dD] }t||rt||t||q|j|jdS)z/Simple substitute for functools.update_wrapper.) __module____name__ __qualname____doc__N)hasattrsetattrgetattr__dict__update)ZnewZoldreplacer _wraps r cCs tt|SN)typesysnamer r r _new_module#src@s eZdZdS)_DeadlockErrorN)rrrr r r r r0src@s8eZdZdZddZddZddZdd Zd d Zd S) _ModuleLockzA recursive lock implementation which is able to detect deadlocks (e.g. thread 1 trying to take locks A then B, and thread 2 trying to take locks B then A). cCs0t|_t|_||_d|_d|_d|_dSN)_threadZ allocate_locklockwakeuprownercountwaitersselfrr r r __init__:s   z_ModuleLock.__init__cCs<t}|j}t|}|dkr$dS|j}||krdSqdS)NFT)r get_identr _blocking_onget)rZmetidrr r r has_deadlockBs z_ModuleLock.has_deadlockc Cst}|t|<z|jn|jdks.|j|krT||_|jd7_W5QRWVdS|rhtd||j dr|j d7_ W5QRX|j |j qW5t|=XdS)z Acquire the module lock. If a potential deadlock is detected, a _DeadlockError is raised. Otherwise, the lock is always acquired and True is returned. rTzdeadlock detected by %rFN) rr r!rrrr$rracquirerreleaserr#r r r r&Ns   z_ModuleLock.acquirec Cszt}|jb|j|kr"td|jdks0t|jd8_|jdkrld|_|jrl|jd8_|j W5QRXdS)Ncannot release un-acquired lockrr%) rr rr RuntimeErrorrAssertionErrorrrr'r(r r r r'gs  z_ModuleLock.releasecCsd|jt|S)Nz_ModuleLock({!r}) at {}formatridrr r r __repr__tsz_ModuleLock.__repr__N) rrrrrr$r&r'r0r r r r r4s   rc@s0eZdZdZddZddZddZdd Zd S) _DummyModuleLockzVA simple _ModuleLock equivalent for Python builds without multi-threading support.cCs||_d|_dSr)rrrr r r r|sz_DummyModuleLock.__init__cCs|jd7_dS)Nr%T)rr/r r r r&sz_DummyModuleLock.acquirecCs$|jdkrtd|jd8_dS)Nrr)r%)rr*r/r r r r's z_DummyModuleLock.releasecCsd|jt|S)Nz_DummyModuleLock({!r}) at {}r,r/r r r r0sz_DummyModuleLock.__repr__N)rrrrrr&r'r0r r r r r1xs r1c@s$eZdZddZddZddZdS)_ModuleLockManagercCs||_d|_dSr )_name_lockrr r r rsz_ModuleLockManager.__init__cCst|j|_|jdSr )_get_module_lockr3r4r&r/r r r __enter__s z_ModuleLockManager.__enter__cOs|jdSr )r4r')rargsZkwargsr r r __exit__sz_ModuleLockManager.__exit__N)rrrrr6r8r r r r r2sr2cCstzjzt|}Wntk r0d}YnX|dkrptdkrLt|}nt|}|fdd}t ||t|<W5tX|S)zGet or create the module lock for a given module name. Acquire/release internally the global import lock to protect _module_locks.NcSs0tzt||krt|=W5tXdSr )_imp acquire_lock release_lock _module_locksr")refrr r r cbs  z_get_module_lock..cb) r9r:r;r<KeyErrorrr1r_weakrefr=)rrr>r r r r5s    r5cCs6t|}z |Wntk r(Yn X|dS)zAcquires then releases the module lock for a given module name. This is used to ensure a module is completely initialized, in the event it is being imported by another thread. N)r5r&rr')rrr r r _lock_unlock_modules  rAcOs |||S)a.remove_importlib_frames in import.c will always remove sequences of importlib frames that end with a call to this function Use it instead of a normal call in places where including the importlib frames introduces unwanted noise into the traceback (e.g. when executing module code) r )fr7Zkwdsr r r _call_with_frames_removedsrCr%) verbositycGs6tjj|kr2|dsd|}t|j|tjddS)z=Print the message to stderr if -v/PYTHONVERBOSE is turned on.)#zimport z# )ZfileN)rflagsverbose startswithprintr-stderr)messagerDr7r r r _verbose_messages  rLcsfdd}t||S)z1Decorator to verify the named module is built-in.cs&|tjkrtd||d||S)N{!r} is not a built-in moduler)rbuiltin_module_names ImportErrorr-rfullnamefxnr r _requires_builtin_wrappers   z4_requires_builtin.._requires_builtin_wrapperr )rSrTr rRr _requires_builtins  rVcsfdd}t||S)z/Decorator to verify the named module is frozen.cs&t|std||d||SNz{!r} is not a frozen moduler)r9 is_frozenrOr-rPrRr r _requires_frozen_wrappers   z2_requires_frozen.._requires_frozen_wrapperrU)rSrYr rRr _requires_frozens  rZcCs>t||}|tjkr2tj|}t||tj|St|SdS)zLoad the specified module into sys.modules and return it. This method is deprecated. Use loader.exec_module instead. N)spec_from_loaderrmodules_exec_load)rrQspecmoduler r r _load_module_shims      racCst|dd}t|dr8z ||WStk r6YnXz |j}Wntk rVYnX|dk rht|Sz |j}Wntk rd}YnXz |j}Wn:tk r|dkrd |YSd ||YSYnXd ||SdS)N __loader__ module_repr? ) rrrc Exception__spec__AttributeError_module_repr_from_specr__file__r-)r`loaderr_rfilenamer r r _module_repr s.       roc@sreZdZdZddddddZddZdd Zed d Zej d d Zed dZ eddZ e j ddZ dS) ModuleSpecaThe specification for a module, used for loading. A module's spec is the source for information about the module. For data associated with the module, including source, use the spec's loader. `name` is the absolute name of the module. `loader` is the loader to use when loading the module. `parent` is the name of the package the module is in. The parent is derived from the name. `is_package` determines if the module is considered a package or not. On modules this is reflected by the `__path__` attribute. `origin` is the specific location used by the loader from which to load the module, if that information is available. When filename is set, origin will match. `has_location` indicates that a spec's "origin" reflects a location. When this is True, `__file__` attribute of the module is set. `cached` is the location of the cached bytecode file, if any. It corresponds to the `__cached__` attribute. `submodule_search_locations` is the sequence of path entries to search when importing submodules. If set, is_package should be True--and False otherwise. Packages are simply modules that (may) have submodules. If a spec has a non-None value in `submodule_search_locations`, the import system will consider modules loaded from the spec as packages. Only finders (see importlib.abc.MetaPathFinder and importlib.abc.PathEntryFinder) should modify ModuleSpec instances. N)origin loader_state is_packagecCs6||_||_||_||_|r gnd|_d|_d|_dSNF)rrmrqrrsubmodule_search_locations _set_fileattr_cached)rrrmrqrrrsr r r rVszModuleSpec.__init__cCsfd|jd|jg}|jdk r4|d|j|jdk rP|d|jd|jjd|S)Nz name={!r}z loader={!r}z origin={!r}zsubmodule_search_locations={}z{}({})z, ) r-rrmrqappendru __class__rjoin)rr7r r r r0bs    zModuleSpec.__repr__cCsj|j}zH|j|jkoL|j|jkoL|j|jkoL||jkoL|j|jkoL|j|jkWStk rdYdSXdSrt)rurrmrqcached has_locationrj)rZotherZsmslr r r __eq__ls     zModuleSpec.__eq__cCs:|jdkr4|jdk r4|jr4tdkr&tt|j|_|jSr )rwrqrv_bootstrap_externalNotImplementedErrorZ _get_cachedr/r r r r{xs  zModuleSpec.cachedcCs ||_dSr )rw)rr{r r r r{scCs$|jdkr|jddS|jSdS)z The name of the module's parent.N.r)rur rpartitionr/r r r parents zModuleSpec.parentcCs|jSr )rvr/r r r r|szModuleSpec.has_locationcCst||_dSr )boolrv)rvaluer r r r|s) rrrrrr0r}propertyr{setterrr|r r r r rp1s $       rprqrscCst|drJtdkrttj}|dkr0|||dS|r8gnd}||||dS|dkrt|drz||}Wqtk rd}YqXnd}t||||dS)z5Return a module spec based on various loader methods.Z get_filenameN)rm)rmrursFr)rr~rspec_from_file_locationrsrOrp)rrmrqrsrZsearchr r r r[s$     r[cCs8z |j}Wntk rYnX|dk r,|S|j}|dkrZz |j}Wntk rXYnXz |j}Wntk r|d}YnX|dkr|dkrz |j}Wqtk rd}YqXn|}z |j}Wntk rd}YnXzt|j}Wntk rd}YnXt |||d}|dkr"dnd|_ ||_ ||_ |S)NrqFT) rirjrrbrl_ORIGIN __cached__list__path__rprvr{ru)r`rmrqr_rZlocationr{rur r r _spec_from_modulesH         rFoverridecCs|st|dddkr6z |j|_Wntk r4YnX|sJt|dddkr|j}|dkr|jdk rtdkrnttj}| |}|j|_ ||_d|_ z ||_ Wntk rYnX|st|dddkrz |j |_Wntk rYnXz ||_Wntk rYnX|s"t|dddkrR|jdk rRz |j|_Wntk rPYnX|jr|srt|dddkrz |j|_ Wntk rYnX|st|dddkr|jdk rz |j|_Wntk rYnX|S)Nrrb __package__rrlr)rrrrjrmrur~r_NamespaceLoader__new__Z_pathrlrbrrrirr|rqr{r)r_r`rrmrr r r _init_module_attrss`            rcCsRd}t|jdr|j|}nt|jdr2td|dkrDt|j}t|||S)z+Create a module based on the provided spec.N create_module exec_modulezBloaders that define exec_module() must also define create_module())rrmrrOrrrr_r`r r r module_from_spec%s    rcCsj|jdkrdn|j}|jdkrB|jdkr2d|Sd||jSn$|jrVd||jSd|j|jSdS)z&Return the repr to use for the module.Nrdrerfrg)rrqrmr-r|)r_rr r r rk6s   rkc Cs|j}t|tj||k r6d|}t||dzj|jdkrj|j dkrZtd|jdt ||ddn4t ||ddt |jds|j |n |j |W5tj|j}|tj|j<XW5QRX|S)zFExecute the spec's specified module in an existing module's namespace.zmodule {!r} not in sys.modulesrNmissing loaderTrr)rr2rr\r"r-rOpoprmrurr load_moduler)r_r`rmsgr r r r]Gs"      r]cCsz|j|jWn4|jtjkr@tj|j}|tj|j<YnXtj|j}|tj|j<t|dddkrz |j|_Wntk rYnXt|dddkrz(|j |_ t |ds|j dd|_ Wntk rYnXt|dddkrz ||_ Wntk rYnX|S)Nrbrrrrri)rmrrrr\rrrbrjrrrrrirr r r _load_backward_compatiblees6      rc Cs|jdk rt|jdst|St|}d|_z|tj|j<z4|jdkr`|jdkrlt d|jdn |j |Wn2ztj|j=Wnt k rYnXYnXtj |j}|tj|j<t d|j|jW5d|_X|S)NrTFrrzimport {!r} # {!r})rmrrrZ _initializingrr\rrurOrr?rrLrr r r _load_unlockeds.      rc Cs*t|jt|W5QRSQRXdS)zReturn a new module object, loaded by the spec's loader. The module is not added to its parent. If a module is already in sys.modules, that existing module gets clobbered. N)r2rr)r_r r r r^s r^c@seZdZdZeddZedddZedddZed d Z ed d Z ee d dZ ee ddZ ee ddZeeZdS)BuiltinImporterzMeta path import for built-in modules. All methods are either class or static methods to avoid the need to instantiate the class. cCs d|jS)sReturn repr for the module. The method is deprecated. The import machinery does the job itself. z)r-r)r`r r r rcszBuiltinImporter.module_reprNcCs,|dk r dSt|r$t||ddSdSdS)Nzbuilt-inr)r9Z is_builtinr[clsrQpathtargetr r r find_specs  zBuiltinImporter.find_speccCs|||}|dk r|jSdS)zFind the built-in module. If 'path' is ever specified then the search is considered a failure. This method is deprecated. Use find_spec() instead. N)rrm)rrQrr_r r r find_modules zBuiltinImporter.find_modulecCs.|jtjkr"td|j|jdttj|S)zCreate a built-in modulerMr)rrrNrOr-rCr9Zcreate_builtin)rr_r r r rs   zBuiltinImporter.create_modulecCsttj|dS)zExec a built-in moduleN)rCr9Z exec_builtin)rr`r r r rszBuiltinImporter.exec_modulecCsdS)z9Return None as built-in modules do not have code objects.Nr rrQr r r get_codeszBuiltinImporter.get_codecCsdS)z8Return None as built-in modules do not have source code.Nr rr r r get_sourceszBuiltinImporter.get_sourcecCsdS)z4Return False as built-in modules are never packages.Fr rr r r rsszBuiltinImporter.is_package)NN)N)rrrr staticmethodrc classmethodrrrrrVrrrsrarr r r r rs*        rc@seZdZdZdZeddZedddZeddd Z ed d Z ed d Z eddZ ee ddZee ddZee ddZdS)FrozenImporterzMeta path import for frozen modules. All methods are either class or static methods to avoid the need to instantiate the class. ZfrozencCsd|jtjS)rr)r-rrr)mr r r rcszFrozenImporter.module_reprNcCs"t|rt|||jdSdSdS)Nr)r9rXr[rrr r r r s zFrozenImporter.find_speccCst|r|SdS)z]Find a frozen module. This method is deprecated. Use find_spec() instead. N)r9rX)rrQrr r r r'szFrozenImporter.find_modulecCsdS)z*Use default semantics for module creation.Nr )rr_r r r r0szFrozenImporter.create_modulecCs@|jj}t|s$td||dttj|}t||j dSrW) rirr9rXrOr-rCget_frozen_objectexecr)r`rcoder r r r4s   zFrozenImporter.exec_modulecCs t||S)z_Load a frozen module. This method is deprecated. Use exec_module() instead. )rarr r r r=szFrozenImporter.load_modulecCs t|S)z-Return the code object for the frozen module.)r9rrr r r rFszFrozenImporter.get_codecCsdS)z6Return None as frozen modules do not have source code.Nr rr r r rLszFrozenImporter.get_sourcecCs t|S)z.Return True if the frozen module is a package.)r9Zis_frozen_packagerr r r rsRszFrozenImporter.is_package)NN)N)rrrrrrrcrrrrrrrZrrrsr r r r r s.        rc@s eZdZdZddZddZdS)_ImportLockContextz$Context manager for the import lock.cCs tdS)zAcquire the import lock.N)r9r:r/r r r r6_sz_ImportLockContext.__enter__cCs tdS)z= 0z__package__ not set to a stringz6attempted relative import with no known parent packagezEmpty module nameN) isinstancestr TypeErrorr-rrrOrrrr r r _sanity_checks    rzNo module named z{!r}cCsd}|dd}|r|tjkr*t|||tjkr>tj|Stj|}z |j}Wn2tk rtd||}t||ddYnXt ||}|dkrtt||dnt |}|rtj|}t ||dd||S)Nrrz; {!r} is not a packager) rrr\rCrrj_ERR_MSGr-ModuleNotFoundErrorrrr)rimport_rrZ parent_modulerr_r`r r r _find_and_load_unlockeds*        rc Csjt|2tj|t}|tkr6t||W5QRSW5QRX|dkr^d|}t||dt||S)zFind and load the module.Nz(import of {} halted; None in sys.modulesr) r2rr\r"_NEEDS_LOADINGrr-rrA)rrr`rKr r r _find_and_loads   rrcCs*t||||dkr t|||}t|tS)a2Import and return the module based on its name, the package the call is being made from, and the level adjustment. This function represents the greatest common denominator of functionality between import_module and __import__. This includes setting __package__ if the loader did not. r)rrr _gcd_importrr r r rs  r recursivec Cs|D]}t|tsB|r"|jd}nd}td|dt|jq|dkrl|st|drt||j|ddqt||sd |j|}zt ||Wqt k r}z*|j |krt j |td k rWYqW5d }~XYqXq|S) zFigure out what __import__ should return. The import_ parameter is a callable which takes the name of module to import. It is required to decouple the function from assuming importlib's import implementation is desired. z.__all__z ``from list''zItem in z must be str, not *__all__TrrN)rrrrrr_handle_fromlistrr-rCrrrr\r"r)r`fromlistrrxZwhereZ from_nameZexcr r r rs,      rcCs|d}|d}|dk rR|dk rN||jkrNtjd|d|jdtdd|S|dk r`|jStjd tdd|d }d |kr|d d }|S)zCalculate what __package__ should be. __package__ is not guaranteed to be defined or could be set to None to represent that its proper value is unknown. rriNz __package__ != __spec__.parent (z != ))Z stacklevelzYcan't resolve package from __spec__ or __package__, falling back on __name__ and __path__rrrr)r"rrrrr)globalsrr_r r r _calc___package__s&  rr c Cs|dkrt|}n$|dk r|ni}t|}t|||}|s|dkrTt|ddS|s\|St|t|dd}tj|jdt|j|Snt|drt||tS|SdS)aImport a module. The 'globals' argument is used to infer where the import is occurring from to handle relative imports. The 'locals' argument is ignored. The 'fromlist' argument specifies what should exist as attributes on the module being imported (e.g. ``from module import ``). The 'level' argument represents the package location to import from in a relative import (e.g. ``from ..pkg import mod`` would have a 'level' of 2). rNrr) rr partitionrrr\rrr) rrlocalsrrr`Zglobals_rZcut_offr r r __import__9s      rcCs&t|}|dkrtd|t|S)Nzno built-in module named )rrrOr)rr_r r r _builtin_from_name^s  rc Cs|a|att}tjD]H\}}t||r|tjkrs^D%   $e -H%*IO   / % %#xxsubtype is an example module showing how to subtype builtin types from C. test_descr.py in the standard test suite requires it in order to complete. If you don't care about the examples, and don't intend to run the Python test suite, you can recompile Python without Modules/xxsubtype.c.symtable($module, source, filename, startstr, /) -- Return symbol and scope dictionaries used internally by compiler.get_traced_memory($module, /) -- Get the current size and peak size of memory blocks traced by tracemalloc. Returns a tuple: (current: int, peak: int).get_tracemalloc_memory($module, /) -- Get the memory usage in bytes of the tracemalloc module. This memory is used internally to trace memory allocations.get_traceback_limit($module, /) -- Get the maximum number of frames stored in the traceback of a trace. By default, a trace of an allocated memory block only stores the most recent frame: the limit is 1.stop($module, /) -- Stop tracing Python memory allocations. Also clear traces of memory blocks allocated by Python.start($module, nframe=1, /) -- Start tracing Python memory allocations. Also set the maximum number of frames stored in the traceback of a trace to nframe._get_object_traceback($module, obj, /) -- Get the traceback where the Python object obj was allocated. Return a tuple of (filename: str, lineno: int) tuples. Return None if the tracemalloc module is disabled or did not trace the allocation of the object._get_traces($module, /) -- Get traces of all memory blocks allocated by Python. Return a list of (size: int, traceback: tuple) tuples. traceback is a tuple of (filename: str, lineno: int) tuples. Return an empty list if the tracemalloc module is disabled.clear_traces($module, /) -- Clear traces of memory blocks allocated by Python.is_tracing($module, /) -- Return True if the tracemalloc module is tracing Python memory allocations.Debug module to trace memory blocks allocated by Python.faulthandler module._PyFaulthandler_Initwritable($self, /) -- Returns True if the IO object can be written.readable($self, /) -- Returns True if the IO object can be read.seekable($self, /) -- Returns True if the IO object can be seeked.write($self, s, /) -- Write string to file. Returns the number of characters written, which is always equal to the length of the string.seek($self, pos, whence=0, /) -- Change stream position. Seek to character offset pos relative to position indicated by whence: 0 Start of stream (the default). pos should be >= 0; 1 Current position - pos must be 0; 2 End of stream - pos must be 0. Returns the new absolute position.truncate($self, pos=None, /) -- Truncate size to pos. The pos argument defaults to the current file position, as returned by tell(). The current file position is unchanged. Returns the new absolute position.tell($self, /) -- Tell the current file position.readline($self, size=-1, /) -- Read until newline or EOF. Returns an empty string if EOF is hit immediately.read($self, size=-1, /) -- Read at most size characters, returned as a string. If the argument is negative or omitted, read until EOF is reached. Return an empty string at EOF.getvalue($self, /) -- Retrieve the entire contents of the object.close($self, /) -- Close the IO object. Attempting any further operation after the object is closed will raise a ValueError. This method has no effect if the file is already closed.StringIO(initial_value='', newline='\n') -- Text I/O implementation using an in-memory buffer. The initial_value argument sets the value of object. The newline argument is like the one of TextIOWrapper's constructor.Write string to stream. Returns the number of characters written (which is always equal to the length of the string). Read until newline or EOF. Returns an empty string if EOF is hit immediately. Read at most n characters from stream. Read from underlying buffer until we have n characters or we hit EOF. If n is negative or omitted, read until EOF. Separate the underlying buffer from the TextIOBase and return it. After the underlying buffer has been detached, the TextIO is in an unusable state. The error setting of the decoder or encoder. Subclasses should override. Line endings translated so far. Only line endings translated during reading are considered. Subclasses should override. Encoding of the text stream. Subclasses should override. Base class for text I/O. This class provides a character and line based interface to stream I/O. There is no readinto method because Python's character strings are immutable. There is no public constructor. reset($self, /) -- setstate($self, state, /) -- getstate($self, /) -- decode($self, /, input, final=False) -- IncrementalNewlineDecoder(decoder, translate, errors='strict') -- Codec used when reading a file in universal newlines mode. It wraps another incremental decoder, translating \r\n and \r into \n. It also records the types of newlines encountered. When used with translate=False, it ensures that the newline sequence is returned in one piece. When used with decoder=None, it expects unicode strings as decode input and translates newlines without first invoking an external decoder.truncate($self, pos=None, /) -- tell($self, /) -- seek($self, cookie, whence=0, /) -- isatty($self, /) -- writable($self, /) -- readable($self, /) -- seekable($self, /) -- fileno($self, /) -- close($self, /) -- flush($self, /) -- readline($self, size=-1, /) -- read($self, size=-1, /) -- write($self, text, /) -- reconfigure($self, /, *, encoding=None, errors=None, newline=None, line_buffering=None, write_through=None) -- Reconfigure the text stream with new parameters. This also does an implicit stream flush.detach($self, /) -- TextIOWrapper(buffer, encoding=None, errors=None, newline=None, line_buffering=False, write_through=False) -- Character and line based layer over a BufferedIOBase object, buffer. encoding gives the name of the encoding that the stream will be decoded or encoded with. It defaults to locale.getpreferredencoding(False). errors determines the strictness of encoding and decoding (see help(codecs.Codec) or the documentation for codecs.register) and defaults to "strict". newline controls how line endings are handled. It can be None, '', '\n', '\r', and '\r\n'. It works as follows: * On input, if newline is None, universal newlines mode is enabled. Lines in the input can end in '\n', '\r', or '\r\n', and these are translated into '\n' before being returned to the caller. If it is '', universal newline mode is enabled, but line endings are returned to the caller untranslated. If it has any of the other legal values, input lines are only terminated by the given string, and the line ending is returned to the caller untranslated. * On output, if newline is None, any '\n' characters written are translated to the system default line separator, os.linesep. If newline is '' or '\n', no translation takes place. If newline is any of the other legal values, any '\n' characters written are translated to the given string. If line_buffering is True, a call to flush is implied when a call to write contains a newline character.Write the given buffer to the IO stream. Returns the number of bytes written, which is always the length of b in bytes. Raises BlockingIOError if the buffer is full and the underlying raw stream cannot accept more data at the moment. readinto1($self, buffer, /) -- readinto($self, buffer, /) -- Read and return up to n bytes, with at most one read() call to the underlying raw stream. A short result does not imply that EOF is imminent. Returns an empty bytes object on EOF. Read and return up to n bytes. If the argument is omitted, None, or negative, reads and returns all data until EOF. If the argument is positive, and the underlying raw stream is not 'interactive', multiple raw reads may be issued to satisfy the byte count (unless EOF is reached first). But for interactive raw streams (as well as sockets and pipes), at most one raw read will be issued, and a short result does not imply that EOF is imminent. Returns an empty bytes object on EOF. Returns None if the underlying raw stream was open in non-blocking mode and no data is available at the moment. detach($self, /) -- Disconnect this buffer from its underlying raw stream and return it. After the raw stream has been detached, the buffer is in an unusable state.Base class for buffered IO objects. The main difference with RawIOBase is that the read() method supports omitting the size argument, and does not have a default implementation that defers to readinto(). In addition, read(), readinto() and write() may raise BlockingIOError if the underlying raw stream is in non-blocking mode and not ready; unlike their raw counterparts, they will never return None. A typical implementation should not inherit from a RawIOBase implementation, but wrap one. BufferedReader(raw, buffer_size=DEFAULT_BUFFER_SIZE) -- Create a new buffered reader using the given readable raw IO object.BufferedWriter(raw, buffer_size=DEFAULT_BUFFER_SIZE) -- A buffer for a writeable sequential RawIO object. The constructor creates a BufferedWriter for the given writeable raw stream. If the buffer_size is not given, it defaults to DEFAULT_BUFFER_SIZE.BufferedRWPair(reader, writer, buffer_size=DEFAULT_BUFFER_SIZE, /) -- A buffered reader and writer object together. A buffered reader object and buffered writer object put together to form a sequential IO object that can read and write. This is typically used with a socket or two-way pipe. reader and writer are RawIOBase objects that are readable and writeable respectively. If the buffer_size is omitted it defaults to DEFAULT_BUFFER_SIZE.write($self, buffer, /) -- peek($self, size=0, /) -- readline($self, size=-1, /) -- readinto1($self, buffer, /) -- readinto($self, buffer, /) -- read1($self, size=-1, /) -- read($self, size=-1, /) -- truncate($self, pos=None, /) -- seek($self, target, whence=0, /) -- BufferedRandom(raw, buffer_size=DEFAULT_BUFFER_SIZE) -- A buffered interface to random access streams. The constructor creates a reader and writer for a seekable stream, raw, given in the first argument. If the buffer_size is omitted it defaults to DEFAULT_BUFFER_SIZE.truncate($self, size=None, /) -- Truncate the file to at most size bytes. Size defaults to the current file position, as returned by tell(). The current file position is unchanged. Returns the new size.seek($self, pos, whence=0, /) -- Change stream position. Seek to byte offset pos relative to position indicated by whence: 0 Start of stream (the default). pos should be >= 0; 1 Current position - pos may be negative; 2 End of stream - pos usually negative. Returns the new absolute position.getvalue($self, /) -- Retrieve the entire contents of the BytesIO object.getbuffer($self, /) -- Get a read-write view over the contents of the BytesIO object.read($self, size=-1, /) -- Read at most size bytes, returned as a bytes object. If the size argument is negative, read until EOF is reached. Return an empty bytes object at EOF.readlines($self, size=None, /) -- List of bytes objects, each a line from the file. Call readline() repeatedly and return a list of the lines so read. The optional size argument, if given, is an approximate bound on the total number of bytes in the lines returned.readline($self, size=-1, /) -- Next line from the file, as a bytes object. Retain newline. A non-negative size argument limits the maximum number of bytes to return (an incomplete line may be returned then). Return an empty bytes object at EOF.readinto($self, buffer, /) -- Read bytes into buffer. Returns number of bytes read (0 for EOF), or None if the object is set not to block and has no data to read.read1($self, size=-1, /) -- Read at most size bytes, returned as a bytes object. If the size argument is negative or omitted, read until EOF is reached. Return an empty bytes object at EOF.writelines($self, lines, /) -- Write lines to the file. Note that newlines are not added. lines can be any iterable object producing bytes-like objects. This is equivalent to calling write() for each element.write($self, b, /) -- Write bytes to file. Return the number of bytes written.tell($self, /) -- Current file position, an integer.isatty($self, /) -- Always returns False. BytesIO objects are not connected to a TTY-like device.flush($self, /) -- Does nothing.close($self, /) -- Disable all I/O operations.writable($self, /) -- Returns True if the IO object can be written.seekable($self, /) -- Returns True if the IO object can be seeked.readable($self, /) -- Returns True if the IO object can be read.BytesIO(initial_bytes=b'') -- Buffered I/O implementation using an in-memory bytes buffer.FileIO(file, mode='r', closefd=True, opener=None) -- Open a file. The mode can be 'r' (default), 'w', 'x' or 'a' for reading, writing, exclusive creation or appending. The file will be created if it doesn't exist when opened for writing or appending; it will be truncated when opened for writing. A FileExistsError will be raised if it already exists when opened for creating. Opening a file for creating implies writing so this mode behaves in a similar way to 'w'.Add a '+' to the mode to allow simultaneous reading and writing. A custom opener can be used by passing a callable as *opener*. The underlying file descriptor for the file object is then obtained by calling opener with (*name*, *flags*). *opener* must return an open file descriptor (passing os.open as *opener* results in functionality similar to passing None).isatty($self, /) -- True if the file is connected to a TTY device.fileno($self, /) -- Return the underlying file descriptor (an integer).writable($self, /) -- True if file was opened in a write mode.readable($self, /) -- True if file was opened in a read mode.seekable($self, /) -- True if file supports random-access.close($self, /) -- Close the file. A closed file cannot be used for further I/O operations. close() may be called more than once without error.truncate($self, size=None, /) -- Truncate the file to at most size bytes and return the truncated size. Size defaults to the current file position, as returned by tell(). The current file position is changed to the value of size.tell($self, /) -- Current file position. Can raise OSError for non seekable files.seek($self, pos, whence=0, /) -- Move to new file position and return the file position. Argument offset is a byte count. Optional argument whence defaults to SEEK_SET or 0 (offset from start of file, offset should be >= 0); other values are SEEK_CUR or 1 (move relative to current position, positive or negative), and SEEK_END or 2 (move relative to end of file, usually negative, although many platforms allow seeking beyond the end of a file). Note that not all file objects are seekable.write($self, b, /) -- Write buffer b to file, return number of bytes written. Only makes one system call, so not all of the data may be written. The number of bytes actually written is returned. In non-blocking mode, returns None if the write would block.readinto($self, buffer, /) -- Same as RawIOBase.readinto().readall($self, /) -- Read all data from the file, returned as bytes. In non-blocking mode, returns as much as is immediately available, or None if no data is available. Return an empty bytes object at EOF.read($self, size=-1, /) -- Read at most size bytes, returned as bytes. Only makes one system call, so less data may be returned than requested. In non-blocking mode, returns None if no data is available. Return an empty bytes object at EOF.writelines($self, lines, /) -- Write a list of lines to stream. Line separators are not added, so it is usual for each of the lines provided to have a line separator at the end.readlines($self, hint=-1, /) -- Return a list of lines from the stream. hint can be specified to control the number of lines read: no more lines will be read if the total size (in bytes/characters) of all lines so far exceeds hint.readline($self, size=-1, /) -- Read and return a line from the stream. If size is specified, at most size bytes will be read. The line terminator is always b'\n' for binary files; for text files, the newlines argument to open can be used to select the line terminator(s) recognized.isatty($self, /) -- Return whether this is an 'interactive' stream. Return False if it can't be determined.fileno($self, /) -- Returns underlying file descriptor if one exists. OSError is raised if the IO object does not use a file descriptor.writable($self, /) -- Return whether object was opened for writing. If False, write() will raise OSError.readable($self, /) -- Return whether object was opened for reading. If False, read() will raise OSError.seekable($self, /) -- Return whether object supports random access. If False, seek(), tell() and truncate() will raise OSError. This method may need to do a test seek().close($self, /) -- Flush and close the IO object. This method has no effect if the file is already closed.flush($self, /) -- Flush write buffers, if applicable. This is not implemented for read-only and non-blocking streams.Truncate file to size bytes. File pointer is left unchanged. Size defaults to the current IO position as reported by tell(). Returns the new size.tell($self, /) -- Return current stream position.Change stream position. Change the stream position to the given byte offset. The offset is interpreted relative to the position indicated by whence. Values for whence are: * 0 -- start of stream (the default); offset should be zero or positive * 1 -- current stream position; offset may be negative * 2 -- end of stream; offset is usually negative Return the new absolute position.The abstract base class for all I/O classes, acting on streams of bytes. There is no public constructor. This class provides dummy implementations for many methods that derived classes can override selectively; the default implementations represent a file that cannot be read, written or seeked. Even though IOBase does not declare read, readinto, or write because their signatures will vary, implementations and clients should consider those methods part of the interface. Also, implementations may raise UnsupportedOperation when operations they do not support are called. The basic type used for binary data read from or written to a file is bytes. Other bytes-like objects are accepted as method arguments too. In some cases (such as readinto), a writable object is required. Text I/O classes work with str data. Note that calling any method (except additional calls to close(), which are ignored) on a closed stream should raise a ValueError. IOBase (and its subclasses) support the iterator protocol, meaning that an IOBase object can be iterated over yielding the lines in a stream. IOBase also supports the :keyword:`with` statement. In this example, fp is closed after the suite of the with statement is complete: with open('spam.txt', 'r') as fp: fp.write('Spam and eggs!') readall($self, /) -- Read until EOF, using multiple read() call.read($self, size=-1, /) -- Base class for raw binary I/O.open_code($module, /, path) -- Opens the provided file with the intent to import the contents. This may perform extra validation beyond open(), but is otherwise interchangeable with calling open(path, 'rb').open($module, /, file, mode='r', buffering=-1, encoding=None, errors=None, newline=None, closefd=True, opener=None) -- Open file and return a stream. Raise OSError upon failure. file is either a text or byte string giving the name (and the path if the file isn't in the current working directory) of the file to be opened or an integer file descriptor of the file to be wrapped. (If a file descriptor is given, it is closed when the returned I/O object is closed, unless closefd is set to False.) mode is an optional string that specifies the mode in which the file is opened. It defaults to 'r' which means open for reading in text mode. Other common values are 'w' for writing (truncating the file if it already exists), 'x' for creating and writing to a new file, and 'a' for appending (which on some Unix systems, means that all writes append to the end of the file regardless of the current seek position). In text mode, if encoding is not specified the encoding used is platform dependent: locale.getpreferredencoding(False) is called to get the current locale encoding. (For reading and writing raw bytes use binary mode and leave encoding unspecified.) The available modes are: ========= =============================================================== Character Meaning --------- --------------------------------------------------------------- 'r' open for reading (default) 'w' open for writing, truncating the file first 'x' create a new file and open it for writing 'a' open for writing, appending to the end of the file if it exists 'b' binary mode 't' text mode (default) '+' open a disk file for updating (reading and writing) 'U' universal newline mode (deprecated) ========= =============================================================== The default mode is 'rt' (open for reading text). For binary random access, the mode 'w+b' opens and truncates the file to 0 bytes, while 'r+b' opens the file without truncation. The 'x' mode implies 'w' and raises an `FileExistsError` if the file already exists. Python distinguishes between files opened in binary and text modes, even when the underlying operating system doesn't. Files opened in binary mode (appending 'b' to the mode argument) return contents as bytes objects without any decoding. In text mode (the default, or when 't' is appended to the mode argument), the contents of the file are returned as strings, the bytes having been first decoded using a platform-dependent encoding or using the specified encoding if given. 'U' mode is deprecated and will raise an exception in future versions of Python. It has no effect in Python 3. Use newline to control universal newlines mode. buffering is an optional integer used to set the buffering policy. Pass 0 to switch buffering off (only allowed in binary mode), 1 to select line buffering (only usable in text mode), and an integer > 1 to indicate the size of a fixed-size chunk buffer. When no buffering argument is given, the default buffering policy works as follows: * Binary files are buffered in fixed-size chunks; the size of the buffer is chosen using a heuristic trying to determine the underlying device's "block size" and falling back on `io.DEFAULT_BUFFER_SIZE`. On many systems, the buffer will typically be 4096 or 8192 bytes long. * "Interactive" text files (files for which isatty() returns True) use line buffering. Other text files use the policy described above for binary files. encoding is the name of the encoding used to decode or encode the file. This should only be used in text mode. The default encoding is platform dependent, but any encoding supported by Python can be passed. See the codecs module for the list of supported encodings. errors is an optional string that specifies how encoding errors are to be handled---this argument should not be used in binary mode. Pass 'strict' to raise a ValueError exception if there is an encoding error (the default of None has the same effect), or pass 'ignore' to ignore errors. (Note that ignoring encoding errors can lead to data loss.) See the documentation for codecs.register or run 'help(codecs.Codec)' for a list of the permitted encoding error strings. newline controls how universal newlines works (it only applies to text mode). It can be None, '', '\n', '\r', and '\r\n'. It works as follows: * On input, if newline is None, universal newlines mode is enabled. Lines in the input can end in '\n', '\r', or '\r\n', and these are translated into '\n' before being returned to the caller. If it is '', universal newline mode is enabled, but line endings are returned to the caller untranslated. If it has any of the other legal values, input lines are only terminated by the given string, and the line ending is returned to the caller untranslated. * On output, if newline is None, any '\n' characters written are translated to the system default line separator, os.linesep. If newline is '' or '\n', no translation takes place. If newline is any of the other legal values, any '\n' characters written are translated to the given string. If closefd is False, the underlying file descriptor will be kept open when the file is closed. This does not work when a file name is given and must be True in that case. A custom opener can be used by passing a callable as *opener*. The underlying file descriptor for the file object is then obtained by calling *opener* with (*file*, *flags*). *opener* must return an open file descriptor (passing os.open as *opener* results in functionality similar to passing None). open() returns a file object whose type depends on the mode, and through which the standard file operations such as reading and writing are performed. When open() is used to open a file in a text mode ('w', 'r', 'wt', 'rt', etc.), it returns a TextIOWrapper. When used to open a file in a binary mode, the returned class varies: in read binary mode, it returns a BufferedReader; in write binary and append binary modes, it returns a BufferedWriter, and in read/write mode, it returns a BufferedRandom. It is also possible to use a string or bytearray as a file for both reading and writing. For strings StringIO can be used like a file opened in a text mode, and for bytes a BytesIO can be used like a file opened in a binary mode.The io module provides the Python interfaces to stream handling. The builtin open function is defined in this module. At the top of the I/O hierarchy is the abstract base class IOBase. It defines the basic interface to a stream. Note, however, that there is no separation between reading and writing to streams; implementations are allowed to raise an OSError if they do not support a given operation. Extending IOBase is RawIOBase which deals simply with the reading and writing of raw bytes to a stream. FileIO subclasses RawIOBase to provide an interface to OS files. BufferedIOBase deals with buffering on a raw byte stream (RawIOBase). Its subclasses, BufferedWriter, BufferedReader, and BufferedRWPair buffer streams that are readable, writable, and both respectively. BufferedRandom provides a buffered interface to random access streams. BytesIO is a simple stream of in-memory bytes. Another IOBase subclass, TextIOBase, deals with the encoding and decoding of streams into text. TextIOWrapper, which extends it, is a buffered text interface to a buffered raw stream (`BufferedIOBase`). Finally, StringIO is an in-memory stream for text. Argument names are not part of the specification, and only the arguments of open() are intended to be used as keyword arguments. data: DEFAULT_BUFFER_SIZE An int containing the default buffer size used by the module's buffered I/O classes. open() uses the file's blksize (as obtained by os.stat) if possible. bind_textdomain_codeset(domain, codeset) -> string Bind the C library's domain to codeset.bindtextdomain(domain, dir) -> string Bind the C library's domain to dir.textdomain(domain) -> string Set the C library's textdmain to domain, returning the new domain.dcgettext(domain, msg, category) -> string Return translation of msg in domain and category.dgettext(domain, msg) -> string Return translation of msg in domain.gettext(msg) -> string Return translation of msg.nl_langinfo(key) -> string Return the value for the locale information associated with key.strxfrm(string) -> string. Return a string that can be used as a key for locale-aware comparisons.string,string -> int. Compares two strings according to the locale.() -> dict. Returns numeric and monetary locale-specific parameters.(integer,string=None) -> string. Activates/queries locale processing.Support for POSIX locales.locked() -> bool (locked_lock() is an obsolete synonym) Return whether the lock is in the locked state.release() (release_lock() is an obsolete synonym) Release the lock, allowing another thread that is blocked waiting for the lock to acquire the lock. The lock must be in the locked state, but it needn't be locked by the same thread that unlocks it.acquire(blocking=True, timeout=-1) -> bool (acquire_lock() is an obsolete synonym) Lock the lock. Without argument, this blocks if the lock is already locked (even by the same thread), waiting for another thread to release the lock, and return True once the lock is acquired. With an argument, this will only block if the argument is true, and the return value reflects whether the lock is acquired. The blocking operation is interruptible._release_save() -> tuple For internal use by `threading.Condition`._acquire_restore(state) -> None For internal use by `threading.Condition`._is_owned() -> bool For internal use by `threading.Condition`.release() Release the lock, allowing another thread that is blocked waiting for the lock to acquire the lock. The lock must be in the locked state, and must be locked by the same thread that unlocks it; otherwise a `RuntimeError` is raised. Do note that if the lock was acquire()d several times in a row by the current thread, release() needs to be called as many times for the lock to be available for other threads.acquire(blocking=True) -> bool Lock the lock. `blocking` indicates whether we should wait for the lock to be available or not. If `blocking` is False and another thread holds the lock, the method will return False immediately. If `blocking` is True and another thread holds the lock, the method will wait for the lock to be released, take it and then return True. (note: the blocking operation is interruptible.) In all other cases, the method will return True immediately. Precisely, if the current thread already holds the lock, its internal counter is simply incremented. If nobody holds the lock, the lock is taken and its internal counter initialized to 1.ExceptHookArgs Type used to pass arguments to threading.excepthook.excepthook(exc_type, exc_value, exc_traceback, thread) Handle uncaught Thread.run() exception._set_sentinel() -> lock Set a sentinel lock that will be released when the current thread state is finalized (after it is untied from the interpreter). This is a private API for the threading module.stack_size([size]) -> size Return the thread stack size used when creating new threads. The optional size argument specifies the stack size (in bytes) to be used for subsequently created threads, and must be 0 (use platform or configured default) or a positive integer value of at least 32,768 (32k). If changing the thread stack size is unsupported, a ThreadError exception is raised. If the specified size is invalid, a ValueError exception is raised, and the stack size is unmodified. 32k bytes currently the minimum supported stack size value to guarantee sufficient stack space for the interpreter itself. Note that some platforms may have particular restrictions on values for the stack size, such as requiring a minimum stack size larger than 32 KiB or requiring allocation in multiples of the system memory page size - platform documentation should be referred to for more information (4 KiB pages are common; using multiples of 4096 for the stack size is the suggested approach in the absence of more specific information)._count() -> integer Return the number of currently running Python threads, excluding the main thread. The returned number comprises all threads created through `start_new_thread()` as well as `threading.Thread`, and not yet finished. This function is meant for internal and specialized purposes only. In most applications `threading.enumerate()` should be used instead.get_native_id() -> integer Return a non-negative integer identifying the thread as reported by the OS (kernel). This may be used to uniquely identify a particular thread within a system.get_ident() -> integer Return a non-zero integer that uniquely identifies the current thread amongst other threads that exist simultaneously. This may be used to identify per-thread resources. Even though on some platforms threads identities may appear to be allocated consecutive numbers starting at 1, this behavior should not be relied upon, and the number should be seen purely as a magic cookie. A thread's identity may be reused for another thread after it exits.interrupt_main() Raise a KeyboardInterrupt in the main thread. A subthread can use this function to interrupt the main thread.exit() (exit_thread() is an obsolete synonym) This is synonymous to ``raise SystemExit''. It will cause the current thread to exit silently unless the exception is caught.allocate_lock() -> lock object (allocate() is an obsolete synonym) Create a new lock object. See help(type(threading.Lock())) for information about locks.start_new_thread(function, args[, kwargs]) (start_new() is an obsolete synonym) Start a new thread and return its identifier. The thread will call the function with positional arguments from the tuple args and keyword arguments taken from the optional dictionary kwargs. The thread exits when the function returns; the return value is ignored. The thread will also exit when the function raises an unhandled exception; a stack trace will be printed unless the exception is SystemExit. This module provides primitive operations to write multi-threaded programs. The 'threading' module provides a more convenient interface.A lock object is a synchronization primitive. To create a lock, call threading.Lock(). Methods are: acquire() -- lock the lock, possibly blocking until it can be obtained release() -- unlock of the lock locked() -- test whether the lock is currently locked A lock is not owned by the thread that locked it; another thread may unlock it. A thread attempting to lock a lock that it has already locked will block until another thread unlocks it. Deadlocks may ensue.get_clock_info(name: str) -> dict Get information of the specified clock.perf_counter_ns() -> int Performance counter for benchmarking as nanoseconds.perf_counter() -> float Performance counter for benchmarking.thread_time() -> int Thread time for profiling as nanoseconds: sum of the kernel and user-space CPU time.thread_time() -> float Thread time for profiling: sum of the kernel and user-space CPU time.process_time() -> int Process time for profiling as nanoseconds: sum of the kernel and user-space CPU time.process_time() -> float Process time for profiling: sum of the kernel and user-space CPU time.monotonic_ns() -> int Monotonic clock, cannot go backward, as nanoseconds.monotonic() -> float Monotonic clock, cannot go backward.tzset() Initialize, or reinitialize, the local timezone to the value stored in os.environ['TZ']. The TZ environment variable should be specified in standard Unix timezone format as documented in the tzset man page (eg. 'US/Eastern', 'Europe/Amsterdam'). Unknown timezones will silently fall back to UTC. If the TZ environment variable is not set, the local timezone is set to the systems best guess of wallclock time. Changing the TZ environment variable without calling tzset *may* change the local timezone used by methods such as localtime, but this behaviour should not be relied on.strptime(string, format) -> struct_time Parse a string to a time tuple according to a format specification. See the library reference manual for formatting codes (same as strftime()). Commonly used format codes: %Y Year with century as a decimal number. %m Month as a decimal number [01,12]. %d Day of the month as a decimal number [01,31]. %H Hour (24-hour clock) as a decimal number [00,23]. %M Minute as a decimal number [00,59]. %S Second as a decimal number [00,61]. %z Time zone offset from UTC. %a Locale's abbreviated weekday name. %A Locale's full weekday name. %b Locale's abbreviated month name. %B Locale's full month name. %c Locale's appropriate date and time representation. %I Hour (12-hour clock) as a decimal number [01,12]. %p Locale's equivalent of either AM or PM. Other codes may be available on your platform. See documentation for the C library strftime function. strftime(format[, tuple]) -> string Convert a time tuple to a string according to a format specification. See the library reference manual for formatting codes. When the time tuple is not present, current time as returned by localtime() is used. Commonly used format codes: %Y Year with century as a decimal number. %m Month as a decimal number [01,12]. %d Day of the month as a decimal number [01,31]. %H Hour (24-hour clock) as a decimal number [00,23]. %M Minute as a decimal number [00,59]. %S Second as a decimal number [00,61]. %z Time zone offset from UTC. %a Locale's abbreviated weekday name. %A Locale's full weekday name. %b Locale's abbreviated month name. %B Locale's full month name. %c Locale's appropriate date and time representation. %I Hour (12-hour clock) as a decimal number [01,12]. %p Locale's equivalent of either AM or PM. Other codes may be available on your platform. See documentation for the C library strftime function. mktime(tuple) -> floating point number Convert a time tuple in local time to seconds since the Epoch. Note that mktime(gmtime(0)) will not generally return zero for most time zones; instead the returned value will either be equal to that of the timezone or altzone attributes on the time module.ctime(seconds) -> string Convert a time in seconds since the Epoch to a string in local time. This is equivalent to asctime(localtime(seconds)). When the time tuple is not present, current time as returned by localtime() is used.asctime([tuple]) -> string Convert a time tuple to a string, e.g. 'Sat Jun 06 16:26:11 1998'. When the time tuple is not present, current time as returned by localtime() is used.localtime([seconds]) -> (tm_year,tm_mon,tm_mday,tm_hour,tm_min, tm_sec,tm_wday,tm_yday,tm_isdst) Convert seconds since the Epoch to a time tuple expressing local time. When 'seconds' is not passed in, convert the current time instead.gmtime([seconds]) -> (tm_year, tm_mon, tm_mday, tm_hour, tm_min, tm_sec, tm_wday, tm_yday, tm_isdst) Convert seconds since the Epoch to a time tuple expressing UTC (a.k.a. GMT). When 'seconds' is not passed in, convert the current time instead. If the platform supports the tm_gmtoff and tm_zone, they are available as attributes only.sleep(seconds) Delay execution for a given number of seconds. The argument may be a floating point number for subsecond precision.pthread_getcpuclockid(thread_id) -> int Return the clk_id of a thread's CPU time clock.clock_getres(clk_id) -> floating point number Return the resolution (precision) of the specified clock clk_id.clock_settime_ns(clk_id, time) Set the time of the specified clock clk_id with nanoseconds.clock_settime(clk_id, time) Set the time of the specified clock clk_id.clock_gettime_ns(clk_id) -> int Return the time of the specified clock clk_id as nanoseconds.clock_gettime(clk_id) -> float Return the time of the specified clock clk_id.time_ns() -> int Return the current time in nanoseconds since the Epoch.time() -> floating point number Return the current time in seconds since the Epoch. Fractions of a second may be present if the system clock provides them.This module provides various functions to manipulate time values. There are two standard representations of time. One is the number of seconds since the Epoch, in UTC (a.k.a. GMT). It may be an integer or a floating point number (to represent fractions of seconds). The Epoch is system-defined; on Unix, it is generally January 1st, 1970. The actual value can be retrieved by calling gmtime(0). The other representation is a tuple of 9 integers giving local time. The tuple items are: year (including century, e.g. 1998) month (1-12) day (1-31) hours (0-23) minutes (0-59) seconds (0-59) weekday (0-6, Monday is 0) Julian day (day in the year, 1-366) DST (Daylight Savings Time) flag (-1, 0 or 1) If the DST flag is 0, the time is given in the regular time zone; if it is 1, the time is given in the DST time zone; if it is -1, mktime() should guess based on the date and time. SunMonTueWedThuFriSatJanFebMarAprMayJunJulAugSepOctNovDecConvert a file's mode to a string of the form '-rwxrwxrwx'Return the portion of the file's mode that describes the file type.Return the portion of the file's mode that can be set by os.chmod().S_ISWHT(mode) -> bool Return True if mode is from a whiteout.S_ISPORT(mode) -> bool Return True if mode is from an event port.S_ISDOOR(mode) -> bool Return True if mode is from a door.S_ISSOCK(mode) -> bool Return True if mode is from a socket.S_ISLNK(mode) -> bool Return True if mode is from a symbolic link.S_ISFIFO(mode) -> bool Return True if mode is from a FIFO (named pipe).S_ISREG(mode) -> bool Return True if mode is from a regular file.S_ISBLK(mode) -> bool Return True if mode is from a block special device file.S_ISCHR(mode) -> bool Return True if mode is from a character special device file.S_ISDIR(mode) -> bool Return True if mode is from a directory.S_IFMT_: file type bits S_IFDIR: directory S_IFCHR: character device S_IFBLK: block device S_IFREG: regular file S_IFIFO: fifo (named pipe) S_IFLNK: symbolic link S_IFSOCK: socket file S_IFDOOR: door S_IFPORT: event port S_IFWHT: whiteout S_ISUID: set UID bit S_ISGID: set GID bit S_ENFMT: file locking enforcement S_ISVTX: sticky bit S_IREAD: Unix V7 synonym for S_IRUSR S_IWRITE: Unix V7 synonym for S_IWUSR S_IEXEC: Unix V7 synonym for S_IXUSR S_IRWXU: mask for owner permissions S_IRUSR: read by owner S_IWUSR: write by owner S_IXUSR: execute by owner S_IRWXG: mask for group permissions S_IRGRP: read by group S_IWGRP: write by group S_IXGRP: execute by group S_IRWXO: mask for others (not in group) permissions S_IROTH: read by others S_IWOTH: write by others S_IXOTH: execute by others UF_NODUMP: do not dump file UF_IMMUTABLE: file may not be changed UF_APPEND: file may only be appended to UF_OPAQUE: directory is opaque when viewed through a union stack UF_NOUNLINK: file may not be renamed or deleted UF_COMPRESSED: OS X: file is hfs-compressed UF_HIDDEN: OS X: file should not be displayed SF_ARCHIVED: file may be archived SF_IMMUTABLE: file may not be changed SF_APPEND: file may only be appended to SF_NOUNLINK: file may not be renamed or deleted SF_SNAPSHOT: file is a snapshot file ST_MODE ST_INO ST_DEV ST_NLINK ST_UID ST_GID ST_SIZE ST_ATIME ST_MTIME ST_CTIME FILE_ATTRIBUTE_*: Windows file attribute constants (only present on Windows) struct_siginfo: Result from sigwaitinfo or sigtimedwait. This object may be accessed either as a tuple of (si_signo, si_code, si_errno, si_pid, si_uid, si_status, si_band), or via the attributes si_signo, si_code, and so on.valid_signals($module, /) -- Return a set of valid signal numbers on this platform. The signal numbers returned by this function can be safely passed to functions like `pthread_sigmask`.sigtimedwait($module, sigset, timeout, /) -- Like sigwaitinfo(), but with a timeout. The timeout is specified in seconds, with floating point numbers allowed.sigwaitinfo($module, sigset, /) -- Wait synchronously until one of the signals in *sigset* is delivered. Returns a struct_siginfo containing information about the signal.sigwait($module, sigset, /) -- Wait for a signal. Suspend execution of the calling thread until the delivery of one of the signals specified in the signal set sigset. The function accepts the signal and returns the signal number.sigpending($module, /) -- Examine pending signals. Returns a set of signal numbers that are pending for delivery to the calling thread.pthread_sigmask($module, how, mask, /) -- Fetch and/or change the signal mask of the calling thread.pthread_kill($module, thread_id, signalnum, /) -- Send a signal to a thread.pause($module, /) -- Wait until a signal arrives.siginterrupt($module, signalnum, flag, /) -- Change system call restart behaviour. If flag is False, system calls will be restarted when interrupted by signal sig, else system calls will be interrupted.set_wakeup_fd(fd, *, warn_on_full_buffer=True) -> fd Sets the fd to be written to (with the signal number) when a signal comes in. A library can use this to wakeup select or poll. The previous fd or -1 is returned. The fd must be non-blocking.getsignal($module, signalnum, /) -- Return the current action for the given signal. The return value can be: SIG_IGN -- if the signal is being ignored SIG_DFL -- if the default action for the signal is in effect None -- if an unknown handler is in effect anything else -- the callable Python object used as a handlerstrsignal($module, signalnum, /) -- Return the system description of the given signal. The return values can be such as "Interrupt", "Segmentation fault", etc. Returns None if the signal is not recognized.raise_signal($module, signalnum, /) -- Send a signal to the executing process.signal($module, signalnum, handler, /) -- Set the action for the given signal. The action can be SIG_DFL, SIG_IGN, or a callable Python object. The previous action is returned. See getsignal() for possible return values. *** IMPORTANT NOTICE *** A signal handler function is called with two arguments: the first is the signal number, the second is the interrupted stack frame.getitimer($module, which, /) -- Returns current value of given itimer.setitimer($module, which, seconds, interval=0.0, /) -- Sets given itimer (one of ITIMER_REAL, ITIMER_VIRTUAL or ITIMER_PROF). The timer will fire after value seconds and after that every interval seconds. The itimer can be cleared by setting seconds to zero. Returns old values as a tuple: (delay, interval).alarm($module, seconds, /) -- Arrange for SIGALRM to arrive after the given number of seconds.default_int_handler(...) The default handler for SIGINT installed by Python. It raises KeyboardInterrupt.This module provides mechanisms to use signal handlers in Python. Functions: alarm() -- cause SIGALRM after a specified time [Unix only] setitimer() -- cause a signal (described below) after a specified float time and the timer may restart then [Unix only] getitimer() -- get current value of timer [Unix only] signal() -- set the action for a given signal getsignal() -- get the signal action for a given signal pause() -- wait until a signal arrives [Unix only] default_int_handler() -- default SIGINT handler signal constants: SIG_DFL -- used to refer to the system default handler SIG_IGN -- used to ignore the signal NSIG -- number of defined signals SIGINT, SIGTERM, etc. -- signal numbers itimer constants: ITIMER_REAL -- decrements in real time, and delivers SIGALRM upon expiration ITIMER_VIRTUAL -- decrements only when the process is executing, and delivers SIGVTALRM upon expiration ITIMER_PROF -- decrements both when the process is executing and when the system is executing on behalf of the process. Coupled with ITIMER_VIRTUAL, this timer is usually used to profile the time spent by the application in user and kernel space. SIGPROF is delivered upon expiration. *** IMPORTANT NOTICE *** A signal handler function is called with two arguments: the first is the signal number, the second is the interrupted stack frame._ncallbacks() -> int Return the number of registered exit functions._run_exitfuncs() -> None Run all registered exit functions.unregister(func) -> None Unregister an exit function which was previously registered using atexit.register func - function to be unregistered_clear() -> None Clear the list of previously registered exit functions.register(func, *args, **kwargs) -> func Register a function to be executed upon normal program termination func - function to be called at exit args - optional arguments to pass to func kwargs - optional keyword arguments to pass to func func is returned to facilitate usage as a decorator.allow programmer to define multiple exit functions to be executedupon normal program termination. Two public functions, register and unregister, are defined. groupby(iterable, key=None) -- make an iterator that returns consecutive keys and groups from the iterable iterable Elements to divide into groups according to the key function. key A function for computing the group category for each element. If the key function is not specified or is None, the element itself is used for grouping.teedataobject(iterable, values, next, /) -- Data container common to multiple tee objects._tee(iterable, /) -- Iterator wrapped to make it copyable.cycle(iterable, /) -- Return elements from the iterable until it is exhausted. Then repeat the sequence indefinitely.dropwhile(predicate, iterable, /) -- Drop items from the iterable while predicate(item) is true. Afterwards, return every element until the iterable is exhausted.takewhile(predicate, iterable, /) -- Return successive entries from an iterable as long as the predicate evaluates to true for each entry.starmap(function, iterable, /) -- Return an iterator whose values are returned from the function evaluated with an argument tuple taken from the given sequence.combinations(iterable, r) -- Return successive r-length combinations of elements in the iterable. combinations(range(4), 3) --> (0,1,2), (0,1,3), (0,2,3), (1,2,3)combinations_with_replacement(iterable, r) -- Return successive r-length combinations of elements in the iterable allowing individual elements to have successive repeats. combinations_with_replacement('ABC', 2) --> AA AB AC BB BC CC"permutations(iterable, r=None) -- Return successive r-length permutations of elements in the iterable. permutations(range(3), 2) --> (0,1), (0,2), (1,0), (1,2), (2,0), (2,1)accumulate(iterable, func=None, *, initial=None) -- Return series of accumulated sums (or other binary function results).compress(data, selectors) -- Return data elements corresponding to true selector elements. Forms a shorter iterator from selected data elements using the selectors to choose the data elements.filterfalse(function, iterable, /) -- Return those items of iterable for which function(item) is false. If function is None, return the items that are false.count(start=0, step=1) -- Return a count object whose .__next__() method returns consecutive values. Equivalent to: def count(firstval=0, step=1): x = firstval while 1: yield x x += stepReturns an independent iterator.islice(iterable, stop) --> islice object islice(iterable, start, stop[, step]) --> islice object Return an iterator whose next() method returns selected values from an iterable. If start is specified, will skip all preceding elements; otherwise, start defaults to zero. Step defaults to one. If specified as another value, step determines how many values are skipped between successive calls. Works like a slice() on a list but returns an iterator.chain(*iterables) --> chain object Return a chain object whose .__next__() method returns elements from the first iterable until it is exhausted, then elements from the next iterable, until all of the iterables are exhausted.from_iterable($type, iterable, /) -- Alternative chain() constructor taking a single iterable argument that evaluates lazily.product(*iterables, repeat=1) --> product object Cartesian product of input iterables. Equivalent to nested for-loops. For example, product(A, B) returns the same as: ((x,y) for x in A for y in B). The leftmost iterators are in the outermost for-loop, so the output tuples cycle in a manner similar to an odometer (with the rightmost element changing on every iteration). To compute the product of an iterable with itself, specify the number of repetitions with the optional repeat keyword argument. For example, product(A, repeat=4) means the same as product(A, A, A, A). product('ab', range(3)) --> ('a',0) ('a',1) ('a',2) ('b',0) ('b',1) ('b',2) product((0,1), (0,1), (0,1)) --> (0,0,0) (0,0,1) (0,1,0) (0,1,1) (1,0,0) ...Returns size in memory, in bytes.Private method returning an estimate of len(list(it)).repeat(object [,times]) -> create an iterator which returns the object for the specified number of times. If not specified, returns the object endlessly.Set state information for unpickling.Return state information for pickling.zip_longest(iter1 [,iter2 [...]], [fillvalue=None]) --> zip_longest object Return a zip_longest object whose .__next__() method returns a tuple where the i-th element comes from the i-th iterable argument. The .__next__() method continues until the longest iterable in the argument sequence is exhausted and then it raises StopIteration. When the shorter iterables are exhausted, the fillvalue is substituted in their place. The fillvalue defaults to None or can be specified by a keyword argument. tee($module, iterable, n=2, /) -- Returns a tuple of n independent iterators.Functional tools for creating and using iterators. Infinite iterators: count(start=0, step=1) --> start, start+step, start+2*step, ... cycle(p) --> p0, p1, ... plast, p0, p1, ... repeat(elem [,n]) --> elem, elem, elem, ... endlessly or up to n times Iterators terminating on the shortest input sequence: accumulate(p[, func]) --> p0, p0+p1, p0+p1+p2 chain(p, q, ...) --> p0, p1, ... plast, q0, q1, ... chain.from_iterable([p, q, ...]) --> p0, p1, ... plast, q0, q1, ... compress(data, selectors) --> (d[0] if s[0]), (d[1] if s[1]), ... dropwhile(pred, seq) --> seq[n], seq[n+1], starting when pred fails groupby(iterable[, keyfunc]) --> sub-iterators grouped by value of keyfunc(v) filterfalse(pred, seq) --> elements of seq where pred(elem) is False islice(seq, [start,] stop [, step]) --> elements from seq[start:stop:step] starmap(fun, seq) --> fun(*seq[0]), fun(*seq[1]), ... tee(it, n=2) --> (it1, it2 , ... itn) splits one iterator into n takewhile(pred, seq) --> seq[0], seq[1], until pred fails zip_longest(p, q, ...) --> (p[0], q[0]), (p[1], q[1]), ... Combinatoric generators: product(p, q, ... [repeat=1]) --> cartesian product permutations(p[, r]) combinations(p, r) combinations_with_replacement(p, r) _abc_subclasscheck($module, self, subclass, /) -- Internal ABC helper for subclasss checks. Should be never used outside abc module._abc_instancecheck($module, self, instance, /) -- Internal ABC helper for instance checks. Should be never used outside abc module._abc_register($module, self, subclass, /) -- Internal ABC helper for subclasss registration. Should be never used outside abc module._get_dump($module, self, /) -- Internal ABC helper for cache and registry debugging. Return shallow copies of registry, of both caches, and negative cache version. Don't call this function directly, instead use ABC._dump_registry() for a nice repr._reset_caches($module, self, /) -- Internal ABC helper to reset both caches of a given class. Should be only used by refleak.py_reset_registry($module, self, /) -- Internal ABC helper to reset registry of a given class. Should be only used by refleak.py_abc_init($module, self, /) -- Internal ABC helper for class set-up. Should be never used outside abc module.get_cache_token($module, /) -- Returns the current ABC cache token. The token is an opaque object (supporting equality testing) identifying the current version of the ABC cache for virtual subclasses. The token changes with every call to register() on any ABC.Module contains faster C implementation of abc.ABCMetaInternal state held by ABC machinery.D.__sizeof__() -- size of D in memory, in bytesRotate the deque n steps to the right (default n=1). If n is negative, rotates left.D.reverse() -- reverse *IN PLACE*D.__reversed__() -- return a reverse iterator over the dequeD.remove(value) -- remove first occurrence of value.Remove and return the leftmost element.Remove and return the rightmost element.D.insert(index, object) -- insert object before indexD.index(value, [start, [stop]]) -> integer -- return first index of value. Raises ValueError if the value is not present.Extend the left side of the deque with elements from the iterableExtend the right side of the deque with elements from the iterableD.count(value) -> integer -- return number of occurrences of valueReturn a shallow copy of a deque.Remove all elements from the deque.Add an element to the left side of the deque.Add an element to the right side of the deque.deque([iterable[, maxlen]]) --> deque object A list-like sequence optimized for data accesses near its endpoints.Private method returning an estimate of len(list(it)).Return state information for pickling.D.copy() -> a shallow copy of D.__missing__(key) # Called by __getitem__ for missing key; pseudo-code: if self.default_factory is None: raise KeyError((key,)) self[key] = value = self.default_factory() return value defaultdict(default_factory[, ...]) --> dict with default factory The default factory is called without arguments to produce a new value when a key is not present, in __getitem__ only. A defaultdict compares equal to a dict with the same items. All remaining arguments are treated the same as if they were passed to the dict constructor, including keyword arguments. _count_elements($module, mapping, iterable, /) -- Count elements in the iterable, updating the mappingHigh performance data structures. - deque: ordered collection accessible from endpoints only - defaultdict: dict subclass with a default value factory length_hint($module, obj, default=0, /) -- Return an estimate of the number of items in obj. This is useful for presizing containers when building from an iterable. If the object supports len(), the result will be exact. Otherwise, it may over- or under-estimate by an arbitrary amount. The result will be an integer >= 0._compare_digest($module, a, b, /) -- Return 'a == b'. This function uses an approach designed to prevent timing analysis, making it appropriate for cryptography. a and b must both be of the same type: either str (ASCII only), or any bytes-like object. Note: If a and b are of different lengths, or if an error occurs, a timing attack could theoretically reveal information about the types and lengths of a and b--but not their values.ge($module, a, b, /) -- Same as a >= b.gt($module, a, b, /) -- Same as a > b.le($module, a, b, /) -- Same as a <= b.lt($module, a, b, /) -- Same as a < b.ne($module, a, b, /) -- Same as a != b.eq($module, a, b, /) -- Same as a == b.ipow($module, a, b, /) -- Same as a **= b.pow($module, a, b, /) -- Same as a ** b.delitem($module, a, b, /) -- Same as del a[b].setitem($module, a, b, c, /) -- Same as a[b] = c.getitem($module, a, b, /) -- Same as a[b].iconcat($module, a, b, /) -- Same as a += b, for a and b sequences.concat($module, a, b, /) -- Same as a + b, for a and b sequences.ior($module, a, b, /) -- Same as a |= b.ixor($module, a, b, /) -- Same as a ^= b.iand($module, a, b, /) -- Same as a &= b.irshift($module, a, b, /) -- Same as a >>= b.ilshift($module, a, b, /) -- Same as a <<= b.imod($module, a, b, /) -- Same as a %= b.itruediv($module, a, b, /) -- Same as a /= b.ifloordiv($module, a, b, /) -- Same as a //= b.imatmul($module, a, b, /) -- Same as a @= b.imul($module, a, b, /) -- Same as a *= b.isub($module, a, b, /) -- Same as a -= b.iadd($module, a, b, /) -- Same as a += b.or_($module, a, b, /) -- Same as a | b.xor($module, a, b, /) -- Same as a ^ b.and_($module, a, b, /) -- Same as a & b.not_($module, a, /) -- Same as not a.rshift($module, a, b, /) -- Same as a >> b.lshift($module, a, b, /) -- Same as a << b.invert($module, a, /) -- Same as ~a.inv($module, a, /) -- Same as ~a.abs($module, a, /) -- Same as abs(a).pos($module, a, /) -- Same as +a.neg($module, a, /) -- Same as -a.mod($module, a, b, /) -- Same as a % b.truediv($module, a, b, /) -- Same as a / b.floordiv($module, a, b, /) -- Same as a // b.matmul($module, a, b, /) -- Same as a @ b.mul($module, a, b, /) -- Same as a * b.sub($module, a, b, /) -- Same as a - b.add($module, a, b, /) -- Same as a + b.index($module, a, /) -- Same as a.__index__()is_not($module, a, b, /) -- Same as a is not b.is_($module, a, b, /) -- Same as a is b.countOf($module, a, b, /) -- Return the number of times b occurs in a.indexOf($module, a, b, /) -- Return the first index of b in a.contains($module, a, b, /) -- Same as b in a (note reversed operands).truth($module, a, /) -- Return True if a is true, False otherwise.itemgetter(item, ...) --> itemgetter object Return a callable object that fetches the given item(s) from its operand. After f = itemgetter(2), the call f(r) returns r[2]. After g = itemgetter(2, 5, 3), the call g(r) returns (r[2], r[5], r[3])attrgetter(attr, ...) --> attrgetter object Return a callable object that fetches the given attribute(s) from its operand. After f = attrgetter('name'), the call f(r) returns r.name. After g = attrgetter('name', 'date'), the call g(r) returns (r.name, r.date). After h = attrgetter('name.first', 'name.last'), the call h(r) returns (r.name.first, r.name.last).Return state information for picklingmethodcaller(name, ...) --> methodcaller object Return a callable object that calls the given method on its operand. After f = methodcaller('name'), the call f(r) returns r.name(). After g = methodcaller('name', 'date', foo=1), the call g(r) returns r.name('date', foo=1).Operator interface. This module exports a set of functions implemented in C corresponding to the intrinsic operators of Python. For example, operator.add(x, y) is equivalent to the expression x+y. The function names are those used for special methods; variants without leading and trailing '__' are also provided for convenience.partial(func, *args, **keywords) - new function with partial application of the given arguments and keywords. Create a cached callable that wraps another function. user_function: the function being cached maxsize: 0 for no caching None for unlimited cache size n for a bounded cache typed: False cache f(3) and f(3.0) as identical calls True cache f(3) and f(3.0) as distinct calls cache_info_type: namedtuple class with the fields: hits misses currsize maxsize Convert a cmp= function into a key= function.reduce(function, sequence[, initial]) -> value Apply a function of two arguments cumulatively to the items of a sequence, from left to right, so as to reduce the sequence to a single value. For example, reduce(lambda x, y: x+y, [1, 2, 3, 4, 5]) calculates ((((1+2)+3)+4)+5). If initial is present, it is placed before the items of the sequence in the calculation, and serves as a default when the sequence is empty.Tools that operate on functions.proxy(object[, callback]) -- create a proxy object that weakly references 'object'. 'callback', if given, is called with a reference to the proxy when 'object' is about to be finalized.getweakrefs(object) -- return a list of all weak reference objects that point to 'object'._remove_dead_weakref($module, dct, key, /) -- Atomically remove key from dict if it points to a dead weakref.getweakrefcount($module, object, /) -- Return the number of weak references to 'object'._forget_codec($module, encoding, /) -- Purge the named codec from the internal codec lookup cachelookup_error($module, name, /) -- lookup_error(errors) -> handler Return the error handler for the specified error handling name or raise a LookupError, if no handler exists under this name.register_error($module, errors, handler, /) -- Register the specified error handler under the name errors. handler must be a callable object, that will be called with an exception instance containing information about the location of the encoding/decoding error and must return a (replacement, new position) tuple.readbuffer_encode($module, data, errors=None, /) -- charmap_build($module, map, /) -- charmap_decode($module, data, errors=None, mapping=None, /) -- charmap_encode($module, str, errors=None, mapping=None, /) -- ascii_decode($module, data, errors=None, /) -- ascii_encode($module, str, errors=None, /) -- latin_1_decode($module, data, errors=None, /) -- latin_1_encode($module, str, errors=None, /) -- raw_unicode_escape_decode($module, data, errors=None, /) -- raw_unicode_escape_encode($module, str, errors=None, /) -- unicode_escape_decode($module, data, errors=None, /) -- unicode_escape_encode($module, str, errors=None, /) -- utf_32_ex_decode($module, data, errors=None, byteorder=0, final=False, /) -- utf_32_be_decode($module, data, errors=None, final=False, /) -- utf_32_le_decode($module, data, errors=None, final=False, /) -- utf_32_decode($module, data, errors=None, final=False, /) -- utf_32_be_encode($module, str, errors=None, /) -- utf_32_le_encode($module, str, errors=None, /) -- utf_32_encode($module, str, errors=None, byteorder=0, /) -- utf_16_ex_decode($module, data, errors=None, byteorder=0, final=False, /) -- utf_16_be_decode($module, data, errors=None, final=False, /) -- utf_16_le_decode($module, data, errors=None, final=False, /) -- utf_16_decode($module, data, errors=None, final=False, /) -- utf_16_be_encode($module, str, errors=None, /) -- utf_16_le_encode($module, str, errors=None, /) -- utf_16_encode($module, str, errors=None, byteorder=0, /) -- utf_7_decode($module, data, errors=None, final=False, /) -- utf_7_encode($module, str, errors=None, /) -- utf_8_decode($module, data, errors=None, final=False, /) -- utf_8_encode($module, str, errors=None, /) -- escape_decode($module, data, errors=None, /) -- escape_encode($module, data, errors=None, /) -- decode($module, /, obj, encoding='utf-8', errors='strict') -- Decodes obj using the codec registered for encoding. Default encoding is 'utf-8'. errors may be given to set a different error handling scheme. Default is 'strict' meaning that encoding errors raise a ValueError. Other possible values are 'ignore', 'replace' and 'backslashreplace' as well as any other name registered with codecs.register_error that can handle ValueErrors.encode($module, /, obj, encoding='utf-8', errors='strict') -- Encodes obj using the codec registered for encoding. The default encoding is 'utf-8'. errors may be given to set a different error handling scheme. Default is 'strict' meaning that encoding errors raise a ValueError. Other possible values are 'ignore', 'replace' and 'backslashreplace' as well as any other name registered with codecs.register_error that can handle ValueErrors.lookup($module, encoding, /) -- Looks up a codec tuple in the Python codec registry and returns a CodecInfo object.register($module, search_function, /) -- Register a codec search function. Search functions are expected to take one argument, the encoding name in all lower case letters, and either return None, or a tuple of functions (encoder, decoder, stream_reader, stream_writer) (or a CodecInfo object).Compiled regular expression object.The result of re.match() and re.search(). Match objects always have a boolean value of True.__deepcopy__($self, memo, /) -- __copy__($self, /) -- scanner($self, /, string, pos=0, endpos=sys.maxsize) -- finditer($self, /, string, pos=0, endpos=sys.maxsize) -- Return an iterator over all non-overlapping matches for the RE pattern in string. For each match, the iterator returns a match object.split($self, /, string, maxsplit=0) -- Split string by the occurrences of pattern.findall($self, /, string, pos=0, endpos=sys.maxsize) -- Return a list of all non-overlapping matches of pattern in string.subn($self, /, repl, string, count=0) -- Return the tuple (new_string, number_of_subs_made) found by replacing the leftmost non-overlapping occurrences of pattern with the replacement repl.sub($self, /, repl, string, count=0) -- Return the string obtained by replacing the leftmost non-overlapping occurrences of pattern in string by the replacement repl.search($self, /, string, pos=0, endpos=sys.maxsize) -- Scan through string looking for a match, and return a corresponding match object instance. Return None if no position in the string matches.fullmatch($self, /, string, pos=0, endpos=sys.maxsize) -- Matches against all of the string.match($self, /, string, pos=0, endpos=sys.maxsize) -- Matches zero or more characters at the beginning of the string.__deepcopy__($self, memo, /) -- __copy__($self, /) -- expand($self, /, template) -- Return the string obtained by doing backslash substitution on the string template, as done by the sub() method.groupdict($self, /, default=None) -- Return a dictionary containing all the named subgroups of the match, keyed by the subgroup name. default Is used for groups that did not participate in the match.groups($self, /, default=None) -- Return a tuple containing all the subgroups of the match, from 1. default Is used for groups that did not participate in the match.span($self, group=0, /) -- For match object m, return the 2-tuple (m.start(group), m.end(group)).end($self, group=0, /) -- Return index of the end of the substring matched by group.start($self, group=0, /) -- Return index of the start of the substring matched by group.group([group1, ...]) -> str or tuple. Return subgroup(s) of the match by indices or names. For 0 returns the entire match.search($self, /) -- match($self, /) -- unicode_tolower($module, character, /) -- ascii_tolower($module, character, /) -- unicode_iscased($module, character, /) -- ascii_iscased($module, character, /) -- getcodesize($module, /) -- compile($module, /, pattern, flags, code, groups, groupindex, indexgroup) -- SRE 2.2.2 Copyright (c) 1997-2002 by Secret Labs AB pwd.struct_passwd: Results from getpw*() routines. This object may be accessed either as a tuple of (pw_name,pw_passwd,pw_uid,pw_gid,pw_gecos,pw_dir,pw_shell) or via the object attributes as named in the above tuple.getpwall($module, /) -- Return a list of all available password database entries, in arbitrary order. See help(pwd) for more on password database entries.getpwnam($module, name, /) -- Return the password database entry for the given user name. See `help(pwd)` for more on password database entries.getpwuid($module, uidobj, /) -- Return the password database entry for the given numeric user ID. See `help(pwd)` for more on password database entries.This module provides access to the Unix password database. It is available on all Unix versions. Password database entries are reported as 7-tuples containing the following items from the password database (see `'), in order: pw_name, pw_passwd, pw_uid, pw_gid, pw_gecos, pw_dir, pw_shell. The uid and gid items are integers, all others are strings. An exception is raised if the entry asked for cannot be found.This module makes available standard errno system symbols. The value of each symbol is the corresponding integer value, e.g., on most systems, errno.ENOENT equals the integer 2. The dictionary errno.errorcode maps numeric codes to symbol names, e.g., errno.errorcode[2] could be the string 'ENOENT'. Symbols that are not relevant to the underlying system are not defined. To map error codes to error messages, use the function os.strerror(), e.g. os.strerror(2) could return 'No such file or directory'.stat_result: Result from stat, fstat, or lstat. This object may be accessed either as a tuple of (mode, ino, dev, nlink, uid, gid, size, atime, mtime, ctime) or via the attributes st_mode, st_ino, st_dev, st_nlink, st_uid, and so on. Posix/windows: If your platform supports st_blksize, st_blocks, st_rdev, or st_flags, they are available as attributes only. See os.stat for more information.statvfs_result: Result from statvfs or fstatvfs. This object may be accessed either as a tuple of (bsize, frsize, blocks, bfree, bavail, files, ffree, favail, flag, namemax), or via the attributes f_bsize, f_frsize, f_blocks, f_bfree, and so on. See os.statvfs for more information.waitid_result: Result from waitid. This object may be accessed either as a tuple of (si_pid, si_uid, si_signo, si_status, si_code), or via the attributes si_pid, si_uid, and so on. See os.waitid for more information.uname_result: Result from os.uname(). This object may be accessed either as a tuple of (sysname, nodename, release, version, machine), or via the attributes sysname, nodename, release, version, and machine. See os.uname for more information.sched_param(sched_priority) -- Current has only one field: sched_priority"); sched_priority A scheduling parameter.times_result: Result from os.times(). This object may be accessed either as a tuple of (user, system, children_user, children_system, elapsed), or via the attributes user, system, children_user, children_system, and elapsed. See os.times for more information.A tuple of (columns, lines) for holding terminal window size__fspath__($self, /) -- Returns the path for the entry.inode($self, /) -- Return inode of the entry; cached per entry.stat($self, /, *, follow_symlinks=True) -- Return stat_result object for the entry; cached per entry.is_symlink($self, /) -- Return True if the entry is a symbolic link; cached per entry.is_file($self, /, *, follow_symlinks=True) -- Return True if the entry is a file; cached per entry.is_dir($self, /, *, follow_symlinks=True) -- Return True if the entry is a directory; cached per entry.memfd_create($module, /, name, flags=MFD_CLOEXEC) -- getrandom($module, /, size, flags=0) -- Obtain a series of random bytes.fspath($module, /, path) -- Return the file system path representation of the object. If the object is str or bytes, then allow it to pass through as-is. If the object defines __fspath__(), then return the result of that method. All other types raise a TypeError.scandir($module, /, path=None) -- Return an iterator of DirEntry objects for given path. path can be specified as either str, bytes, or a path-like object. If path is bytes, the names of yielded DirEntry objects will also be bytes; in all other circumstances they will be str. If path is None, uses the path='.'.set_blocking($module, fd, blocking, /) -- Set the blocking mode of the specified file descriptor. Set the O_NONBLOCK flag if blocking is False, clear the O_NONBLOCK flag otherwise.get_blocking($module, fd, /) -- Get the blocking mode of the file descriptor. Return False if the O_NONBLOCK flag is set, True if the flag is cleared.set_inheritable($module, fd, inheritable, /) -- Set the inheritable flag of the specified file descriptor.get_inheritable($module, fd, /) -- Get the close-on-exe flag of the specified file descriptor.cpu_count($module, /) -- Return the number of CPUs in the system; return None if indeterminable. This number is not equivalent to the number of CPUs the current process can use. The number of usable CPUs can be obtained with ``len(os.sched_getaffinity(0))``Return the size of the terminal window as (columns, lines). The optional argument fd (default standard output) specifies which file descriptor should be queried. If the file descriptor is not connected to a terminal, an OSError is thrown. This function will only be defined if an implementation is available for this system. shutil.get_terminal_size is the high-level function which should normally be used, os.get_terminal_size is the low-level implementation.listxattr($module, /, path=None, *, follow_symlinks=True) -- Return a list of extended attributes on path. path may be either None, a string, a path-like object, or an open file descriptor. if path is None, listxattr will examine the current directory. If follow_symlinks is False, and the last element of the path is a symbolic link, listxattr will examine the symbolic link itself instead of the file the link points to.removexattr($module, /, path, attribute, *, follow_symlinks=True) -- Remove extended attribute attribute on path. path may be either a string, a path-like object, or an open file descriptor. If follow_symlinks is False, and the last element of the path is a symbolic link, removexattr will modify the symbolic link itself instead of the file the link points to.setxattr($module, /, path, attribute, value, flags=0, *, follow_symlinks=True) -- Set extended attribute attribute on path to value. path may be either a string, a path-like object, or an open file descriptor. If follow_symlinks is False, and the last element of the path is a symbolic link, setxattr will modify the symbolic link itself instead of the file the link points to.getxattr($module, /, path, attribute, *, follow_symlinks=True) -- Return the value of extended attribute attribute on path. path may be either a string, a path-like object, or an open file descriptor. If follow_symlinks is False, and the last element of the path is a symbolic link, getxattr will examine the symbolic link itself instead of the file the link points to.getresgid($module, /) -- Return a tuple of the current process's real, effective, and saved group ids.getresuid($module, /) -- Return a tuple of the current process's real, effective, and saved user ids.setresgid($module, rgid, egid, sgid, /) -- Set the current process's real, effective, and saved group ids.setresuid($module, ruid, euid, suid, /) -- Set the current process's real, effective, and saved user ids.urandom($module, size, /) -- Return a bytes object containing random bytes suitable for cryptographic use.getloadavg($module, /) -- Return average recent system load information. Return the number of processes in the system run queue averaged over the last 1, 5, and 15 minutes as a tuple of three floats. Raises OSError if the load average was unobtainable.abort($module, /) -- Abort the interpreter immediately. This function 'dumps core' or otherwise fails in the hardest way possible on the hosting operating system. This function never returns.pathconf($module, /, path, name) -- Return the configuration limit name for the file or directory path. If there is no limit, return -1. On some platforms, path may also be specified as an open file descriptor. If this functionality is unavailable, using it raises an exception.fpathconf($module, fd, name, /) -- Return the configuration limit name for the file descriptor fd. If there is no limit, return -1.sysconf($module, name, /) -- Return an integer-valued system configuration variable.confstr($module, name, /) -- Return a string-valued system configuration variable.statvfs($module, /, path) -- Perform a statvfs system call on the given path. path may always be specified as a string. On some platforms, path may also be specified as an open file descriptor. If this functionality is unavailable, using it raises an exception.fstatvfs($module, fd, /) -- Perform an fstatvfs system call on the given fd. Equivalent to statvfs(fd).WSTOPSIG($module, /, status) -- Return the signal that stopped the process that provided the status value.WTERMSIG($module, /, status) -- Return the signal that terminated the process that provided the status value.WEXITSTATUS($module, /, status) -- Return the process return code from status.WIFEXITED($module, /, status) -- Return True if the process returning status exited via the exit() system call.WIFSIGNALED($module, /, status) -- Return True if the process returning status was terminated by a signal.WIFSTOPPED($module, /, status) -- Return True if the process returning status was stopped.WIFCONTINUED($module, /, status) -- Return True if a particular process was continued from a job control stop. Return True if the process returning status was continued from a job control stop.WCOREDUMP($module, status, /) -- Return True if the process returning status was dumped to a core file.fdatasync($module, /, fd) -- Force write of fd to disk without forcing update of metadata.sync($module, /) -- Force write of everything to disk.fsync($module, /, fd) -- Force write of fd to disk.fchdir($module, /, fd) -- Change to the directory of the given file descriptor. fd must be opened on a directory, not a file. Equivalent to os.chdir(fd).strerror($module, code, /) -- Translate an error code to a message string.unsetenv($module, name, /) -- Delete an environment variable.putenv($module, name, value, /) -- Change or add an environment variable.posix_fadvise($module, fd, offset, length, advice, /) -- Announce an intention to access data in a specific pattern. Announce an intention to access data in a specific pattern, thus allowing the kernel to make optimizations. The advice applies to the region of the file specified by fd starting at offset and continuing for length bytes. advice is one of POSIX_FADV_NORMAL, POSIX_FADV_SEQUENTIAL, POSIX_FADV_RANDOM, POSIX_FADV_NOREUSE, POSIX_FADV_WILLNEED, or POSIX_FADV_DONTNEED.posix_fallocate($module, fd, offset, length, /) -- Ensure a file has allocated at least a particular number of bytes on disk. Ensure that the file specified by fd encompasses a range of bytes starting at offset bytes from the beginning and continuing for length bytes.truncate($module, /, path, length) -- Truncate a file, specified by path, to a specific length. On some platforms, path may also be specified as an open file descriptor. If this functionality is unavailable, using it raises an exception.ftruncate($module, fd, length, /) -- Truncate a file, specified by file descriptor, to a specific length.makedev($module, major, minor, /) -- Composes a raw device number from the major and minor device numbers.minor($module, device, /) -- Extracts a device minor number from a raw device number.major($module, device, /) -- Extracts a device major number from a raw device number.mknod($module, /, path, mode=384, device=0, *, dir_fd=None) -- Create a node in the file system. Create a node in the file system (file, device special file or named pipe) at path. mode specifies both the permissions to use and the type of node to be created, being combined (bitwise OR) with one of S_IFREG, S_IFCHR, S_IFBLK, and S_IFIFO. If S_IFCHR or S_IFBLK is set on mode, device defines the newly created device special file (probably using os.makedev()). Otherwise device is ignored. If dir_fd is not None, it should be a file descriptor open to a directory, and path should be relative; path will then be relative to that directory. dir_fd may not be implemented on your platform. If it is unavailable, using it will raise a NotImplementedError.mkfifo($module, /, path, mode=438, *, dir_fd=None) -- Create a "fifo" (a POSIX named pipe). If dir_fd is not None, it should be a file descriptor open to a directory, and path should be relative; path will then be relative to that directory. dir_fd may not be implemented on your platform. If it is unavailable, using it will raise a NotImplementedError.pipe2($module, flags, /) -- Create a pipe with flags set atomically. Returns a tuple of two file descriptors: (read_fd, write_fd) flags can be constructed by ORing together one or more of these values: O_NONBLOCK, O_CLOEXEC.pipe($module, /) -- Create a pipe. Returns a tuple of two file descriptors: (read_fd, write_fd)isatty($module, fd, /) -- Return True if the fd is connected to a terminal. Return True if the file descriptor is an open file descriptor connected to the slave end of a terminal.fstat($module, /, fd) -- Perform a stat system call on the given file descriptor. Like stat(), but for an open file descriptor. Equivalent to os.stat(fd).sendfile(out, in, offset, count) -> byteswritten sendfile(out, in, offset, count[, headers][, trailers], flags=0) -> byteswritten Copy count bytes from file descriptor in to file descriptor out.pwritev($module, fd, buffers, offset, flags=0, /) -- Writes the contents of bytes-like objects to a file descriptor at a given offset. Combines the functionality of writev() and pwrite(). All buffers must be a sequence of bytes-like objects. Buffers are processed in array order. Entire contents of first buffer is written before proceeding to second, and so on. The operating system may set a limit (sysconf() value SC_IOV_MAX) on the number of buffers that can be used. This function writes the contents of each object to the file descriptor and returns the total number of bytes written. The flags argument contains a bitwise OR of zero or more of the following flags: - RWF_DSYNC - RWF_SYNC Using non-zero flags requires Linux 4.7 or newer.pwrite($module, fd, buffer, offset, /) -- Write bytes to a file descriptor starting at a particular offset. Write buffer to fd, starting at offset bytes from the beginning of the file. Returns the number of bytes writte. Does not change the current file offset.writev($module, fd, buffers, /) -- Iterate over buffers, and write the contents of each to a file descriptor. Returns the total number of bytes written. buffers must be a sequence of bytes-like objects.write($module, fd, data, /) -- Write a bytes object to a file descriptor.preadv($module, fd, buffers, offset, flags=0, /) -- Reads from a file descriptor into a number of mutable bytes-like objects. Combines the functionality of readv() and pread(). As readv(), it will transfer data into each buffer until it is full and then move on to the next buffer in the sequence to hold the rest of the data. Its fourth argument, specifies the file offset at which the input operation is to be performed. It will return the total number of bytes read (which can be less than the total capacity of all the objects). The flags argument contains a bitwise OR of zero or more of the following flags: - RWF_HIPRI - RWF_NOWAIT Using non-zero flags requires Linux 4.6 or newer.pread($module, fd, length, offset, /) -- Read a number of bytes from a file descriptor starting at a particular offset. Read length bytes from file descriptor fd, starting at offset bytes from the beginning of the file. The file offset remains unchanged.readv($module, fd, buffers, /) -- Read from a file descriptor fd into an iterable of buffers. The buffers should be mutable buffers accepting bytes. readv will transfer data into each buffer until it is full and then move on to the next buffer in the sequence to hold the rest of the data. readv returns the total number of bytes read, which may be less than the total capacity of all the buffers.read($module, fd, length, /) -- Read from a file descriptor. Returns a bytes object.lseek($module, fd, position, how, /) -- Set the position of a file descriptor. Return the new position. Return the new cursor position in number of bytes relative to the beginning of the file.lockf($module, fd, command, length, /) -- Apply, test or remove a POSIX lock on an open file descriptor. fd An open file descriptor. command One of F_LOCK, F_TLOCK, F_ULOCK or F_TEST. length The number of bytes to lock, starting at the current position.dup2($module, /, fd, fd2, inheritable=True) -- Duplicate file descriptor.dup($module, fd, /) -- Return a duplicate of a file descriptor.device_encoding($module, /, fd) -- Return a string describing the encoding of a terminal's file descriptor. The file descriptor must be attached to a terminal. If the device is not a terminal, return None.closerange($module, fd_low, fd_high, /) -- Closes all file descriptors in [fd_low, fd_high), ignoring errors.close($module, /, fd) -- Close a file descriptor.open($module, /, path, flags, mode=511, *, dir_fd=None) -- Open a file for low level IO. Returns a file descriptor (integer). If dir_fd is not None, it should be a file descriptor open to a directory, and path should be relative; path will then be relative to that directory. dir_fd may not be implemented on your platform. If it is unavailable, using it will raise a NotImplementedError.tcsetpgrp($module, fd, pgid, /) -- Set the process group associated with the terminal specified by fd.tcgetpgrp($module, fd, /) -- Return the process group associated with the terminal specified by fd.setpgid($module, pid, pgrp, /) -- Call the system call setpgid(pid, pgrp).setsid($module, /) -- Call the system call setsid().getsid($module, pid, /) -- Call the system call getsid(pid) and return the result.waitpid($module, pid, options, /) -- Wait for completion of a given child process. Returns a tuple of information regarding the child process: (pid, status) The options argument is ignored on Windows.waitid($module, idtype, id, options, /) -- Returns the result of waiting for a process or processes. idtype Must be one of be P_PID, P_PGID or P_ALL. id The id to wait on. options Constructed from the ORing of one or more of WEXITED, WSTOPPED or WCONTINUED and additionally may be ORed with WNOHANG or WNOWAIT. Returns either waitid_result or None if WNOHANG is specified and there are no children in a waitable state.wait4($module, /, pid, options) -- Wait for completion of a specific child process. Returns a tuple of information about the child process: (pid, status, rusage)wait3($module, /, options) -- Wait for completion of a child process. Returns a tuple of information about the child process: (pid, status, rusage)wait($module, /) -- Wait for completion of a child process. Returns a tuple of information about the child process: (pid, status)setpgrp($module, /) -- Make the current process the leader of its process group.getpgid($module, /, pid) -- Call the system call getpgid(), and return the result.initgroups(username, gid) -> None Call the system initgroups() to initialize the group access list with all of the groups of which the specified username is a member, plus the specified group id.setgroups($module, groups, /) -- Set the groups of the current process to list.setregid($module, rgid, egid, /) -- Set the current process's real and effective group ids.setegid($module, egid, /) -- Set the current process's effective group id.setgid($module, gid, /) -- Set the current process's group id.setreuid($module, ruid, euid, /) -- Set the current process's real and effective user ids.seteuid($module, euid, /) -- Set the current process's effective user id.setuid($module, uid, /) -- Set the current process's user id.killpg($module, pgid, signal, /) -- Kill a process group with a signal.kill($module, pid, signal, /) -- Kill a process with a signal.getlogin($module, /) -- Return the actual login name.getuid($module, /) -- Return the current process's user id.getppid($module, /) -- Return the parent's process id. If the parent process has already exited, Windows machines will still return its id; others systems will return the id of the 'init' process (1).getpgrp($module, /) -- Return the current process group id.getpid($module, /) -- Return the current process id.getgroups($module, /) -- Return list of supplemental group IDs for the process.getgrouplist(user, group) -> list of groups to which a user belongs Returns a list of groups to which a user belongs. user: username to lookup group: base group id of the usergetgid($module, /) -- Return the current process's group id.geteuid($module, /) -- Return the current process's effective user id.getegid($module, /) -- Return the current process's effective group id.forkpty($module, /) -- Fork a new process with a new pseudo-terminal as controlling tty. Returns a tuple of (pid, master_fd). Like fork(), return pid of 0 to the child process, and pid of child to the parent process. To both, return fd of newly opened pseudo-terminal.openpty($module, /) -- Open a pseudo-terminal. Return a tuple of (master_fd, slave_fd) containing open file descriptors for both the master and slave ends.sched_getaffinity($module, pid, /) -- Return the affinity of the process identified by pid (or the current process if zero). The affinity is returned as a set of CPU identifiers.sched_setaffinity($module, pid, mask, /) -- Set the CPU affinity of the process identified by pid to mask. mask should be an iterable of integers identifying CPUs.sched_yield($module, /) -- Voluntarily relinquish the CPU.sched_setscheduler($module, pid, policy, param, /) -- Set the scheduling policy for the process identified by pid. If pid is 0, the calling process is changed. param is an instance of sched_param.sched_setparam($module, pid, param, /) -- Set scheduling parameters for the process identified by pid. If pid is 0, sets parameters for the calling process. param should be an instance of sched_param.sched_rr_get_interval($module, pid, /) -- Return the round-robin quantum for the process identified by pid, in seconds. Value returned is a float.sched_getscheduler($module, pid, /) -- Get the scheduling policy for the process identifiedy by pid. Passing 0 for pid returns the scheduling policy for the calling process.sched_getparam($module, pid, /) -- Returns scheduling parameters for the process identified by pid. If pid is 0, returns parameters for the calling process. Return value is an instance of sched_param.sched_get_priority_min($module, /, policy) -- Get the minimum scheduling priority for policy.sched_get_priority_max($module, /, policy) -- Get the maximum scheduling priority for policy.register_at_fork($module, /, *, before=, after_in_child=, after_in_parent=) -- Register callables to be called when forking a new process. before A callable to be called in the parent before the fork() syscall. after_in_child A callable to be called in the child after fork(). after_in_parent A callable to be called in the parent after fork(). 'before' callbacks are called in reverse order. 'after_in_child' and 'after_in_parent' callbacks are called in order.fork($module, /) -- Fork a child process. Return 0 to child process and PID of child to parent process.execve($module, /, path, argv, env) -- Execute an executable path with arguments, replacing current process. path Path of executable file. argv Tuple or list of strings. env Dictionary of strings mapping to strings.execv($module, path, argv, /) -- Execute an executable path with arguments, replacing current process. path Path of executable file. argv Tuple or list of strings._exit($module, /, status) -- Exit to the system with specified status, without normal exit processing.times($module, /) -- Return a collection containing process timing information. The object returned behaves like a named tuple with these fields: (utime, stime, cutime, cstime, elapsed_time) All fields are floating point numbers.utime($module, /, path, times=None, *, ns=, dir_fd=None, follow_symlinks=True) -- Set the access and modified time of path. path may always be specified as a string. On some platforms, path may also be specified as an open file descriptor. If this functionality is unavailable, using it raises an exception. If times is not None, it must be a tuple (atime, mtime); atime and mtime should be expressed as float seconds since the epoch. If ns is specified, it must be a tuple (atime_ns, mtime_ns); atime_ns and mtime_ns should be expressed as integer nanoseconds since the epoch. If times is None and ns is unspecified, utime uses the current time. Specifying tuples for both times and ns is an error. If dir_fd is not None, it should be a file descriptor open to a directory, and path should be relative; path will then be relative to that directory. If follow_symlinks is False, and the last element of the path is a symbolic link, utime will modify the symbolic link itself instead of the file the link points to. It is an error to use dir_fd or follow_symlinks when specifying path as an open file descriptor. dir_fd and follow_symlinks may not be available on your platform. If they are unavailable, using them will raise a NotImplementedError.remove($module, /, path, *, dir_fd=None) -- Remove a file (same as unlink()). If dir_fd is not None, it should be a file descriptor open to a directory, and path should be relative; path will then be relative to that directory. dir_fd may not be implemented on your platform. If it is unavailable, using it will raise a NotImplementedError.unlink($module, /, path, *, dir_fd=None) -- Remove a file (same as remove()). If dir_fd is not None, it should be a file descriptor open to a directory, and path should be relative; path will then be relative to that directory. dir_fd may not be implemented on your platform. If it is unavailable, using it will raise a NotImplementedError.uname($module, /) -- Return an object identifying the current operating system. The object behaves like a named tuple with the following fields: (sysname, nodename, release, version, machine)umask($module, mask, /) -- Set the current numeric umask and return the previous umask.system($module, /, command) -- Execute the command in a subshell.symlink($module, /, src, dst, target_is_directory=False, *, dir_fd=None) -- Create a symbolic link pointing to src named dst. target_is_directory is required on Windows if the target is to be interpreted as a directory. (On Windows, symlink requires Windows 6.0 or greater, and raises a NotImplementedError otherwise.) target_is_directory is ignored on non-Windows platforms. If dir_fd is not None, it should be a file descriptor open to a directory, and path should be relative; path will then be relative to that directory. dir_fd may not be implemented on your platform. If it is unavailable, using it will raise a NotImplementedError.rmdir($module, /, path, *, dir_fd=None) -- Remove a directory. If dir_fd is not None, it should be a file descriptor open to a directory, and path should be relative; path will then be relative to that directory. dir_fd may not be implemented on your platform. If it is unavailable, using it will raise a NotImplementedError.replace($module, /, src, dst, *, src_dir_fd=None, dst_dir_fd=None) -- Rename a file or directory, overwriting the destination. If either src_dir_fd or dst_dir_fd is not None, it should be a file descriptor open to a directory, and the respective path string (src or dst) should be relative; the path will then be relative to that directory. src_dir_fd and dst_dir_fd, may not be implemented on your platform. If they are unavailable, using them will raise a NotImplementedError.rename($module, /, src, dst, *, src_dir_fd=None, dst_dir_fd=None) -- Rename a file or directory. If either src_dir_fd or dst_dir_fd is not None, it should be a file descriptor open to a directory, and the respective path string (src or dst) should be relative; the path will then be relative to that directory. src_dir_fd and dst_dir_fd, may not be implemented on your platform. If they are unavailable, using them will raise a NotImplementedError.copy_file_range($module, /, src, dst, count, offset_src=None, offset_dst=None) -- Copy count bytes from one file descriptor to another. src Source file descriptor. dst Destination file descriptor. count Number of bytes to copy. offset_src Starting offset in src. offset_dst Starting offset in dst. If offset_src is None, then src is read from the current position; respectively for offset_dst.readlink($module, /, path, *, dir_fd=None) -- Return a string representing the path to which the symbolic link points. If dir_fd is not None, it should be a file descriptor open to a directory, and path should be relative; path will then be relative to that directory. dir_fd may not be implemented on your platform. If it is unavailable, using it will raise a NotImplementedError.posix_spawnp($module, path, argv, env, /, *, file_actions=(), setpgroup=, resetids=False, setsid=False, setsigmask=(), setsigdef=(), scheduler=) -- Execute the program specified by path in a new process. path Path of executable file. argv Tuple or list of strings. env Dictionary of strings mapping to strings. file_actions A sequence of file action tuples. setpgroup The pgroup to use with the POSIX_SPAWN_SETPGROUP flag. resetids If the value is `True` the POSIX_SPAWN_RESETIDS will be activated. setsid If the value is `True` the POSIX_SPAWN_SETSID or POSIX_SPAWN_SETSID_NP will be activated. setsigmask The sigmask to use with the POSIX_SPAWN_SETSIGMASK flag. setsigdef The sigmask to use with the POSIX_SPAWN_SETSIGDEF flag. scheduler A tuple with the scheduler policy (optional) and parameters.posix_spawn($module, path, argv, env, /, *, file_actions=(), setpgroup=, resetids=False, setsid=False, setsigmask=(), setsigdef=(), scheduler=) -- Execute the program specified by path in a new process. path Path of executable file. argv Tuple or list of strings. env Dictionary of strings mapping to strings. file_actions A sequence of file action tuples. setpgroup The pgroup to use with the POSIX_SPAWN_SETPGROUP flag. resetids If the value is `true` the POSIX_SPAWN_RESETIDS will be activated. setsid If the value is `true` the POSIX_SPAWN_SETSID or POSIX_SPAWN_SETSID_NP will be activated. setsigmask The sigmask to use with the POSIX_SPAWN_SETSIGMASK flag. setsigdef The sigmask to use with the POSIX_SPAWN_SETSIGDEF flag. scheduler A tuple with the scheduler policy (optional) and parameters.setpriority($module, /, which, who, priority) -- Set program scheduling priority.getpriority($module, /, which, who) -- Return program scheduling priority.nice($module, increment, /) -- Add increment to the priority of process and return the new priority.mkdir($module, /, path, mode=511, *, dir_fd=None) -- Create a directory. If dir_fd is not None, it should be a file descriptor open to a directory, and path should be relative; path will then be relative to that directory. dir_fd may not be implemented on your platform. If it is unavailable, using it will raise a NotImplementedError. The mode argument is ignored on Windows.lstat($module, /, path, *, dir_fd=None) -- Perform a stat system call on the given path, without following symbolic links. Like stat(), but do not follow symbolic links. Equivalent to stat(path, follow_symlinks=False).listdir($module, /, path=None) -- Return a list containing the names of the files in the directory. path can be specified as either str, bytes, or a path-like object. If path is bytes, the filenames returned will also be bytes; in all other circumstances the filenames returned will be str. If path is None, uses the path='.'. On some platforms, path may also be specified as an open file descriptor;\ the file descriptor must refer to a directory. If this functionality is unavailable, using it raises NotImplementedError. The list is in arbitrary order. It does not include the special entries '.' and '..' even if they are present in the directory.link($module, /, src, dst, *, src_dir_fd=None, dst_dir_fd=None, follow_symlinks=True) -- Create a hard link to a file. If either src_dir_fd or dst_dir_fd is not None, it should be a file descriptor open to a directory, and the respective path string (src or dst) should be relative; the path will then be relative to that directory. If follow_symlinks is False, and the last element of src is a symbolic link, link will create a link to the symbolic link itself instead of the file the link points to. src_dir_fd, dst_dir_fd, and follow_symlinks may not be implemented on your platform. If they are unavailable, using them will raise a NotImplementedError.getcwdb($module, /) -- Return a bytes string representing the current working directory.getcwd($module, /) -- Return a unicode string representing the current working directory.ctermid($module, /) -- Return the name of the controlling terminal for this process.chroot($module, /, path) -- Change root directory to path.lchown($module, /, path, uid, gid) -- Change the owner and group id of path to the numeric uid and gid. This function will not follow symbolic links. Equivalent to os.chown(path, uid, gid, follow_symlinks=False).fchown($module, /, fd, uid, gid) -- Change the owner and group id of the file specified by file descriptor. Equivalent to os.chown(fd, uid, gid).chown($module, /, path, uid, gid, *, dir_fd=None, follow_symlinks=True) -- Change the owner and group id of path to the numeric uid and gid.\ path Path to be examined; can be string, bytes, a path-like object, or open-file-descriptor int. dir_fd If not None, it should be a file descriptor open to a directory, and path should be relative; path will then be relative to that directory. follow_symlinks If False, and the last element of the path is a symbolic link, stat will examine the symbolic link itself instead of the file the link points to. path may always be specified as a string. On some platforms, path may also be specified as an open file descriptor. If this functionality is unavailable, using it raises an exception. If dir_fd is not None, it should be a file descriptor open to a directory, and path should be relative; path will then be relative to that directory. If follow_symlinks is False, and the last element of the path is a symbolic link, chown will modify the symbolic link itself instead of the file the link points to. It is an error to use dir_fd or follow_symlinks when specifying path as an open file descriptor. dir_fd and follow_symlinks may not be implemented on your platform. If they are unavailable, using them will raise a NotImplementedError.fchmod($module, /, fd, mode) -- Change the access permissions of the file given by file descriptor fd. Equivalent to os.chmod(fd, mode).chmod($module, /, path, mode, *, dir_fd=None, follow_symlinks=True) -- Change the access permissions of a file. path Path to be modified. May always be specified as a str, bytes, or a path-like object. On some platforms, path may also be specified as an open file descriptor. If this functionality is unavailable, using it raises an exception. mode Operating-system mode bitfield. dir_fd If not None, it should be a file descriptor open to a directory, and path should be relative; path will then be relative to that directory. follow_symlinks If False, and the last element of the path is a symbolic link, chmod will modify the symbolic link itself instead of the file the link points to. It is an error to use dir_fd or follow_symlinks when specifying path as an open file descriptor. dir_fd and follow_symlinks may not be implemented on your platform. If they are unavailable, using them will raise a NotImplementedError.chdir($module, /, path) -- Change the current working directory to the specified path. path may always be specified as a string. On some platforms, path may also be specified as an open file descriptor. If this functionality is unavailable, using it raises an exception.ttyname($module, fd, /) -- Return the name of the terminal device connected to 'fd'. fd Integer file descriptor handle.access($module, /, path, mode, *, dir_fd=None, effective_ids=False, follow_symlinks=True) -- Use the real uid/gid to test for access to a path. path Path to be tested; can be string, bytes, or a path-like object. mode Operating-system mode bitfield. Can be F_OK to test existence, or the inclusive-OR of R_OK, W_OK, and X_OK. dir_fd If not None, it should be a file descriptor open to a directory, and path should be relative; path will then be relative to that directory. effective_ids If True, access will use the effective uid/gid instead of the real uid/gid. follow_symlinks If False, and the last element of the path is a symbolic link, access will examine the symbolic link itself instead of the file the link points to. dir_fd, effective_ids, and follow_symlinks may not be implemented on your platform. If they are unavailable, using them will raise a NotImplementedError. Note that most operations will use the effective uid/gid, therefore this routine can be used in a suid/sgid environment to test if the invoking user has the specified access to the path.stat($module, /, path, *, dir_fd=None, follow_symlinks=True) -- Perform a stat system call on the given path. path Path to be examined; can be string, bytes, a path-like object or open-file-descriptor int. dir_fd If not None, it should be a file descriptor open to a directory, and path should be a relative string; path will then be relative to that directory. follow_symlinks If False, and the last element of the path is a symbolic link, stat will examine the symbolic link itself instead of the file the link points to. dir_fd and follow_symlinks may not be implemented on your platform. If they are unavailable, using them will raise a NotImplementedError. It's an error to use dir_fd or follow_symlinks when specifying path as an open file descriptor.This module provides access to operating system functionality that is standardized by the C Standard and the POSIX standard (a thinly disguised Unix interface). Refer to the library manual and corresponding Unix manual entries for more information on calls.get_freeze_count($module, /) -- Return the number of objects in the permanent generation.unfreeze($module, /) -- Unfreeze all objects in the permanent generation. Put all objects in the permanent generation back into oldest generation.freeze($module, /) -- Freeze all current tracked objects and ignore them for future collections. This can be used before a POSIX fork() call to make the gc copy-on-write friendly. Note: collection before a POSIX fork() call may free pages for future allocation which can cause copy-on-write.get_referents(*objs) -> list Return the list of objects that are directly referred to by objs.get_referrers(*objs) -> list Return the list of objects that directly refer to any of objs.is_tracked($module, obj, /) -- Returns true if the object is tracked by the garbage collector. Simple atomic objects will return false.get_stats($module, /) -- Return a list of dictionaries containing per-generation statistics.get_objects($module, /, generation=None) -- Return a list of objects tracked by the collector (excluding the list returned). generation Generation to extract the objects from. If generation is not None, return only the objects tracked by the collector that are in that generation.collect($module, /, generation=2) -- Run the garbage collector. With no arguments, run a full collection. The optional argument may be an integer specifying which generation to collect. A ValueError is raised if the generation number is invalid. The number of unreachable objects is returned.get_threshold($module, /) -- Return the current collection thresholds.set_threshold(threshold0, [threshold1, threshold2]) -> None Sets the collection thresholds. Setting threshold0 to zero disables collection. get_count($module, /) -- Return a three-tuple of the current collection counts.get_debug($module, /) -- Get the garbage collection debugging flags.set_debug($module, flags, /) -- Set the garbage collection debugging flags. flags An integer that can have the following bits turned on: DEBUG_STATS - Print statistics during collection. DEBUG_COLLECTABLE - Print collectable objects found. DEBUG_UNCOLLECTABLE - Print unreachable but uncollectable objects found. DEBUG_SAVEALL - Save objects to gc.garbage rather than freeing them. DEBUG_LEAK - Debug leaking programs (everything but STATS). Debugging information is written to sys.stderr.isenabled($module, /) -- Returns true if automatic garbage collection is enabled.disable($module, /) -- Disable automatic garbage collection.enable($module, /) -- Enable automatic garbage collection.This module provides access to the garbage collector for reference cycles. enable() -- Enable automatic garbage collection. disable() -- Disable automatic garbage collection. isenabled() -- Returns true if automatic collection is enabled. collect() -- Do a full collection right now. get_count() -- Return the current collection counts. get_stats() -- Return list of dictionaries containing per-generation stats. set_debug() -- Set debugging flags. get_debug() -- Get debugging flags. set_threshold() -- Set the collection thresholds. get_threshold() -- Return the current the collection thresholds. get_objects() -- Return a list of all objects tracked by the collector. is_tracked() -- Returns true if a given object is tracked. get_referrers() -- Return the list of objects that refer to an object. get_referents() -- Return the list of objects that an object refers to. freeze() -- Freeze all tracked objects and ignore them for future collections. unfreeze() -- Unfreeze all objects in the permanent generation. get_freeze_count() -- Return the number of objects in the permanent generation. PyObject_GC_Trackcalculate_prefixsearch_for_prefixcalculate_exec_prefixsearch_for_exec_prefixcalculate_pybuilddircalculate_program_full_path:calculate_module_search_pathcalculate_set_prefixcalculate_set_exec_prefix/calculate_read_pyenvcalculate_argv0_pathabsolutizecopy_absolutecalculate_zip_pathjoinpathcalculate_init   ؗҜ<3#I9=D2[%Cod(h7yACnF?O8M20HwZstr conversions.get_int_max_str_digits($module, /) -- Return the maximum string digits limit for non-binary int<->str conversions.unraisablehook($module, unraisable, /) -- Handle an unraisable exception. The unraisable argument has the following attributes: * exc_type: Exception type. * exc_value: Exception value, can be None. * exc_traceback: Exception traceback, can be None. * err_msg: Error message, can be None. * object: Object causing the exception, can be None.get_asyncgen_hooks($module, /) -- Return the installed asynchronous generators hooks. This returns a namedtuple of the form (firstiter, finalizer).set_asyncgen_hooks(* [, firstiter] [, finalizer]) Set a finalizer for async generators objects.get_coroutine_origin_tracking_depth($module, /) -- Check status of origin tracking for coroutine objects in this thread.set_coroutine_origin_tracking_depth($module, /, depth) -- Enable or disable origin tracking for coroutine objects in this thread. Coroutine objects will track 'depth' frames of traceback information about where they came from, available in their cr_origin attribute. Set a depth of 0 to disable._debugmallocstats($module, /) -- Print summary info to stderr about the state of pymalloc's structures. In Py_DEBUG mode, also perform some expensive internal consistency checks.call_tracing($module, func, args, /) -- Call func(*args), while tracing is enabled. The tracing state is saved, and restored afterwards. This is intended to be called from a debugger from a checkpoint, to recursively debug some other code.gettrace($module, /) -- Return the global debug tracing function set with sys.settrace. See the debugger chapter in the library manual.settrace(function) Set the global debug tracing function. It will be called on each function call. See the debugger chapter in the library manual.setrecursionlimit($module, limit, /) -- Set the maximum depth of the Python interpreter stack to n. This limit prevents infinite recursion from causing an overflow of the C stack and crashing Python. The highest possible limit is platform- dependent.getprofile($module, /) -- Return the profiling function set with sys.setprofile. See the profiler chapter in the library manual.setprofile(function) Set the profiling function. It will be called on each function call and return. See the profiler chapter in the library manual.setdlopenflags($module, flags, /) -- Set the flags used by the interpreter for dlopen calls. This is used, for example, when the interpreter loads extension modules. Among other things, this will enable a lazy resolving of symbols when importing a module, if called as sys.setdlopenflags(0). To share symbols across extension modules, call as sys.setdlopenflags(os.RTLD_GLOBAL). Symbolic names for the flag modules can be found in the os module (RTLD_xxx constants, e.g. os.RTLD_LAZY).getswitchinterval($module, /) -- Return the current thread switch interval; see sys.setswitchinterval().setswitchinterval($module, interval, /) -- Set the ideal thread switching delay inside the Python interpreter. The actual frequency of switching threads can be lower if the interpreter executes long sequences of uninterruptible code (this is implementation-specific and workload-dependent). The parameter must represent the desired switching delay in seconds A typical value is 0.005 (5 milliseconds).getcheckinterval($module, /) -- Return the current check interval; see sys.setcheckinterval().setcheckinterval($module, n, /) -- Set the async event check interval to n instructions. This tells the Python interpreter to check for asynchronous events every n instructions. This also affects how often thread switches occur.is_finalizing($module, /) -- Return True if Python is exiting.intern($module, string, /) -- ``Intern'' the given string. This enters the string in the (global) table of interned strings whose purpose is to speed up dictionary lookups. Return the string itself or the previously interned string object with the same value._getframe($module, depth=0, /) -- Return a frame object from the call stack. If optional integer depth is given, return the frame object that many calls below the top of the stack. If that is deeper than the call stack, ValueError is raised. The default for depth is zero, returning the frame at the top of the call stack. This function should be used for internal and specialized purposes only.getsizeof(object [, default]) -> int Return the size of object in bytes.getrecursionlimit($module, /) -- Return the current value of the recursion limit. The recursion limit is the maximum depth of the Python interpreter stack. This limit prevents infinite recursion from causing an overflow of the C stack and crashing Python.getrefcount($module, object, /) -- Return the reference count of object. The count returned is generally one higher than you might expect, because it includes the (temporary) reference as an argument to getrefcount().getfilesystemencodeerrors($module, /) -- Return the error mode used Unicode to OS filename conversion.getfilesystemencoding($module, /) -- Return the encoding used to convert Unicode filenames to OS filenames.getallocatedblocks($module, /) -- Return the number of memory blocks currently allocated.getdlopenflags($module, /) -- Return the current value of the flags that are used for dlopen calls. The flag constants are defined in the os module.getdefaultencoding($module, /) -- Return the current default encoding used by the Unicode implementation.exit($module, status=None, /) -- Exit the interpreter by raising SystemExit(status). If the status is omitted or None, it defaults to zero (i.e., success). If the status is an integer, it will be used as the system exit status. If it is another kind of object, it will be printed and the system exit status will be one (i.e., failure).excepthook($module, exctype, value, traceback, /) -- Handle an exception by displaying it with a traceback on sys.stderr.exc_info($module, /) -- Return current exception information: (type, value, traceback). Return information about the most recent exception caught by an except clause in the current stack frame or in an older stack frame.displayhook($module, object, /) -- Print an object to sys.stdout and also save it in builtins.__current_frames($module, /) -- Return a dict mapping each thread's thread id to its current stack frame. This function should be used for specialized purposes only._clear_type_cache($module, /) -- Clear the internal type lookup cache.callstats($module, /) -- Return a tuple of function call statistics. A tuple is returned only if CALL_PROFILE was defined when Python was built. Otherwise, this returns None. When enabled, this function returns detailed, implementation-specific details about the number of function calls executed. The return value is a 11-tuple where the entries in the tuple are counts of: 0. all function calls 1. calls to PyFunction_Type objects 2. PyFunction calls that do not create an argument tuple 3. PyFunction calls that do not create an argument tuple and bypass PyEval_EvalCodeEx() 4. PyMethod calls 5. PyMethod calls on bound methods 6. PyType calls 7. PyCFunction calls 8. generator calls 9. All other calls 10. Number of stack pops performed by call_function()breakpointhook(*args, **kws) This hook function is called by built-in breakpoint(). audit(event, *args) Passes the event to any audit hooks that are attached.addaudithook($module, /, hook) -- Adds a new audit hook callback.sys.flags Flags provided through command line arguments or environment vars.sys.version_info Version information as a named tuple.This module provides access to some objects used or maintained by the interpreter and to functions that interact strongly with the interpreter. Dynamic objects: argv -- command line arguments; argv[0] is the script pathname if known path -- module search path; path[0] is the script directory, else '' modules -- dictionary of loaded modules displayhook -- called to show results in an interactive session excepthook -- called to handle any uncaught exception other than SystemExit To customize printing in an interactive session or to install a custom top-level exception handler, assign other functions to replace these. stdin -- standard input file object; used by input() stdout -- standard output file object; used by print() stderr -- standard error object; used for error messages By assigning other file objects (or objects that behave like files) to these, it is possible to redirect all of the interpreter's I/O. last_type -- type of last uncaught exception last_value -- value of last uncaught exception last_traceback -- traceback of last uncaught exception These three are only available in an interactive session after a traceback has been printed. Static objects: builtin_module_names -- tuple of module names built into this interpreter copyright -- copyright notice pertaining to this interpreter exec_prefix -- prefix used to find the machine-specific Python library executable -- absolute path of the executable binary of the Python interpreter float_info -- a named tuple with information about the float implementation. float_repr_style -- string indicating the style of repr() output for floats hash_info -- a named tuple with information about the hash algorithm. hexversion -- version information encoded as a single integer implementation -- Python implementation information. int_info -- a named tuple with information about the int implementation. maxsize -- the largest supported length of containers. maxunicode -- the value of the largest Unicode code point platform -- platform identifier prefix -- prefix used to find the Python library thread_info -- a named tuple with information about the thread implementation. version -- the version of this interpreter as a string version_info -- version information as a named tuple __stdin__ -- the original stdin; don't touch! __stdout__ -- the original stdout; don't touch! __stderr__ -- the original stderr; don't touch! __displayhook__ -- the original displayhook; don't touch! __excepthook__ -- the original excepthook; don't touch! Functions: displayhook() -- print an object to the screen, and save it in builtins._ excepthook() -- print an exception and its traceback to sys.stderr exc_info() -- return thread-safe information about the current exception exit() -- exit the interpreter by raising SystemExit getdlopenflags() -- returns flags to be used for dlopen() calls getprofile() -- get the global profiling function getrefcount() -- return the reference count for an object (plus one :-) getrecursionlimit() -- return the max recursion depth for the interpreter getsizeof() -- return the size of an object in bytes gettrace() -- get the global debug tracing function setcheckinterval() -- control how often the interpreter checks for events setdlopenflags() -- set the flags to be used for dlopen() calls setprofile() -- set the global profiling function setrecursionlimit() -- set the max recursion depth for the interpreter settrace() -- set the global debug tracing function _PySys_Create_PySys_SetPreliminaryStderr_PySys_InitCore_Py_HashRandomization_Init During handling of the above exception, another exception occurred: The above exception was the direct cause of the following exception: _PyInterpreterState_Enable_PyRuntimeState_Init_implPy_InitializeFromConfig_Py_PreInitializeFromPyArgvPython detected LC_CTYPE=C: LC_CTYPE coerced to %.20s (set another locale or PYTHONCOERCECLOCALE=0 to disable this locale coercion behavior). pyinit_mainnew_interpreterinit_importlib_externalinit_import_sizepycore_init_import_warningsinit_importlibpyinit_core_reconfigurepycore_init_builtinspycore_init_typespycore_create_interpreterpycore_init_runtimeinit_sys_streamsadd_main_module_Py_ReconfigureMainInterpreter  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~_PyPreConfig_Write_PyPreConfig_Readpreconfig_init_utf8_modepreconfig_init_allocator_PyArgv_AsWstrList_PyConfig_InitPathConfigconfig_calculate_pathconfigpathconfig_copypathconfig_set_from_configconfig_init_module_search_pathsUUUUUUUU?33333333*$I$I$qqqE]tEUUUUUUU;;I$I$I8885P^Cy 0 0 0 袋. ,d! p= ףp= ؉؉ %^B{ $I$I$ =B!B|PuPuPqq@(  loads($module, bytes, /) -- Convert the bytes-like object to a value. If no valid value is found, raise EOFError, ValueError or TypeError. Extra bytes in the input are ignored.dumps($module, value, version=version, /) -- Return the bytes object that would be written to a file by dump(value, file). value Must be a supported type. version Indicates the data format that dumps should use. Raise a ValueError exception if value has (or contains an object that has) an unsupported type.load($module, file, /) -- Read one value from the open file and return it. file Must be readable binary file. If no valid value is read (e.g. because the data has a different Python version's incompatible marshal format), raise EOFError, ValueError or TypeError. Note: If an object containing an unsupported type was marshalled with dump(), load() will substitute None for the unmarshallable type.dump($module, value, file, version=version, /) -- Write the value on the open file. value Must be a supported type. file Must be a writeable binary file. version Indicates the data format that dump should use. If the value has (or contains an object that has) an unsupported type, a ValueError exception is raised - but garbage data will also be written to the file. The object will not be properly read back by load().This module contains functions that can read and write Python values in a binary format. The format is specific to Python, but independent of machine architecture issues. Not all Python object types are supported; in general, only objects whose value is independent from a particular invocation of Python can be written and read by this module. The following types are supported: None, integers, floating point numbers, strings, bytes, bytearrays, tuples, lists, sets, dictionaries, and code objects, where it should be understood that tuples, lists and dictionaries are only supported as long as the values contained therein are themselves supported; and recursive lists and dictionaries should not be written (they will cause infinite loops). Variables: version -- indicates the format that the module uses. Version 0 is the historical format, version 1 shares interned strings and version 2 uses a binary format for floating point numbers. Version 3 shares common object references (New in version 3.4). Functions: dump() -- write value to a file load() -- read value from a file dumps() -- marshal value as a bytes object loads() -- read value from a bytes-like objectPyConfig_ReadPyConfig_SetWideStringList_PyConfig_Copyconfig_init_program_nameconfig_init_stdio_encodingconfig_parse_cmdlinePyConfig_SetStringconfig_update_argvPyWideStringList_Insertcore_read_precmdlineconfig_get_locale_encodingconfig_init_pycache_prefixconfig_init_tracemallocconfig_init_int_max_str_digitsconfig_init_hash_seedPYTHONHASHSEED: if this variable is set to 'random', a random value is used to seed the hashes of str and bytes objects. It can also be set to an integer in the range [0,4294967295] to get hash values with a predictable seed. PYTHONINTMAXSTRDIGITS: limits the maximum digit characters in an int value when converting from a string and when converting an int back to a str. A value of 0 disables the limit. Conversions to or from bases 2, 4, 8, 16, and 32 are never limited. PYTHONMALLOC: set the Python memory allocators and/or install debug hooks on Python memory allocators. Use PYTHONMALLOC=debug to install debug hooks. PYTHONCOERCECLOCALE: if this variable is set to 0, it disables the locale coercion behavior. Use PYTHONCOERCECLOCALE=warn to request display of locale coercion and locale compatibility warnings on stderr. PYTHONBREAKPOINT: if this variable is set to 0, it disables the default debugger. It can be set to the callable of your debugger of choice. PYTHONDEVMODE: enable the development mode. PYTHONPYCACHEPREFIX: root directory for bytecode cache (pyc) files. PYTHONHOME : alternate directory (or %lc). The default module search path uses %s. PYTHONCASEOK : ignore case in 'import' statements (Windows). PYTHONUTF8: if set to 1, enable the UTF-8 mode. PYTHONIOENCODING: Encoding[:errors] used for stdin/stdout/stderr. PYTHONFAULTHANDLER: dump the Python traceback on fatal errors. file : program read from script file - : program read from stdin (default; interactive mode if a tty) arg ...: arguments passed to program in sys.argv[1:] Other environment variables: PYTHONSTARTUP: file executed on interactive startup (no default) PYTHONPATH : '%lc'-separated list of directories prefixed to the default module search path. The result is sys.path. -u : force the stdout and stderr streams to be unbuffered; this option has no effect on stdin; also PYTHONUNBUFFERED=x -v : verbose (trace import statements); also PYTHONVERBOSE=x can be supplied multiple times to increase verbosity -V : print the Python version number and exit (also --version) when given twice, print more information about the build -W arg : warning control; arg is action:message:category:module:lineno also PYTHONWARNINGS=arg -x : skip first line of source, allowing use of non-Unix forms of #!cmd -X opt : set implementation-specific option. The following options are available: -X faulthandler: enable faulthandler -X showrefcount: output the total reference count and number of used memory blocks when the program finishes or after each statement in the interactive interpreter. This only works on debug builds -X tracemalloc: start tracing Python memory allocations using the tracemalloc module. By default, only the most recent frame is stored in a traceback of a trace. Use -X tracemalloc=NFRAME to start tracing with a traceback limit of NFRAME frames -X showalloccount: output the total count of allocated objects for each type when the program finishes. This only works when Python was built with COUNT_ALLOCS defined -X importtime: show how long each import takes. It shows module name, cumulative time (including nested imports) and self time (excluding nested imports). Note that its output may be broken in multi-threaded application. Typical usage is python3 -X importtime -c 'import asyncio' -X dev: enable CPython's "development mode", introducing additional runtime checks which are too expensive to be enabled by default. Effect of the developer mode: * Add default warning filter, as -W default * Install debug hooks on memory allocators: see the PyMem_SetupDebugHooks() C function * Enable the faulthandler module to dump the Python traceback on a crash * Enable asyncio debug mode * Set the dev_mode attribute of sys.flags to True * io.IOBase destructor logs close() exceptions -X utf8: enable UTF-8 mode for operating system interfaces, overriding the default locale-aware mode. -X utf8=0 explicitly disables UTF-8 mode (even when it would otherwise activate automatically) -X pycache_prefix=PATH: enable writing .pyc files to a parallel tree rooted at the given directory instead of to the code tree -X int_max_str_digits=number: limit the size of int<->str conversions. This helps avoid denial of service attacks when parsing untrusted data. The default is sys.int_info.default_max_str_digits. 0 disables. --check-hash-based-pycs always|default|never: control how Python invalidates hash-based .pyc files -i : inspect interactively after running script; forces a prompt even if stdin does not appear to be a terminal; also PYTHONINSPECT=x -I : isolate Python from the user's environment (implies -E and -s) -m mod : run library module as a script (terminates option list) -O : remove assert and __debug__-dependent statements; add .opt-1 before .pyc extension; also PYTHONOPTIMIZE=x -OO : do -O changes and also discard docstrings; add .opt-2 before .pyc extension -q : don't print version and copyright messages on interactive startup -s : don't add user site directory to sys.path; also PYTHONNOUSERSITE -S : don't imply 'import site' on initialization Options and arguments (and corresponding environment variables): -b : issue warnings about str(bytes_instance), str(bytearray_instance) and comparing bytes/bytearray with str. (-bb: issue errors) -B : don't write .pyc files on import; also PYTHONDONTWRITEBYTECODE=x -c cmd : program passed in as string (terminates option list) -d : debug output from parser; also PYTHONDEBUG=x -E : ignore PYTHON* environment variables (such as PYTHONPATH) -h : print this help message and exit (also --help) usage: %ls [option] ... [-c cmd | -m mod | file | -] [arg] ... config_set_bytes_stringsource_hash($module, /, key, source) -- _fix_co_filename($module, code, path, /) -- Changes code.co_filename to specify the passed-in file path. code Code object to change. path File path to use.exec_builtin($module, mod, /) -- Initialize a built-in module.exec_dynamic($module, mod, /) -- Initialize an extension module.create_dynamic($module, spec, file=, /) -- Create an extension module.is_frozen($module, name, /) -- Returns True if the module name corresponds to a frozen module.is_builtin($module, name, /) -- Returns True if the module name corresponds to a built-in module.init_frozen($module, name, /) -- Initializes a frozen module.create_builtin($module, spec, /) -- Create an extension module.is_frozen_package($module, name, /) -- Returns True if the module name is of a frozen package.get_frozen_object($module, name, /) -- Create a code object for a frozen module.release_lock($module, /) -- Release the interpreter's import lock. On platforms without threads, this function does nothing.acquire_lock($module, /) -- Acquires the interpreter's import lock for the current thread. This lock should be used by import hooks to ensure thread-safety when importing modules. On platforms without threads, this function does nothing.lock_held($module, /) -- Return True if the import lock is currently held, else False. On platforms without threads, return False.extension_suffixes($module, /) -- Returns the list of file suffixes used to identify extension modules.(Extremely) low-level import machinery bits as used by importlib and imp._PyImportZip_Init_PyImportHooks_Init_PyImport_Init,-,/2231 0067848&>;=><:;9(22?<&B%C)=(@A('B%=&@='A(%<B=#!@A"B%=A&!BC$= @A <#!@="AB=@=A <BC=AB=ABC=@A@=AB=@=A<B= @DABB=A = BC= @A < @D=AB =B=@= A BC =AB=A@A<;(<BC! B@F <BBFBC<@FB@F<BCBFBC@FB@F<B B BF BC <  @D FB B@F BCFBF@F(GHGIJKLMNOPC=/TQTCRSQQTC<;U<BU<VWXYZ[\]^_`abcdefghQT<<ijk2mml 1l 1(o((o1nBnBpl(B(B(<B<q75r8stuvr8v&x;yzx;wx;zx;w! x ; zx=x;/{c| x ; z |} x x;;|}x; x=xB;~"o<(o<--<<<z;<;E;;E{{D %@'2*2T    $()*BwUBwU2(23lB;<;<<;UBU<B<< B ;  B @ < <U < BB;B@U<2;x23;(BC<@<{c&(#<Q--=,<2:2B @< B < @<B@<B<B<@<{@ @{ @@@*G {{@ z z @{{{ @ @{@Copyright (c) 2001-2023 Python Software Foundation. All Rights Reserved. Copyright (c) 2000 BeOpen.com. All Rights Reserved. Copyright (c) 1995-2001 Corporation for National Research Initiatives. All Rights Reserved. Copyright (c) 1991-1995 Stichting Mathematisch Centrum, Amsterdam. All Rights Reserved.UnraisableHookArgs Type used to pass arguments to sys.unraisablehook._PyErr_Initcopy($self, /) -- Return a shallow copy of the context object.values($self, /) -- Return a list of all variables' values in the context object.keys($self, /) -- Return a list of all variables in the context object.items($self, /) -- Return all variables and their values in the context object. The result is returned as a list of 2-tuples (variable, value).get($self, key, default=None, /) -- Return the value for `key` if `key` has the value in the context object. If `key` does not exist, return `default`. If `default` is not given, return None.reset($self, token, /) -- Reset the context variable. The variable is reset to the value it had before the `ContextVar.set()` that created the token was used.set($self, value, /) -- Call to set a new value for the context variable in the current context. The required value argument is the new value for the context variable. Returns a Token object that can be used to restore the variable to its previous value via the `ContextVar.reset()` method.get($self, default=, /) -- Return a value for the context variable for the current context. If there is no value for the variable in the current context, the method will: * return the value of the default argument of the method, if provided; or * return the default value for the context variable, if it was created with one; or * raise a LookupError. |}~789;CKLONM >?BA@filter(function or None, iterable) --> filter object Return an iterator yielding those items of iterable for which function(item) is true. If function is None, return the items that are true.map(func, *iterables) --> map object Make an iterator that computes the function using arguments from each of the iterables. Stops when the shortest iterable is exhausted.Return state information for pickling.zip(*iterables) --> A zip object yielding tuples until an input is exhausted. >>> list(zip('abcdefg', range(3), range(4))) [('a', 0, 0), ('b', 1, 1), ('c', 2, 2)] The zip object yields n-length tuples, where n is the number of iterables passed as positional arguments to zip(). The i-th element in every tuple comes from the i-th iterable argument to zip(). This continues until the shortest argument is exhausted.vars([object]) -> dictionary Without arguments, equivalent to locals(). With an argument, equivalent to object.__dict__.sum($module, iterable, /, start=0) -- Return the sum of a 'start' value (default: 0) plus an iterable of numbers When the iterable is empty, return the start value. This function is intended specifically for use with numeric values and may reject non-numeric types.sorted($module, iterable, /, *, key=None, reverse=False) -- Return a new list containing all items from the iterable in ascending order. A custom key function can be supplied to customize the sort order, and the reverse flag can be set to request the result in descending order.setattr($module, obj, name, value, /) -- Sets the named attribute on the given object to the specified value. setattr(x, 'y', v) is equivalent to ``x.y = v''round($module, /, number, ndigits=None) -- Round a number to a given precision in decimal digits. The return value is an integer if ndigits is omitted or None. Otherwise the return value has the same type as the number. ndigits may be negative.repr($module, obj, /) -- Return the canonical string representation of the object. For many object types, including most builtins, eval(repr(obj)) == obj.print(value, ..., sep=' ', end='\n', file=sys.stdout, flush=False) Prints the values to a stream, or to sys.stdout by default. Optional keyword arguments: file: a file-like object (stream); defaults to the current sys.stdout. sep: string inserted between values, default a space. end: string appended after the last value, default a newline. flush: whether to forcibly flush the stream.pow($module, /, base, exp, mod=None) -- Equivalent to base**exp with 2 arguments or base**exp % mod with 3 arguments Some types, such as ints, are able to use a more efficient algorithm when invoked using the three argument form.ord($module, c, /) -- Return the Unicode code point for a one-character string.oct($module, number, /) -- Return the octal representation of an integer. >>> oct(342391) '0o1234567'next(iterator[, default]) Return the next item from the iterator. If default is given and the iterator is exhausted, it is returned instead of raising StopIteration.min(iterable, *[, default=obj, key=func]) -> value min(arg1, arg2, *args, *[, key=func]) -> value With a single iterable argument, return its smallest item. The default keyword-only argument specifies an object to return if the provided iterable is empty. With two or more arguments, return the smallest argument.max(iterable, *[, default=obj, key=func]) -> value max(arg1, arg2, *args, *[, key=func]) -> value With a single iterable argument, return its biggest item. The default keyword-only argument specifies an object to return if the provided iterable is empty. With two or more arguments, return the largest argument.locals($module, /) -- Return a dictionary containing the current scope's local variables. NOTE: Whether or not updates to this dictionary will affect name lookups in the local scope and vice-versa is *implementation dependent* and not covered by any backwards compatibility guarantees.len($module, obj, /) -- Return the number of items in a container.iter(iterable) -> iterator iter(callable, sentinel) -> iterator Get an iterator from an object. In the first form, the argument must supply its own iterator, or be a sequence. In the second form, the callable is called until it returns the sentinel.issubclass($module, cls, class_or_tuple, /) -- Return whether 'cls' is a derived from another class or is the same class. A tuple, as in ``issubclass(x, (A, B, ...))``, may be given as the target to check against. This is equivalent to ``issubclass(x, A) or issubclass(x, B) or ...`` etc.isinstance($module, obj, class_or_tuple, /) -- Return whether an object is an instance of a class or of a subclass thereof. A tuple, as in ``isinstance(x, (A, B, ...))``, may be given as the target to check against. This is equivalent to ``isinstance(x, A) or isinstance(x, B) or ...`` etc.input($module, prompt=None, /) -- Read a string from standard input. The trailing newline is stripped. The prompt string, if given, is printed to standard output without a trailing newline before reading input. If the user hits EOF (*nix: Ctrl-D, Windows: Ctrl-Z+Return), raise EOFError. On *nix systems, readline is used if available.id($module, obj, /) -- Return the identity of an object. This is guaranteed to be unique among simultaneously existing objects. (CPython uses the object's memory address.)hex($module, number, /) -- Return the hexadecimal representation of an integer. >>> hex(12648430) '0xc0ffee'hash($module, obj, /) -- Return the hash value for the given object. Two objects that compare equal must also have the same hash value, but the reverse is not necessarily true.hasattr($module, obj, name, /) -- Return whether the object has an attribute with the given name. This is done by calling getattr(obj, name) and catching AttributeError.globals($module, /) -- Return the dictionary containing the current scope's global variables. NOTE: Updates to this dictionary *will* affect name lookups in the current global scope and vice-versa.getattr(object, name[, default]) -> value Get a named attribute from an object; getattr(x, 'y') is equivalent to x.y. When a default argument is given, it is returned when the attribute doesn't exist; without it, an exception is raised in that case.format($module, value, format_spec='', /) -- Return value.__format__(format_spec) format_spec defaults to the empty string. See the Format Specification Mini-Language section of help('FORMATTING') for details.exec($module, source, globals=None, locals=None, /) -- Execute the given source in the context of globals and locals. The source may be a string representing one or more Python statements or a code object as returned by compile(). The globals must be a dictionary and locals can be any mapping, defaulting to the current globals and locals. If only globals is given, locals defaults to it.eval($module, source, globals=None, locals=None, /) -- Evaluate the given source in the context of globals and locals. The source may be a string representing a Python expression or a code object as returned by compile(). The globals must be a dictionary and locals can be any mapping, defaulting to the current globals and locals. If only globals is given, locals defaults to it.divmod($module, x, y, /) -- Return the tuple (x//y, x%y). Invariant: div*y + mod == x.dir([object]) -> list of strings If called without an argument, return the names in the current scope. Else, return an alphabetized list of names comprising (some of) the attributes of the given object, and of attributes reachable from it. If the object supplies a method named __dir__, it will be used; otherwise the default dir() logic is used and returns: for a module object: the module's attributes. for a class object: its attributes, and recursively the attributes of its bases. for any other object: its attributes, its class's attributes, and recursively the attributes of its class's base classes.delattr($module, obj, name, /) -- Deletes the named attribute from the given object. delattr(x, 'y') is equivalent to ``del x.y''compile($module, /, source, filename, mode, flags=0, dont_inherit=False, optimize=-1, *, _feature_version=-1) -- Compile source into a code object that can be executed by exec() or eval(). The source code may represent a Python module, statement or expression. The filename will be used for run-time error messages. The mode must be 'exec' to compile a module, 'single' to compile a single (interactive) statement, or 'eval' to compile an expression. The flags argument, if present, controls which future statements influence the compilation of the code. The dont_inherit argument, if true, stops the compilation inheriting the effects of any future statements in effect in the code calling compile; if absent or false these statements do influence the compilation, in addition to any features explicitly specified.chr($module, i, /) -- Return a Unicode string of one character with ordinal i; 0 <= i <= 0x10ffff.callable($module, obj, /) -- Return whether the object is callable (i.e., some kind of function). Note that classes are callable, as are instances of classes with a __call__() method.breakpoint(*args, **kws) Call sys.breakpointhook(*args, **kws). sys.breakpointhook() must accept whatever arguments are passed. By default, this drops you into the pdb debugger.bin($module, number, /) -- Return the binary representation of an integer. >>> bin(2796202) '0b1010101010101010101010'ascii($module, obj, /) -- Return an ASCII-only representation of an object. As repr(), return a string containing a printable representation of an object, but escape the non-ASCII characters in the string returned by repr() using \\x, \\u or \\U escapes. This generates a string similar to that returned by repr() in Python 2.any($module, iterable, /) -- Return True if bool(x) is True for any x in the iterable. If the iterable is empty, return False.all($module, iterable, /) -- Return True if bool(x) is True for all values x in the iterable. If the iterable is empty, return True.abs($module, x, /) -- Return the absolute value of the argument.__import__(name, globals=None, locals=None, fromlist=(), level=0) -> module Import a module. Because this function is meant for use by the Python interpreter and not for general use, it is better to use importlib.import_module() to programmatically import a module. The globals argument is only used to determine the context; they are not modified. The locals argument is unused. The fromlist should be a list of names to emulate ``from name import ...'', or an empty list to emulate ``import name''. When importing a module from a package, note that __import__('A.B', ...) returns package A when fromlist is empty, but its submodule B when fromlist is not empty. The level argument is used to determine whether to perform absolute or relative imports: 0 is absolute, while a positive number is the number of parent directories to search relative to the current module.__build_class__(func, name, /, *bases, [metaclass], **kwds) -> class Internal helper function used by the class statement.Built-in functions, exceptions, and other objects. Noteworthy: None is the `nil' object; Ellipsis represents `...' in slices. 26789<=>?@ABCDE_warnings provides basic warning filtering support. It is a helper module to speed up interpreter start-up.Low-level interface to warnings functionality.warn($module, /, message, category=None, stacklevel=1, source=None) -- Issue a warning, or maybe ignore it or raise an exception.ssSSSsi0InNsSj J Ee5R5pqrstuvwxyz{|}~24>A!B"B"J*cbKJh1H1tTw W y Y aAa`ssPRTVBB           (!)"*#+$,%-&.'/ (!)"*#+$,%-&.'/`haibjckdlemfngo`haibjckdlemfngopEEBBBBBEtEEBBBBBEBBBBBBBB|EEBBBBBEpqrstuvwxyz{|}~ffFFFffiFIFiflFLFlffiFFIFfifflFFLFflstSTStstSTSttvDFDvteD5DetkD;Dk~vNFNvtmD=Dm 0   ' ' '   g   gyy '' '   g '  g' g ''''O''''aa ''' '' '''''88 ''A' ' '  g''~'+*']'(*'?*?* '='E'G'** '** '** '.. '22 '33 '66 '55 'OO 'KK '11 '(( 'DD '// '-- ')) 'AA ')) '++ '** ')) '&& 'CC '** ' ''' ' '%% ' ' ' 7v 4t'&'%'@'?'!0! g ' '($0( g-+- g ' ''0.0 g313 g'646 g979 g '<:< g?=? g ' ''B@B g'P' '' '0' 'FC H g`' ' LJLgOMOgRPRgUSUgXVXg[Y[g^\^ga_agdbdggeggjhjgmkmgpnpgsqsgvtvgywyg|z|g}gggggggggggggggggggggggggggggggggggggggggggggg  g   g gggggg!!g$"$g'%'g*(*g-+-g0.0g313g646g979g<:<g?=?gB@BgECEgHFHgKIKgNLN gQOQ gTRT gWUW gZXZ g][] g`^` gcac gfdf gigi gljl gomo grpr gusu gxvx g@' ' '88 '|y | g~  g  g  g  g g g ''  g0 g0 g0 gJJ 'VV 'dd ' 'pp '~~ '  g  g  g  g  g  g  g  g Ag Ag Ag Ag Ag Ag   Ag  Ag  g  g" $ g(% * g.+ 0 g41 6 g:7 < g@= B gFC HAgLI NAgRO TAgXU ZAg^[ `Agda fAgjg lAgpm rAgvs x g|y ~ g  g  g  g  g  g  g Ag Ag Ag Ag Ag Ag Ag Ag  g  g  g  g0 g' Ag g  g    g   g  g0 g'%" 'Ag,(0, g3/03 g96 9 g?;0? g'FB0F gMI0M gSP S gXU X g^Z0^ g'da f gkh m gqn s gxu x g~z0 g'' Ag       'A''' '//$$ ''' ' '''''' 'u'Z'00 'Z'Z'Z'Z'Z'Z'Z'''Z'u'`` ' g g g g g g g g g g g g g g g g g g g g g g g g g g g g g g g g g g g g g g g g g g   g    g g g g g g g" " g%#% g(&( g+)+ g.,. g1/1 g424 g757 g:8: g=;= g@>@ gCAC gFDF gIGI gLJL gOMO gRPR gUSU gXVX g[Y[ g^\^ ga_a gdbd ggeg gjhj gmkm gpnp gsqs gvtv gywy g}z  g  g  g0 g0 g  g  g  g  g  g  g  g(' '"' '$  !"#$%&'(()*+(,-./0.1234445567877779:;9:;9:;<=9:;>?@ABCDDEFGHIJKLMMNOPMQRSTUVTWXVYZ[\]^]_]`aabc7defffffffffgggggggffggggggggggggfffffgghgi222jklllmnnopqqqrstuuvwxyyyz{|}~@@@g777777777777777777777777777777777777777777777777777777777777777g7777777777 777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777gg77 77777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777 777777777777777777777777777777777ggg7777777777777777777777ggg77777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777 g777777777777777777777777777777777777777777777777777777777777777777 777777777777777777777777777777777777777777777777777 7777777777777777777777777777777777777777777777777777777 77777777777777777777777777777777777777777777777777777 77777777777777777777777777777777777777 77777777777777777777777777777777777777777777777777777777 777777777777777777777777777777777777777777777777777777 77777777777777777777777777777777777777777777777777777777777777 77777777777777777777777777777777777777777777777777777777777777777 7777777777777777777777777777777777777777777777777777777g 77777777777777777777777777777777777777777777777777g 77777 777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777 777777777777777777777777777777 g77777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777g7  77777777777777777777777777777777777g77777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777 777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777 7777777777777777777777777777777777777777777777777777777777777777777777777777  g777777777777777777777777777777777777777777777777777777 77777777777777777777777777777777 77777777777777777777777777777777777777777777777777777777777777777777777777777777 777 777777777777777777777777777777gggggg7777777777777fffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffff                                                                                                    !"#$%&'()*+,-./0123456789:;<=>?@ABCD  EFGHI  JJKLMNOPQRRRRS  TUVW  XX  YZ[\]  ^^_`abcddeefgfhijklmfghijklmfffffffffffffyyyyyyyyynyyyyyyoypqyynyyry7777yyysttttttttttttttttuuuuuuuuuuuuuuuuhijklmhijklmhijklmvvvvvvvvvvvvvvvvvvvvvvvvvvwwwwwwwwwwwwwwwwwwwwwwwwwwghijklmghijklmhijklmhijklmxyz{|}~ff77777777777777777777777777777777777777777777777777777777g7777777777777777777777777777777777777777777777777777777777777777777777777777777g7gggggg777777777777777777777777777777777777777777777777777777777777777777777777777777777777777gg7777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777ggg77777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777g777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777gggggg777777777777g7777777777777777 777gff7777777777777777777777777777777777777777777777777777777777777777777777gggggggggfg77ff7777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777 777777777 7777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777g 77777g777777777 777777777777777777777777777777777777777777777777777777777 7777777777777777g777777777777777777777777777777777777777777777777777777777777777777777g777777777777gg77777777777777777777777777777777ffff77777777777777777777777777777777777 7777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777 7777777777g777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777 7777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777h7777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777mmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmttttttttttttttttttttttttttttttttttttttttttttttttttt777777777777777777777777777777777777 hijklm77777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777hijklm 7777777777777777777777777777777777777777777777777777777777777777777777 777777777777777777777777777777777777 77777777777777777777777777777777777777777777777777777777777777777777777777777777777777777 777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777 77777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777 7777777777777777777777777777777777777777777777777777 7777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777 77777777777777777777777777777777777777777777 777777777777777777777777777 77777777777777777777777777777777777777777777 7777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777 777777777777777777777777777777777777777777777777777777777777777777777777777777 77777777777777777777777777777777777777777 7777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777 777777777777777777777777777777777777777777777777777777777777777777777777777777gggg 77777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777gggggggggggggggg777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777yyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyy     777777777777777777777777777777777777777777777ggggggg 777777777777777777777777777777777777777777777 777777777777777777777777777777777777777777777777777777777777777777777g 777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777gghijklm7777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777  !""#$%&'"""()*+,-./0123456789:;<=>?@@@@AB@@@@CD@@@@@@EFGHIJKL@MNOPQRS@@TU""""""V"""""W""""""""""""""""""""""""""""""""""""XYZ["""\"""]^"""""_"""`""""""""""abc""""""de""""""""f""""""""""""""g""""""""h""""d""""""""""""""""""""g""""""i""""""""""""""""jk"""""""""""""""""lm"""""""""""""""""no""""""""p""qrstuvwxyz{|"""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""}~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~"""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""@@@@@"@@@@@@"""""""""""""""V""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""    ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ __sizeof__($self, /) -- Return the size of the string in memory, in bytes.maketrans(x, y=, z=, /) -- Return a translation table usable for str.translate(). If there is only one argument, it must be a dictionary mapping Unicode ordinals (integers) or characters to Unicode ordinals, strings or None. Character keys will be then converted to ordinals. If there are two arguments, they must be strings of equal length, and in the resulting dictionary, each character in x will be mapped to the character at the same position in y. If there is a third argument, it must be a string, whose characters will be mapped to None in the result.__format__($self, format_spec, /) -- Return a formatted version of the string as described by format_spec.S.format_map(mapping) -> str Return a formatted version of S, using substitutions from mapping. The substitutions are identified by braces ('{' and '}').S.format(*args, **kwargs) -> str Return a formatted version of S, using substitutions from args and kwargs. The substitutions are identified by braces ('{' and '}').zfill($self, width, /) -- Pad a numeric string with zeros on the left, to fill a field of the given width. The string is never truncated.isprintable($self, /) -- Return True if the string is printable, False otherwise. A string is printable if all of its characters are considered printable in repr() or if it is empty.isidentifier($self, /) -- Return True if the string is a valid Python identifier, False otherwise. Call keyword.iskeyword(s) to test whether string s is a reserved identifier, such as "def" or "class".isalnum($self, /) -- Return True if the string is an alpha-numeric string, False otherwise. A string is alpha-numeric if all characters in the string are alpha-numeric and there is at least one character in the string.isalpha($self, /) -- Return True if the string is an alphabetic string, False otherwise. A string is alphabetic if all characters in the string are alphabetic and there is at least one character in the string.isnumeric($self, /) -- Return True if the string is a numeric string, False otherwise. A string is numeric if all characters in the string are numeric and there is at least one character in the string.isdigit($self, /) -- Return True if the string is a digit string, False otherwise. A string is a digit string if all characters in the string are digits and there is at least one character in the string.isdecimal($self, /) -- Return True if the string is a decimal string, False otherwise. A string is a decimal string if all characters in the string are decimal and there is at least one character in the string.isspace($self, /) -- Return True if the string is a whitespace string, False otherwise. A string is whitespace if all characters in the string are whitespace and there is at least one character in the string.istitle($self, /) -- Return True if the string is a title-cased string, False otherwise. In a title-cased string, upper- and title-case characters may only follow uncased characters and lowercase characters only cased ones.isupper($self, /) -- Return True if the string is an uppercase string, False otherwise. A string is uppercase if all cased characters in the string are uppercase and there is at least one cased character in the string.islower($self, /) -- Return True if the string is a lowercase string, False otherwise. A string is lowercase if all cased characters in the string are lowercase and there is at least one cased character in the string.isascii($self, /) -- Return True if all characters in the string are ASCII, False otherwise. ASCII characters have code points in the range U+0000-U+007F. Empty string is ASCII too.S.endswith(suffix[, start[, end]]) -> bool Return True if S ends with the specified suffix, False otherwise. With optional start, test S beginning at that position. With optional end, stop comparing S at that position. suffix can also be a tuple of strings to try.S.startswith(prefix[, start[, end]]) -> bool Return True if S starts with the specified prefix, False otherwise. With optional start, test S beginning at that position. With optional end, stop comparing S at that position. prefix can also be a tuple of strings to try.upper($self, /) -- Return a copy of the string converted to uppercase.translate($self, table, /) -- Replace each character in the string using the given translation table. table Translation table, which must be a mapping of Unicode ordinals to Unicode ordinals, strings, or None. The table must implement lookup/indexing via __getitem__, for instance a dictionary or list. If this operation raises LookupError, the character is left untouched. Characters mapped to None are deleted.swapcase($self, /) -- Convert uppercase characters to lowercase and lowercase characters to uppercase.strip($self, chars=None, /) -- Return a copy of the string with leading and trailing whitespace removed. If chars is given and not None, remove characters in chars instead.splitlines($self, /, keepends=False) -- Return a list of the lines in the string, breaking at line boundaries. Line breaks are not included in the resulting list unless keepends is given and true.rpartition($self, sep, /) -- Partition the string into three parts using the given separator. This will search for the separator in the string, starting at the end. If the separator is found, returns a 3-tuple containing the part before the separator, the separator itself, and the part after it. If the separator is not found, returns a 3-tuple containing two empty strings and the original string.rstrip($self, chars=None, /) -- Return a copy of the string with trailing whitespace removed. If chars is given and not None, remove characters in chars instead.rjust($self, width, fillchar=' ', /) -- Return a right-justified string of length width. Padding is done using the specified fill character (default is a space).S.rindex(sub[, start[, end]]) -> int Return the highest index in S where substring sub is found, such that sub is contained within S[start:end]. Optional arguments start and end are interpreted as in slice notation. Raises ValueError when the substring is not found.S.rfind(sub[, start[, end]]) -> int Return the highest index in S where substring sub is found, such that sub is contained within S[start:end]. Optional arguments start and end are interpreted as in slice notation. Return -1 on failure.lstrip($self, chars=None, /) -- Return a copy of the string with leading whitespace removed. If chars is given and not None, remove characters in chars instead.lower($self, /) -- Return a copy of the string converted to lowercase.ljust($self, width, fillchar=' ', /) -- Return a left-justified string of length width. Padding is done using the specified fill character (default is a space).S.index(sub[, start[, end]]) -> int Return the lowest index in S where substring sub is found, such that sub is contained within S[start:end]. Optional arguments start and end are interpreted as in slice notation. Raises ValueError when the substring is not found.partition($self, sep, /) -- Partition the string into three parts using the given separator. This will search for the separator in the string. If the separator is found, returns a 3-tuple containing the part before the separator, the separator itself, and the part after it. If the separator is not found, returns a 3-tuple containing the original string and two empty strings.S.find(sub[, start[, end]]) -> int Return the lowest index in S where substring sub is found, such that sub is contained within S[start:end]. Optional arguments start and end are interpreted as in slice notation. Return -1 on failure.expandtabs($self, /, tabsize=8) -- Return a copy where all tab characters are expanded using spaces. If tabsize is not given, a tab size of 8 characters is assumed.S.count(sub[, start[, end]]) -> int Return the number of non-overlapping occurrences of substring sub in string S[start:end]. Optional arguments start and end are interpreted as in slice notation.center($self, width, fillchar=' ', /) -- Return a centered string of length width. Padding is done using the specified fill character (default is a space).title($self, /) -- Return a version of the string where each word is titlecased. More specifically, words start with uppercased characters and all remaining cased characters have lower case.casefold($self, /) -- Return a version of the string suitable for caseless comparisons.capitalize($self, /) -- Return a capitalized version of the string. More specifically, make the first character have upper case and the rest lower case.join($self, iterable, /) -- Concatenate any number of strings. The string whose method is called is inserted in between each given string. The result is returned as a new string. Example: '.'.join(['ab', 'pq', 'rs']) -> 'ab.pq.rs'rsplit($self, /, sep=None, maxsplit=-1) -- Return a list of the words in the string, using sep as the delimiter string. sep The delimiter according which to split the string. None (the default value) means split according to any whitespace, and discard empty strings from the result. maxsplit Maximum number of splits to do. -1 (the default value) means no limit. Splits are done starting at the end of the string and working to the front.split($self, /, sep=None, maxsplit=-1) -- Return a list of the words in the string, using sep as the delimiter string. sep The delimiter according which to split the string. None (the default value) means split according to any whitespace, and discard empty strings from the result. maxsplit Maximum number of splits to do. -1 (the default value) means no limit.replace($self, old, new, count=-1, /) -- Return a copy with all occurrences of substring old replaced by new. count Maximum number of occurrences to replace. -1 (the default value) means replace all occurrences. If the optional argument count is given, only the first count occurrences are replaced.encode($self, /, encoding='utf-8', errors='strict') -- Encode the string using the codec registered for encoding. encoding The encoding in which to encode the string. errors The error handling scheme to use for encoding errors. The default is 'strict' meaning that encoding errors raise a UnicodeEncodeError. Other possible values are 'ignore', 'replace' and 'xmlcharrefreplace' as well as any other name registered with codecs.register_error that can handle UnicodeEncodeErrors.str(object='') -> str str(bytes_or_buffer[, encoding[, errors]]) -> str Create a new string object from the given object. If encoding or errors is specified, then the object must expose a data buffer that will be decoded using the given encoding and error handler. Otherwise, returns the result of object.__str__() (if defined) or repr(object). encoding defaults to sys.getdefaultencoding(). errors defaults to 'strict'.Set state information for unpickling.Return state information for pickling.Private method returning an estimate of len(list(it))._PyUnicode_Initinit_stdio_encodinginit_fs_encoding_PyUnicode_CheckConsistency__sizeof__($self, /) -- Return memory consumption of the type object.__dir__($self, /) -- Specialized __dir__ implementation for types.__subclasscheck__($self, subclass, /) -- Check if a class is a subclass.__instancecheck__($self, instance, /) -- Check if an object is an instance.__subclasses__($self, /) -- Return a list of immediate subclasses.mro($self, /) -- Return a type's method resolution order.type(object_or_name, bases, dict) type(object) -> the object's type type(name, bases, dict) -> a new type__dir__($self, /) -- Default dir() implementation.__sizeof__($self, /) -- Size of object in memory, in bytes.__format__($self, format_spec, /) -- Default object formatter.This method is called when a class is subclassed. The default implementation does nothing. It may be overridden to extend subclasses. Abstract classes can override this to customize issubclass(). This is invoked early on by abc.ABCMeta.__subclasscheck__(). It should return True, False or NotImplemented. If it returns NotImplemented, the normal algorithm is used. Otherwise, it overrides the normal algorithm (and the outcome is cached). __reduce__($self, /) -- Helper for pickle.__reduce_ex__($self, protocol, /) -- Helper for pickle.object() -- The base class of the class hierarchy. When called, it accepts no arguments and returns a new featureless instance that has no instance attributes and cannot be given any. super() -> same as super(__class__, ) super(type) -> unbound super object super(type, obj) -> bound super object; requires isinstance(obj, type) super(type, type2) -> bound super object; requires issubclass(type2, type) Typical use to call a cooperative superclass method: class C(B): def meth(self, arg): super().meth(arg) This works for class methods too: class C(B): @classmethod def cmeth(cls, arg): super().cmeth(arg)  HPx`phX80((080P0x@x(H8XH@_PyType_CheckConsistencycount($self, value, /) -- Return number of occurrences of value.index($self, value, start=0, stop=sys.maxsize, /) -- Return first index of value. Raises ValueError if the value is not present.__getnewargs__($self, /) -- tuple(iterable=(), /) -- Built-in immutable sequence. If no argument is given, the constructor returns an empty tuple. If iterable is specified the tuple is initialized from iterable's items. If the argument is a tuple, the return value is the same object.Set state information for unpickling.Return state information for pickling.Private method returning an estimate of len(list(it)).n_unnamed_fieldsn_fieldsn_sequence_fieldsReturn state information for pickling.S.indices(len) -> (start, stop, stride) Assuming a sequence of length len, calculate the start and stop indices, and the stride length of the extended slice described by S. Out of bounds indices are clipped in a manner consistent with the handling of normal slices.slice(stop) slice(start, stop[, step]) Create a slice object. This is used for extended slicing (e.g. a[0:10:2]).Private method returning an estimate of len(list(it)).Update a set with the union of itself and others.Update a set with the symmetric difference of itself and another.Remove an element from a set; it must be a member. If the element is not a member, raise a KeyError.Remove and return an arbitrary set element. Raises KeyError if the set is empty.Update a set with the intersection of itself and another.Remove all elements of another set from this set.Remove an element from a set if it is a member. If the element is not a member, do nothing.Remove all elements from this set.Add an element to a set. This has no effect if the element is already present.set() -> new empty set object set(iterable) -> new set object Build an unordered collection of unique elements.Return the union of sets as a new set. (i.e. all elements that are in either set.)Return the symmetric difference of two sets as a new set. (i.e. all elements that are in exactly one of the sets.)S.__sizeof__() -> size of S in memory, in bytesReturn state information for pickling.Report whether this set contains another set.Report whether another set contains this set.Return True if two sets have a null intersection.Return the intersection of two sets as a new set. (i.e. all elements that are in both sets.)Return the difference of two or more sets as a new set. (i.e. all elements that are in this set but not the others.)Return a shallow copy of a set.x.__contains__(y) <==> y in x.frozenset() -> empty frozenset object frozenset(iterable) -> frozenset object Build an immutable unordered collection of unique elements.rangeobject.index(value) -> integer -- return index of value. Raise ValueError if the value is not present.rangeobject.count(value) -> integer -- return number of occurrences of valueReturn a reverse iterator.range(stop) -> range object range(start, stop[, step]) -> range object Return an object that produces a sequence of integers from start (inclusive) to stop (exclusive) by step. range(i, j) produces i, i+1, i+2, ..., j-1. start defaults to 0, and stop is omitted! range(4) produces 0, 1, 2, 3. These are exactly the valid indices for a list of 4 elements. When step is given, it specifies the increment (or decrement).Set state information for unpickling.Return state information for pickling.Private method returning an estimate of len(list(it)).release($self, /) -- Release the underlying buffer exposed by the PickleBuffer object.raw($self, /) -- Return a memoryview of the raw memory underlying this buffer. Will raise BufferError is the buffer isn't contiguous._PyObject_CheckConsistency_PyTypes_InitReturn state information for picklingA simple attribute-based namespace. SimpleNamespace(**kwargs)module(name, doc=None) -- Create a module object. The name must be a string; the optional doc argument can have any type.A bool indicating whether the memory is contiguous.A bool indicating whether the memory is Fortran contiguous.A bool indicating whether the memory is C contiguous.A tuple of integers used internally for PIL-style arrays.A tuple of ndim integers giving the size in bytes to access each element for each dimension of the array.A tuple of ndim integers giving the shape of the memory as an N-dimensional array.An integer indicating how many dimensions of a multi-dimensional array the memory represents.A string containing the format (in struct module style) for each element in the view.The size in bytes of each element of the memoryview.A bool indicating whether the memory is read only.The amount of space in bytes that the array would use in a contiguous representation.The underlying object of the memoryview.toreadonly($self, /) -- Return a readonly version of the memoryview.cast($self, /, format, *, shape) -- Cast a memoryview to a new format or shape.tolist($self, /) -- Return the data in the buffer as a list of elements.hex($self, /, sep=, bytes_per_sep=1) -- Return the data in the buffer as a str of hexadecimal numbers. sep An optional single character or byte to separate hex bytes. bytes_per_sep How many bytes between separators. Positive values count from the right, negative values count from the left. Example: >>> value = memoryview(b'\xb9\x01\xef') >>> value.hex() 'b901ef' >>> value.hex(':') 'b9:01:ef' >>> value.hex(':', 2) 'b9:01ef' >>> value.hex(':', -2) 'b901:ef'tobytes($self, /, order=None) -- Return the data in the buffer as a byte string. Order can be {'C', 'F', 'A'}. When order is 'C' or 'F', the data of the original array is converted to C or Fortran order. For contiguous views, 'A' returns an exact copy of the physical memory. In particular, in-memory Fortran order is preserved. For non-contiguous views, the data is converted to C first. order=None is the same as order='C'.release($self, /) -- Release the underlying buffer exposed by the memoryview object.memoryview(object) -- Create a new memoryview object which references the given object.move_to_end($self, /, key, last=True) -- Move an existing element to the end (or beginning if last is false). Raise KeyError if the element does not exist.od.__reversed__() <==> reversed(od)od.copy() -> a shallow copy of odod.clear() -> None. Remove all items from od.popitem($self, /, last=True) -- Remove and return a (key, value) pair from the dictionary. Pairs are returned in LIFO order if last is true or FIFO order if false.od.pop(k[,d]) -> v, remove specified key and return the corresponding value. If key is not found, d is returned if given, otherwise KeyError is raised. setdefault($self, /, key, default=None) -- Insert key with a value of default if key is not in the dictionary. Return the value for key if key is in the dictionary, else default.Return state information for picklingfromkeys($type, /, iterable, value=None) -- Create a new ordered dictionary with keys from iterable and values set to value.Dictionary that remembers insertion orderReturn state information for pickling__reversed__($self, /) -- Return a reverse iterator over the dict keys.D.copy() -> a shallow copy of DD.clear() -> None. Remove all items from D.fromkeys($type, iterable, value=None, /) -- Create a new dictionary with keys from iterable and values set to value.D.update([E, ]**F) -> None. Update D from dict/iterable E and F. If E is present and has a .keys() method, then does: for k in E: D[k] = E[k] If E is present and lacks a .keys() method, then does: for k, v in E: D[k] = v In either case, this is followed by: for k in F: D[k] = F[k]D.values() -> an object providing a view on D's valuesD.items() -> a set-like object providing a view on D's itemsD.keys() -> a set-like object providing a view on D's keyspopitem($self, /) -- Remove and return a (key, value) pair as a 2-tuple. Pairs are returned in LIFO (last-in, first-out) order. Raises KeyError if the dict is empty.D.pop(k[,d]) -> v, remove specified key and return the corresponding value. If key is not found, d is returned if given, otherwise KeyError is raisedsetdefault($self, key, default=None, /) -- Insert key with a value of default if key is not in the dictionary. Return the value for key if key is in the dictionary, else default.get($self, key, default=None, /) -- Return the value for key if key is in the dictionary, else default.D.__sizeof__() -> size of D in memory, in bytesx.__getitem__(y) <==> x[y]__contains__($self, key, /) -- True if the dictionary has the specified key, else False.dict() -> new empty dictionary dict(mapping) -> new dictionary initialized from a mapping object's (key, value) pairs dict(iterable) -> new dictionary initialized as if via: d = {} for k, v in iterable: d[k] = v dict(**kwargs) -> new dictionary initialized with the name=value pairs in the keyword argument list. For example: dict(one=1, two=2)Return state information for pickling.Private method returning an estimate of len(list(it)).Return a reverse iterator over the dict keys.Return a reverse iterator over the dict items.Return True if the view and the given iterable have a null intersection.Return a reverse iterator over the dict values._PyDict_CheckConsistency__sizeof__($self, /) -- Returns size in memory, in bytes.__format__($self, format_spec, /) -- __getnewargs__($self, /) -- as_integer_ratio($self, /) -- Return integer ratio. Return a pair of integers, whose ratio is exactly equal to the original int and with a positive denominator. >>> (10).as_integer_ratio() (10, 1) >>> (-10).as_integer_ratio() (-10, 1) >>> (0).as_integer_ratio() (0, 1)from_bytes($type, /, bytes, byteorder, *, signed=False) -- Return the integer represented by the given array of bytes. bytes Holds the array of bytes to convert. The argument must either support the buffer protocol or be an iterable object producing bytes. Bytes and bytearray are examples of built-in objects that support the buffer protocol. byteorder The byte order used to represent the integer. If byteorder is 'big', the most significant byte is at the beginning of the byte array. If byteorder is 'little', the most significant byte is at the end of the byte array. To request the native byte order of the host system, use `sys.byteorder' as the byte order value. signed Indicates whether two's complement is used to represent the integer.to_bytes($self, /, length, byteorder, *, signed=False) -- Return an array of bytes representing an integer. length Length of bytes object to use. An OverflowError is raised if the integer is not representable with the given number of bytes. byteorder The byte order used to represent the integer. If byteorder is 'big', the most significant byte is at the beginning of the byte array. If byteorder is 'little', the most significant byte is at the end of the byte array. To request the native byte order of the host system, use `sys.byteorder' as the byte order value. signed Determines whether two's complement is used to represent the integer. If signed is False and a negative integer is given, an OverflowError is raised.bit_length($self, /) -- Number of bits necessary to represent self in binary. >>> bin(37) '0b100101' >>> (37).bit_length() 6int([x]) -> integer int(x, base=10) -> integer Convert a number or string to an integer, or return 0 if no arguments are given. If x is a number, return x.__int__(). For floating point numbers, this truncates towards zero. If x is not a number or if base is given, then x must be a string, bytes, or bytearray instance representing an integer literal in the given base. The literal can be preceded by '+' or '-' and be surrounded by whitespace. The base defaults to 10. Valid bases are 0 and 2-36. Base 0 means to interpret the base from the string as an integer literal. >>> int('0b100', base=0) 4sys.int_info A named tuple that holds information about Python's internal representation of integers. The attributes are read only.sort($self, /, *, key=None, reverse=False) -- Sort the list in ascending order and return None. The sort is in-place (i.e. the list itself is modified) and stable (i.e. the order of two equal elements is maintained). If a key function is given, apply it once to each list item and sort them, ascending or descending, according to their function values. The reverse flag can be set to sort in descending order.reverse($self, /) -- Reverse *IN PLACE*.count($self, value, /) -- Return number of occurrences of value.index($self, value, start=0, stop=sys.maxsize, /) -- Return first index of value. Raises ValueError if the value is not present.remove($self, value, /) -- Remove first occurrence of value. Raises ValueError if the value is not present.pop($self, index=-1, /) -- Remove and return item at index (default last). Raises IndexError if list is empty or index is out of range.extend($self, iterable, /) -- Extend list by appending elements from the iterable.insert($self, index, object, /) -- Insert object before index.append($self, object, /) -- Append object to the end of the list.copy($self, /) -- Return a shallow copy of the list.clear($self, /) -- Remove all items from list.__sizeof__($self, /) -- Return the size of the list in memory, in bytes.__reversed__($self, /) -- Return a reverse iterator over the list.list(iterable=(), /) -- Built-in mutable sequence. If no argument is given, the constructor creates a new empty list. The argument must be an iterable if specified.Set state information for unpickling.Return state information for pickling.Private method returning an estimate of len(list(it)).Set state information for unpickling.Private method returning an estimate of len(list(it)).Return state information for pickling.A interpreter ID identifies a interpreter and may be used as an int.function(code, globals, name=None, argdefs=None, closure=None) -- Create a function object. code a code object globals the globals dictionary name a string that overrides the name from the code object argdefs a tuple that specifies the default argument values closure a tuple that supplies the bindings for free variablesclassmethod(function) -> method Convert a function to be a class method. A class method receives the class as implicit first argument, just like an instance method receives the instance. To declare a class method, use this idiom: class C: @classmethod def f(cls, arg1, arg2, ...): ... It can be called either on the class (e.g. C.f()) or on an instance (e.g. C().f()). The instance is ignored except for its class. If a class method is called for a derived class, the derived class object is passed as the implied first argument. Class methods are different than C++ or Java static methods. If you want those, see the staticmethod builtin.staticmethod(function) -> method Convert a function to be a static method. A static method does not receive an implicit first argument. To declare a static method, use this idiom: class C: @staticmethod def f(arg1, arg2, ...): ... It can be called either on the class (e.g. C.f()) or on an instance (e.g. C().f()). Both the class and the instance are ignored, and neither is passed implicitly as the first argument to the method. Static methods in Python are similar to those found in Java or C++. For a more advanced concept, see the classmethod builtin.F.__sizeof__() -> size of F in memory, in bytesF.clear(): clear most references held by the framesys.float_info A named tuple holding information about the float type. It contains low level information about the precision and internal representation. Please study your system's :file:`float.h` for more information.__format__($self, format_spec, /) -- Formats the float according to format_spec.__set_format__($type, typestr, fmt, /) -- You probably don't want to use this function. typestr Must be 'double' or 'float'. fmt Must be one of 'unknown', 'IEEE, big-endian' or 'IEEE, little-endian', and in addition can only be one of the latter two if it appears to match the underlying C reality. It exists mainly to be used in Python's test suite. Override the automatic determination of C-level floating point type. This affects how floats are converted to and from binary strings.__getformat__($type, typestr, /) -- You probably don't want to use this function. typestr Must be 'double' or 'float'. It exists mainly to be used in Python's test suite. This function returns whichever of 'unknown', 'IEEE, big-endian' or 'IEEE, little-endian' best describes the format of floating point numbers used by the C type named by typestr.__getnewargs__($self, /) -- is_integer($self, /) -- Return True if the float is an integer.hex($self, /) -- Return a hexadecimal representation of a floating-point number. >>> (-0.1).hex() '-0x1.999999999999ap-4' >>> 3.14159.hex() '0x1.921f9f01b866ep+1'fromhex($type, string, /) -- Create a floating-point number from a hexadecimal string. >>> float.fromhex('0x1.ffffp10') 2047.984375 >>> float.fromhex('-0x1p-1074') -5e-324as_integer_ratio($self, /) -- Return integer ratio. Return a pair of integers, whose ratio is exactly equal to the original float and with a positive denominator. Raise OverflowError on infinities and a ValueError on NaNs. >>> (10.0).as_integer_ratio() (10, 1) >>> (0.0).as_integer_ratio() (0, 1) >>> (-.25).as_integer_ratio() (-1, 4)__round__($self, ndigits=None, /) -- Return the Integral closest to x, rounding half toward even. When an argument is passed, work like built-in round(x, ndigits).__trunc__($self, /) -- Return the Integral closest to x between 0 and x.conjugate($self, /) -- Return self, the complex conjugate of any float.float(x=0, /) -- Convert a string or number to a floating point number, if possible.  close() -> raise GeneratorExit inside coroutine.throw(typ[,val[,tb]]) -> raise exception in coroutine, return next iterated value or raise StopIteration.send(arg) -> send 'arg' into coroutine, return next iterated value or raise StopIteration.aclose() -> raise GeneratorExit inside generator.athrow(typ[,val[,tb]]) -> raise exception in generator.asend(v) -> send 'v' in generator.close() -> raise GeneratorExit inside generator.throw(typ[,val[,tb]]) -> raise exception in generator, return next yielded value or raise StopIteration.send(arg) -> send 'arg' into generator, return next yielded value or raise StopIteration.Exception.with_traceback(tb) -- set self.__traceback__ to tb and return self._PyBuiltins_AddExceptions_PyExc_Initenumerate(iterable, start=0) -- Return an enumerate object. iterable an object supporting iteration The enumerate object yields pairs containing a count (from start, which defaults to zero) and a value yielded by the iterable argument. enumerate is useful for obtaining an indexed list: (0, seq[0]), (1, seq[1]), (2, seq[2]), ...Set state information for unpickling.Return state information for pickling.Private method returning an estimate of len(list(it)).reversed(sequence, /) -- Return a reverse iterator over the values of the given sequence.Descriptor to change the deleter on a property.Descriptor to change the setter on a property.Descriptor to change the getter on a property.property(fget=None, fset=None, fdel=None, doc=None) -- Property attribute. fget function to be used for getting an attribute value fset function to be used for setting an attribute value fdel function to be used for del'ing an attribute doc docstring Typical use is to define a managed attribute x: class C(object): def getx(self): return self._x def setx(self, value): self._x = value def delx(self): del self._x x = property(getx, setx, delx, "I'm the 'x' property.") Decorators make defining new properties or modifying existing ones easy: class C(object): @property def x(self): "I am the 'x' property." return self._x @x.setter def x(self, value): self._x = value @x.deleter def x(self): del self._xcomplex.__format__() -> str Convert to a string according to format_spec.complex.conjugate() -> complex Return the complex conjugate of its argument. (3-4j).conjugate() == 3+4j.complex(real=0, imag=0) -- Create a complex number from a real part and an optional imaginary part. This is equivalent to (real + imag*1j) where imag defaults to 0.?replace($self, /, *, co_argcount=-1, co_posonlyargcount=-1, co_kwonlyargcount=-1, co_nlocals=-1, co_stacksize=-1, co_flags=-1, co_firstlineno=-1, co_code=None, co_consts=None, co_names=None, co_varnames=None, co_freevars=None, co_cellvars=None, co_filename=None, co_name=None, co_lnotab=None) -- Return a copy of the code object with new values for the specified fields.code(argcount, posonlyargcount, kwonlyargcount, nlocals, stacksize, flags, codestring, constants, names, varnames, filename, name, firstlineno, lnotab[, freevars[, cellvars]]) Create a code object. Not for the faint of heart.method(function, instance) Create a bound instance method object.instancemethod(function) Bind a function to a class.cell([contents]) -- Create a new cell object. contents the contents of the cell. If not specified, the cell will be empty, and further attempts to access its cell_contents attribute will raise a ValueError.Capsule objects let you wrap a C "void *" pointer in a Python object. They're a way of passing data through the Python interpreter without creating your own custom type. Capsules are used for communication between extension modules. They provide a way for an extension module to export a C interface to other extension modules, so that extension modules can use the Python import mechanism to link to one another. zfill($self, width, /) -- Pad a numeric string with zeros on the left, to fill a field of the given width. The original string is never truncated.translate($self, table, /, delete=b'') -- Return a copy with each character mapped by the given translation table. table Translation table, which must be a bytes object of length 256. All characters occurring in the optional argument delete are removed. The remaining characters are mapped through the given translation table.strip($self, bytes=None, /) -- Strip leading and trailing bytes contained in the argument. If the argument is omitted or None, strip leading and trailing ASCII whitespace.splitlines($self, /, keepends=False) -- Return a list of the lines in the bytes, breaking at line boundaries. Line breaks are not included in the resulting list unless keepends is given and true.split($self, /, sep=None, maxsplit=-1) -- Return a list of the sections in the bytes, using sep as the delimiter. sep The delimiter according which to split the bytes. None (the default value) means split on ASCII whitespace characters (space, tab, return, newline, formfeed, vertical tab). maxsplit Maximum number of splits to do. -1 (the default value) means no limit.rstrip($self, bytes=None, /) -- Strip trailing bytes contained in the argument. If the argument is omitted or None, strip trailing ASCII whitespace.rsplit($self, /, sep=None, maxsplit=-1) -- Return a list of the sections in the bytes, using sep as the delimiter. sep The delimiter according which to split the bytes. None (the default value) means split on ASCII whitespace characters (space, tab, return, newline, formfeed, vertical tab). maxsplit Maximum number of splits to do. -1 (the default value) means no limit. Splitting is done starting at the end of the bytes and working to the front.rpartition($self, sep, /) -- Partition the bytes into three parts using the given separator. This will search for the separator sep in the bytes, starting at the end. If the separator is found, returns a 3-tuple containing the part before the separator, the separator itself, and the part after it. If the separator is not found, returns a 3-tuple containing two empty bytes objects and the original bytes object.rjust($self, width, fillchar=b' ', /) -- Return a right-justified string of length width. Padding is done using the specified fill character.replace($self, old, new, count=-1, /) -- Return a copy with all occurrences of substring old replaced by new. count Maximum number of occurrences to replace. -1 (the default value) means replace all occurrences. If the optional argument count is given, only the first count occurrences are replaced.partition($self, sep, /) -- Partition the bytes into three parts using the given separator. This will search for the separator sep in the bytes. If the separator is found, returns a 3-tuple containing the part before the separator, the separator itself, and the part after it. If the separator is not found, returns a 3-tuple containing the original bytes object and two empty bytes objects.maketrans(frm, to, /) -- Return a translation table useable for the bytes or bytearray translate method. The returned table will be one where each byte in frm is mapped to the byte at the same position in to. The bytes objects frm and to must be of the same length.lstrip($self, bytes=None, /) -- Strip leading bytes contained in the argument. If the argument is omitted or None, strip leading ASCII whitespace.ljust($self, width, fillchar=b' ', /) -- Return a left-justified string of length width. Padding is done using the specified fill character.join($self, iterable_of_bytes, /) -- Concatenate any number of bytes objects. The bytes whose method is called is inserted in between each pair. The result is returned as a new bytes object. Example: b'.'.join([b'ab', b'pq', b'rs']) -> b'ab.pq.rs'.hex($self, /, sep=, bytes_per_sep=1) -- Create a str of hexadecimal numbers from a bytes object. sep An optional single character or byte to separate hex bytes. bytes_per_sep How many bytes between separators. Positive values count from the right, negative values count from the left. Example: >>> value = b'\xb9\x01\xef' >>> value.hex() 'b901ef' >>> value.hex(':') 'b9:01:ef' >>> value.hex(':', 2) 'b9:01ef' >>> value.hex(':', -2) 'b901:ef'fromhex($type, string, /) -- Create a bytes object from a string of hexadecimal numbers. Spaces between two numbers are accepted. Example: bytes.fromhex('B9 01EF') -> b'\\xb9\\x01\\xef'.expandtabs($self, /, tabsize=8) -- Return a copy where all tab characters are expanded using spaces. If tabsize is not given, a tab size of 8 characters is assumed.decode($self, /, encoding='utf-8', errors='strict') -- Decode the bytes using the codec registered for encoding. encoding The encoding with which to decode the bytes. errors The error handling scheme to use for the handling of decoding errors. The default is 'strict' meaning that decoding errors raise a UnicodeDecodeError. Other possible values are 'ignore' and 'replace' as well as any other name registered with codecs.register_error that can handle UnicodeDecodeErrors.center($self, width, fillchar=b' ', /) -- Return a centered string of length width. Padding is done using the specified fill character.bytes(iterable_of_ints) -> bytes bytes(string, encoding[, errors]) -> bytes bytes(bytes_or_buffer) -> immutable copy of bytes_or_buffer bytes(int) -> bytes object of size given by the parameter initialized with null bytes bytes() -> empty bytes object Construct an immutable array of bytes from: - an iterable yielding integers in range(256) - a text string encoded using the specified encoding - any object implementing the buffer API. - an integerSet state information for unpickling.Return state information for pickling.Private method returning an estimate of len(list(it)).zfill($self, width, /) -- Pad a numeric string with zeros on the left, to fill a field of the given width. The original string is never truncated.translate($self, table, /, delete=b'') -- Return a copy with each character mapped by the given translation table. table Translation table, which must be a bytes object of length 256. All characters occurring in the optional argument delete are removed. The remaining characters are mapped through the given translation table.strip($self, bytes=None, /) -- Strip leading and trailing bytes contained in the argument. If the argument is omitted or None, strip leading and trailing ASCII whitespace.splitlines($self, /, keepends=False) -- Return a list of the lines in the bytearray, breaking at line boundaries. Line breaks are not included in the resulting list unless keepends is given and true.split($self, /, sep=None, maxsplit=-1) -- Return a list of the sections in the bytearray, using sep as the delimiter. sep The delimiter according which to split the bytearray. None (the default value) means split on ASCII whitespace characters (space, tab, return, newline, formfeed, vertical tab). maxsplit Maximum number of splits to do. -1 (the default value) means no limit.rstrip($self, bytes=None, /) -- Strip trailing bytes contained in the argument. If the argument is omitted or None, strip trailing ASCII whitespace.rsplit($self, /, sep=None, maxsplit=-1) -- Return a list of the sections in the bytearray, using sep as the delimiter. sep The delimiter according which to split the bytearray. None (the default value) means split on ASCII whitespace characters (space, tab, return, newline, formfeed, vertical tab). maxsplit Maximum number of splits to do. -1 (the default value) means no limit. Splitting is done starting at the end of the bytearray and working to the front.rpartition($self, sep, /) -- Partition the bytearray into three parts using the given separator. This will search for the separator sep in the bytearray, starting at the end. If the separator is found, returns a 3-tuple containing the part before the separator, the separator itself, and the part after it as new bytearray objects. If the separator is not found, returns a 3-tuple containing two empty bytearray objects and the copy of the original bytearray object.rjust($self, width, fillchar=b' ', /) -- Return a right-justified string of length width. Padding is done using the specified fill character.reverse($self, /) -- Reverse the order of the values in B in place.replace($self, old, new, count=-1, /) -- Return a copy with all occurrences of substring old replaced by new. count Maximum number of occurrences to replace. -1 (the default value) means replace all occurrences. If the optional argument count is given, only the first count occurrences are replaced.remove($self, value, /) -- Remove the first occurrence of a value in the bytearray. value The value to remove.pop($self, index=-1, /) -- Remove and return a single item from B. index The index from where to remove the item. -1 (the default value) means remove the last item. If no index argument is given, will pop the last item.partition($self, sep, /) -- Partition the bytearray into three parts using the given separator. This will search for the separator sep in the bytearray. If the separator is found, returns a 3-tuple containing the part before the separator, the separator itself, and the part after it as new bytearray objects. If the separator is not found, returns a 3-tuple containing the copy of the original bytearray object and two empty bytearray objects.maketrans(frm, to, /) -- Return a translation table useable for the bytes or bytearray translate method. The returned table will be one where each byte in frm is mapped to the byte at the same position in to. The bytes objects frm and to must be of the same length.lstrip($self, bytes=None, /) -- Strip leading bytes contained in the argument. If the argument is omitted or None, strip leading ASCII whitespace.ljust($self, width, fillchar=b' ', /) -- Return a left-justified string of length width. Padding is done using the specified fill character.join($self, iterable_of_bytes, /) -- Concatenate any number of bytes/bytearray objects. The bytearray whose method is called is inserted in between each pair. The result is returned as a new bytearray object.insert($self, index, item, /) -- Insert a single item into the bytearray before the given index. index The index where the value is to be inserted. item The item to be inserted.hex($self, /, sep=, bytes_per_sep=1) -- Create a str of hexadecimal numbers from a bytearray object. sep An optional single character or byte to separate hex bytes. bytes_per_sep How many bytes between separators. Positive values count from the right, negative values count from the left. Example: >>> value = bytearray([0xb9, 0x01, 0xef]) >>> value.hex() 'b901ef' >>> value.hex(':') 'b9:01:ef' >>> value.hex(':', 2) 'b9:01ef' >>> value.hex(':', -2) 'b901:ef'fromhex($type, string, /) -- Create a bytearray object from a string of hexadecimal numbers. Spaces between two numbers are accepted. Example: bytearray.fromhex('B9 01EF') -> bytearray(b'\\xb9\\x01\\xef')extend($self, iterable_of_ints, /) -- Append all the items from the iterator or sequence to the end of the bytearray. iterable_of_ints The iterable of items to append.expandtabs($self, /, tabsize=8) -- Return a copy where all tab characters are expanded using spaces. If tabsize is not given, a tab size of 8 characters is assumed.decode($self, /, encoding='utf-8', errors='strict') -- Decode the bytearray using the codec registered for encoding. encoding The encoding with which to decode the bytearray. errors The error handling scheme to use for the handling of decoding errors. The default is 'strict' meaning that decoding errors raise a UnicodeDecodeError. Other possible values are 'ignore' and 'replace' as well as any other name registered with codecs.register_error that can handle UnicodeDecodeErrors.copy($self, /) -- Return a copy of B.clear($self, /) -- Remove all items from the bytearray.center($self, width, fillchar=b' ', /) -- Return a centered string of length width. Padding is done using the specified fill character.append($self, item, /) -- Append a single item to the end of the bytearray. item The item to be appended.__sizeof__($self, /) -- Returns the size of the bytearray object in memory, in bytes.__reduce_ex__($self, proto=0, /) -- Return state information for pickling.B.__alloc__() -> int Return the number of bytes actually allocated.bytearray(iterable_of_ints) -> bytearray bytearray(string, encoding[, errors]) -> bytearray bytearray(bytes_or_buffer) -> mutable copy of bytes_or_buffer bytearray(int) -> bytes array of size given by the parameter initialized with null bytes bytearray() -> empty bytes array Construct a mutable bytearray object from: - an iterable yielding integers in range(256) - a text string encoded using the specified encoding - a bytes or a buffer object - any object implementing the buffer API. - an integerSet state information for unpickling.__reduce__($self, /) -- Return state information for pickling.Private method returning an estimate of len(list(it)).B.isspace() -> bool Return True if all characters in B are whitespace and there is at least one character in B, False otherwise.B.isalpha() -> bool Return True if all characters in B are alphabetic and there is at least one character in B, False otherwise.B.isalnum() -> bool Return True if all characters in B are alphanumeric and there is at least one character in B, False otherwise.B.isascii() -> bool Return True if B is empty or all characters in B are ASCII, False otherwise.B.isdigit() -> bool Return True if all characters in B are digits and there is at least one character in B, False otherwise.B.islower() -> bool Return True if all cased characters in B are lowercase and there is at least one cased character in B, False otherwise.B.isupper() -> bool Return True if all cased characters in B are uppercase and there is at least one cased character in B, False otherwise.B.istitle() -> bool Return True if B is a titlecased string and there is at least one character in B, i.e. uppercase characters may only follow uncased characters and lowercase characters only cased ones. Return False otherwise.B.lower() -> copy of B Return a copy of B with all ASCII characters converted to lowercase.B.upper() -> copy of B Return a copy of B with all ASCII characters converted to uppercase.B.title() -> copy of B Return a titlecased version of B, i.e. ASCII words start with uppercase characters, all remaining cased characters have lowercase.B.capitalize() -> copy of B Return a copy of B with only its first character capitalized (ASCII) and the rest lower-cased.B.swapcase() -> copy of B Return a copy of B with uppercase ASCII characters converted to lowercase ASCII and vice versa.B.maketrans(frm, to) -> translation table Return a translation table (a bytes object of length 256) suitable for use in the bytes or bytearray translate method where each byte in frm is mapped to the byte at the same position in to. The bytes objects frm and to must be of the same length.B.find(sub[, start[, end]]) -> int Return the lowest index in B where subsection sub is found, such that sub is contained within B[start,end]. Optional arguments start and end are interpreted as in slice notation. Return -1 on failure.B.index(sub[, start[, end]]) -> int Return the lowest index in B where subsection sub is found, such that sub is contained within B[start,end]. Optional arguments start and end are interpreted as in slice notation. Raises ValueError when the subsection is not found.B.rfind(sub[, start[, end]]) -> int Return the highest index in B where subsection sub is found, such that sub is contained within B[start,end]. Optional arguments start and end are interpreted as in slice notation. Return -1 on failure.B.rindex(sub[, start[, end]]) -> int Return the highest index in B where subsection sub is found, such that sub is contained within B[start,end]. Optional arguments start and end are interpreted as in slice notation. Raise ValueError when the subsection is not found.B.count(sub[, start[, end]]) -> int Return the number of non-overlapping occurrences of subsection sub in bytes B[start:end]. Optional arguments start and end are interpreted as in slice notation.B.startswith(prefix[, start[, end]]) -> bool Return True if B starts with the specified prefix, False otherwise. With optional start, test B beginning at that position. With optional end, stop comparing B at that position. prefix can also be a tuple of bytes to try.B.endswith(suffix[, start[, end]]) -> bool Return True if B ends with the specified suffix, False otherwise. With optional start, test B beginning at that position. With optional end, stop comparing B at that position. suffix can also be a tuple of bytes to try.bool(x) -> bool Returns True when the argument x is true, False otherwise. The builtins True and False are the only two instances of the class bool. The class bool is a subclass of the class int, and cannot be subclassed.!6 6666666666 6166666666666666666666666666 6 666666666666666666666666666638<& .BeA& .>@C\t\n\r\x00000000?333333?p>0>P ^4@C?A5?55?5?P9ApA Y@?aCoc?`(?yPD?A<<0@ư>.AP?@p࿚?UUUUUU??y??UUUUUU??i????UUUUUU??$I$I???qq??@@@j@cAחA _BmB&@UUUUUU?@(@*@@,@.@@1@!@2@3@UUUUUU??4@i@@@@jAsA5@^ A6@7@8@9@:@;@<@=@@?333333????333333?>@r@p@L@OA?@@@@@A@A@B@B@C@C@@?D@y@@@@jAD@E@E@^AF@F@G@G@H@H@?@?I@@@@j@A@N@@p@L@O"A? @?Q@@X@@\%A @T@@@@@j(A"@@V@ @@@@w+A ( ) startswith????Y @? ?>?;}4 l + 4[ s l TOJd JP4M8=KR@Utc?Z t}!!8"M##T#6687-7n747784>8pn8q99Q:hFF8GXKGG,IJ5JTnJJLM!M5MHuMqNNN4N*O:O,O`_PR\SXSTTT=UHIUXUdU U U N`| d Ed kdh d d< et e e 4e8 _e e ee h)hhh@h|i&iHkkl4 ll$lhlmm@monnnnDoxoo( p"pphpq<q9q$qrr(ssHps|sss*t3thTt ltP t!tT!Du!bu!u\"vP#v#y$%y&yT'z'z'z<(3{({(){X){)*H**Ȁ(+\+++,Sp,,~-D--߅-.`.#.`.0//0|T00Ԉ01j,222É383x3%84/4F4c86Տ7l<777<888GH9T9[:cP::(;GP;P;Y;z,<zX<<<ј ==^>y>(???]D@ԝ@l@ATAܜABp,B |CCbDTDEE$ExEȠE`mFСFFF*GLHH HI IȥJVJcJ`vJJJJJ$zKKDK%MFMhMЫ*N(NO4JP|VPPPQQQ)T VTd^TgTT$TTT4T5UU`BVܳMV<VW<WXDXXJXcXiXHXXt)YظSY\pYZZR[غY[8J\R\\@\]$ ]|!]_]0j]t]^X^_0_d_ ``\` a=aPZaabb,cQcx d gLsgghxh iipVjyjjjXjk-klkll-md7mmxnnPoo8op$pxpqTq|(q;qlHqOqTArsrxrDrs@pst@1txItgt uxuuduav\x xxxyXyyzAz{{ {R|u|l}~< ~D~d~ ,tLk(\ 4p|<|8Պtn$TD||H%28l4<`Aq,Mp|ޓ\`Ֆ`jҙdN Лp).`H-tJU,bj\ɟP@hhD͢` dգ<L, \ A\l$8ϴdܴWjL`RKU[q0|پ,,Bt]P 6 Nd Y t  v h  $!<?<BlWF@\8Gtd4>xV lK Td[8$,)hFI`7T&-DT<  3!t!!l"!"(#-8#Pl#W##$h$%ch%k%%(&&&'%\'-'m'4()5D)))*L*+*h+ll++T|,a,,4-->- .`..C/u\////8$1|11D2 2b2'L3G3h4P4X5566T7:7L88t99 9>8:::,;p;%; <al<f<=p=Y=L>>>T??(@ h@2 @M @T Ak A} A 0B \B B B 8C lC; C DDDEXEEF FF4G<xG|G@H|HHHII I%{8>{>%|>H}LM4MxMQM,8NxNNҏOI؉ )qLC ^PeȌLȎ*,xȏ`Ȑ0'dLx^(,0zey̖T8_ܗh*8Ԛp l+dk8'*ԟXР )H5AMLԢlEd9ФTĥE ^Ԧ .xpbiplX  ܮ h$X29Lc <lFVV0mL,,+"#̻!#C#xe###@#p$$P$$p%%&*(|n(r((l)))8*3+:+@+-%-B-@k--. .P0.(_.://(0G00h011O1(1114 2d22$2Pe2w25l88\h9u9$x99;@!X p  !H!|!!#X"A"H#d#Z $<$l$$T%:|%H%}$&l&&N''e''P(V(DFh*sF+|s,s,t,v,-v-}-}L.}.,/D/l///0ZP0081ŋt11022T313A4UL444h45550@6{t666؏07\7p7.7ΐ77L8889999 9[h::<;;ǕX<ʕ<ѕ<ȗ4==e=x>0?Θ?@ @5HAWAkAHBB™ CڙPCC C.D5LDKDSDwPEE\FFDHGȜG0H7@HZH0IIѝhJ J1JKKLLȞLߞ$MhMlM N`NNDOWOeOxPܠPP0QQ>QB,RhR.RG SNSSĢTˢT`U&V>8VTxV|V,WWWHX)X]Xj@Y2|YY(Z&pZ+Z| [H[[[\\\\T]D]]^d^'^``_{_@```@`abLbbb8ccc<dmHdhdddMdHeee4el$fDf|ffLff(g\g>gZ hIhnhi\iij@jTj]DkkL|4I $#L|#>^,tcR LxnLct@K @@xJl8X1C4LtM $ Dgps$@:`|W 8Pd~,xi%(`9_H   R  d , @ h |X g  1 T 0~ P h    ![(d<PFW(@TYl;ChT` Q@hF (Px& <Q`Zr,Tp C"c""""("D#X2#p##$+$>$T$ j$ l$4u$H~$\$p$$$%%&dV''(\(0(\(|))<*8N*L* +T+p++,,D,H,-l--/P00011,1D1\2p 2[2k24%4A4 S4,4T&5|u556,6L77lj77788l9<l:|; <<W=8y=X=;>v>>$?8?p@SAAAUB0BPmC|xCC(DDD ;E@dEXEtEEFyGG(GLwHhI1I^IIYJML+cXcPdUd`ePexefwff4glgiijl4km`/nnzp qT s s Gt t t4 tH t\ tp t t u "u 5u ?u Fu uu u4 w y y y y 8zH bz| ~z z z {, M|H ~ ~ 4$H+\I4a @ETފ7 eXR( Dylߑ Rݓ(<)X3l&8˘dtEFXKlTO5$D£dii'0vHhV(٨+Dxb68ӫTo| J,d˯V xTv' 84\к#¼`\*HtI x$ L   ,  !H!t!!!q!"YD""""A"$#.##R#Y#f$u$~0$_h$$$>$J$%D%l%%%A%uD&`&& 'a4'\'x'f''F'8((V(()`P))))0*+X***"0++m+uP,,,\---.Al.;.7.,/d///0 T0001P1T 1 1 10 $2 D2' x2 223J,3h3A3K4P4b 4!%4&$5'`5P(5(5* 6*86,+d6t+6+6,6- 7-,7U.X7.x7/70708b1L81l8 3838T49]4$9v4894L9D5x95959 696:6,:Q7h:7:8:8: 9;9@;(;;;;<;U<;< <G>l<><><><><@<WA$=AP=kC={C=D(>E\>Ep>L>}M>\O8?zQ|?Q?Q?1R@:R@XR4@Rl@R@NS@S@T A)WAYA%Z(B/[pBl\B\B](C `tC`C%bCob DbT>@??A B$B4HCH4H$&pIT&I&,J'J(K)XK+K0dL1L44,M4M4MT5Nt5O5OtDdPtGPGPľhQ4QTQ$RRxSST\TTUUV4|o>oDBDqBqBqtLrMrdMsesestg\t$hpudhw$r@xrpxs0yuyv{ |Ԁt}$}48~TtdĂ`ԅxt`̄dԈ4Lt d8$t4Tĝtԟ܏t ħ`td,t؝T ԟt 4ģdܣ4xd44ܮ<dDXd$`hD$D$@4<ttd d|D$tDD$  l4\$$P4P4tlt4"d""'((D++H4,t9$::XD:h:;X=?`@@A<BLBD$EDXTXXZ4[\^bddd4jno$t ttx4x`Dxz{|}T Ԁ, ԁh  $Ht4@$Ć$DTTdĈ 4LtX  !ĕ"$$&@'T(Ğ$+8+/$0ğl143Dh3DH45564\6dp66ԣ6T 7ĥp7Ԧ7t8d`9Ĭ;<l<L>$@DA4CtFJTJ$KDLt MO0RtSDST$TtTUPVPW8Z4pZZZZt [8[4T[d[`\D]D^4_bTctegthkkdll$l m \n o Tt tT $uxyyyy\{`~L$TT$hĈ$P| "P$d-Dt.P78;L??X@̩DK0TKеdKĺLl$MTMtMLNOTPRSZ|4[D[T[\_4eLtg thh\tjjp4kDkpkHl q8rTw$wxx!dy$ty$t1:dD>tpE$HdIxL$W44XT`Yao4ȧDhD4tLĊԋPdԌ č <$d$tdē$Lh$|D0$ԗp4PtdԝTX4TTĠ8TthD(dTXtԱDp4dT4PTPd $<T$8p\$xDt4t  4`$DPDdDtxD0 4dp$dTdt$0 4D D d\   P  @TT\TdD44dd 4p!!|""t""$&t0'l'$''t\(p()l))T,**4*D+tp++ ,D&,4','0-'`-'-D(-4)0.)|.).D*/*1t+1+2+D2+2,2,3,P3$-3t-3-3-P4-d4-T7.h7.|7.d8t/8/(;/D<0<d0=08=0>$2>2h?D3?3`@3@44@5\A5 B$6tBd6 C6C$;8DDDDDDDEEETETGEGFGFG@FDHFHFHFtJXGJGdKGKH$LIdLJLKLKMlM4M NMhNMNTNNN,ONlONO4OtRtORtTUTYtUdZ4VZdV\V0`VD`Vp`V`tW|aWaY@dYTdZdZte[et[e[fT\i\Lk\`kd]k]k]l]TlT^m^n^0n_Pq_qT`q`r`LraHsauad>P>>?$T??, A8EG$JLJJ4K4KTKDLL$MT$UTUPVDWTW@WY\l^\b$cdclc$ete` f g!m"p"tq"qP#r#r#r#r#ds0$s$u %v%v%w%Dw&w@&$xt&x&x&y,'y@'zt'Tz'{'{ (|L(T|d(}(}(})4~`)d~x)~)~)4*l**Ԁ(+$@+ԁ+D+d,,,T,,-L-$`--ĉ-4$.Ċ|.4.,/x//0T0T0d@1T112$d2d2,3tx346Ė67t78408dd848,99T9 :P::Ħ:4:D;D;;d;t0<D<X<ī<d<ĭ=Tl>>?H@@$@AAdBIJHBpBBԳB$CtPCCDDD4ETxEEĻE>t??,tAAܓDBBDC|C$DhFF,GHIJȗdK4dMQQXQܙRTtTԚTU4tVVdXX(D[T\\@]D^t^^\^ܠ_$_x4`С``DbpTcc4dTTdd0Texedffhtgdhi<$jm8DmdTmm̨nDnnn4dotoo Dq\qqqܪdrsHsdsx4tttt4u4xtyzzЭz4{D{{{P}}p}D~D4ܱDx  Xdг,DԃԴ4Xt̵D8tжTd0ĊDԊXl$طċ$HtxȸT4dHčԍ$ȹ4ܹd8$tغ0hdDdHT(ܽd(Dld dĝ(4DTğpddTtģ$TĤ@ԥh4Tt@T$h4 4L 40\|tTtPDd$8dT(<$4dt$,$L4|$d0$x$\DP$$`D<$T$d<  pt4Th|4LTtxdp$DlX$XTt\dD$<DxtlD|dLd(4tT($t,h4tDtd0L$`D|8DT dt$!!H "\ t# # T%D t%p & ' D'L ' 4( (0 T)p ) )@ 4*T D* d,8,l4-- -t.d./p01\16h47E<EEHIKL,DLtdLLLN@N`PPZ[4$[LD]T]]^btefhfff4gXdgh4hDh$dh@jdjj\tkkkkklTlhlmDm!4q"Tq"q\"dr"r"r#Tsd#ds|#s#s#s#Dt8$t`%Tu%y&yP&D}&}&~ 'D~T'~'~'d(((4)8)L)))ā(*D*d*L+`+ăx+++\,D,,4-$`--4.Ԏ`.ԏ..$/tp/4/80T001D1Ԕ1D2ԗ234t$5l5t8899 :d:t:Ģ;,;Td;t|;;<<$ =TT=dh=>>\?|???Ĩ @4@4P@@@@ AԪPAD|AԫBTdBdBC$C4C4D$\D԰DD4D>? ?t@A(DAhAAC|C$FTGdGx4IIJH4KKKL8LxM$MDMdMHM8MLN4N<OP4QTQR\tSSDT8TlTV$W4tXXԘY4YYԙ_pf kqD$rtrst tԞtDu4twwwx0dxDxlxydyyyz dz4z\zp{{{ԡ$|d}l}}$~d$4,ԃlDLT<DT0ċDԋlTD<$<d̪ԑ0Ы4d tĔĬجDXԭĖ4dȮԜ,ԯ4<ttD$ dԤвt(ԥPDĦ0$ĨDԪ  4$H4\DpTdDXTܷXԮи04d԰ܹLLD(T<PĶ̼4`̽ԹT $4T̿ԾdDdt4$`t4T,Xtt$$xDDT@<td(<PdxTdHh4 LxDTl T48tp4\d$Hdt x$TD4T<<TDH$ld4D$TDT$tThT  T $ dtThD4t$04HTl$d<$$4 HT \d p t!#H#$$T$P$l$$%%8T&xd&t&&D'4't(()$),4)@*D**++t/1$3p99;;T<@`$JJK`4LL4MNlOtOO,O@Ph$P|$QQQ\UUDW 4XxdXdY0Y|ZDZZZd[[] ]4$]H__b0$bD4bXdbede`teeeg`$hh h(h<iPDiiTj(jpjlllmmTnXDododpPp4qdqqXql$rtXtuDutuuuuHdvtvvvvv0vDvXw$www<xp4xTx4y<TypzTz|4|||0}~~04~Ā$, l T Ą  ą8   Ĉ \   DX Ԍ    4 $L`DdTd$t84D Ę TpTĚHTdDDԡ$tĢ444 T<h$4ħl$ DDh dxԬ,4D$8IJ@t$<4PdDd4PĶxľ$ t T !,!$`!d "x"4"""d##D#d##($P$$%d$%t8%h%$%%@&&$&4''4'd(p(D<**T`,,-dP--d-.h./tx00D0X1d1t111 2 2d42tH2d2t223(3l33444`4t445L5`55T6X6646D7T7D77 8 8Dp8809D9$:D::\;p;;d;t;,<D<l<D<<=tP=T==$>>T>>tP??T?,@$H@|@4@D@ddA4AtAAtBBB $C4 _>_>`?`d?d`@`$AaCaCaCaC,b$DdbdEbEbdFTcFcFcFcG4d$GdTGdGeG0eGheH|e4HedH fHdfHfH gI@g$ItgdIgIg4J@hDJThTJhhtJhJhKiTL|iLi$MiDNKrB<BB&D a HTBBB B(D0A8D8D0A(B BBBdb(6BEG cBB'L؟,BPO P(K0A8JU 8D0A(B BBBA C$4-BAD bAB\BYx DBLI J(K0A8Dp8D0A(B BBB~ p5BR [E  ,@0@ BEA GD  AABA t @BAD D@f  DABB r  DABE (? ?@  DABA ?uHȥBBB B(D0D8G 8A0A(B BBBA ` iA"c(8ACD ^ AAA ?'?8JBBD A(G` (D ABBA D!7``ܨ8Ht3BBB E(A0D8DP  8D0A(B BBBA !NPܩBSHxBEB B(D0D8A@L 8D0A(B BBBA H[#@DhBIL B(K0R8RP8D0A(B BBB#PlHT]#$`DBAD yAB$ /# < =?P #d HFA} A F " d=0 PBED DP  DBBA  "dP, ЪBCA  ABA , "x H TZAXd |x 5BG0fE, $>BDD G@e DAB "@4 PBED A(Gs(D ABB F"H8 BBB B(A0A8G8A0A(B BBB i"8 ȯBHA D(GP(D ABB )RPH 3BBE B(D0D8Gp 8A0A(B BBBA H )Gph A4 BPJ E(  EBEA  b)7(0 cBDD I@r  DABA  I*T@8( $BBD A(D@r (A ABBA d E*@L lOBGB B(A0A8G8 8A0A(B BBBA  ): L.<,TQBDD O@p DABH<@@dhcBBE D(D0GPX 0D(A BBBA r<P,tDBDA DPq DAB=Y7 A ABE , KBAA e ABA ,!Y& ,HdKWEA E ABA $xX" ZAB$LA| C y A D B XlL*AY A NH |LBBB B(A0A8D] 8D0A(B BBBH L PXml %Ac X( BBDD n ABA  LX   PP !XD Z(! PBHW0l DBE H!W+00`!BGH D0c  DBBA !W;0(!LPjBAG ~ DBA !W  !HK|"W ("DP'D b@"\PASh\"`P BBB F(A0A8J 8A0A(B BBBB aBFFMJX"VX("t\fKAG  AAF #X d,#^BBB B(A0A8G@ 8D0A(B BBBB  8A0A(B BBBE 4#XY@A 8A0A(B BBBE #@#X #`$4f0$@fAD c DD X DB G AA P$CXG  h$fAD Z AA $NXL 4$gAAD h AAH D AAJ $JX AAAX$pgBBB A(A0D@ 0A(A BBBF  0A(A BBBE X%Wo@$x%i"ADD UAA4%Y: ` DAB A DAE AEA4%tiwBAD N DBE y DBA &Y1 (&iXIvDD&Y X&i$l&iDG MX @&xmBJI D(D0L@ 0A(A BBBG &uV <> wAuX>`VKp>AT A L>lFBB A(A0c (A BBBJ q (A BBBH >QAO>U ( ?0BAA AB8?U, T?Al?U?/Am?kU (?PlBAG @ DBA ?4U A ABE ?<Jq@ U9L0@W BIO S(H0A8U 8A0A(B BBBA @T<@BBB A(C0 (D BBBA @X0$A0CTHCPBBB B(A0A8D@ 8D0A(B BBBF DW@(8DĠSBBDPU EBA dD XPH|D7BEB B(D0A8GP 8D0A(B BBBC DWBPD4D oEW Eȣ?8(EBBA A(A0Y (A ABBA xdEBBB B(D0A8DP 8D0A(B BBBG R 8J0A(B BBBK u 8G0A(B BBBK EW~PF|$FxKBGD0zAB0m(D DBB\|BDPpE\\ P\t BBB E(A0A8G 8D0A(B BBBA HLLGJQFEABDDDDDB}`]\X ]+Df]'e2m]|8Ho]%e]x?Dz]eO^\%$^;eCY(<^`AAD y AAG h^e$ 8^ eWBBB D(G;(D BBB8^#BBA C(G0 (D ABBK (^e70l(A ABB$$_DDZ B S E B E L_e2Y A 8h_}BAA x ABA  ABA _e> _N_(Be_eH`"BIJ H(A0A8Upc 8A0A(B BBBA T`iep8t`HBBB A(A0(A BBB`f 0H`nBBB E(D0A8DP 8D0A(B BBBH ae]P$AYE B(D0D8B@DHBPBXA`Icd `cBBB B(A0A8DD 8D0A(B BBBA EROWTd5dHtdBEB E(A0A8GP 8D0A(B BBBF dfPdLd+wBBB B(A0A8J 8A0A(B BBBA 0DefF$N]B<xeTmkBLE A(A0" (D BBBA ez0edneՊAVfXnDDe A  f44fxnBHW0v DBC V FBE lf50f@Ai H I8foBJA D(D@| (A ABBA fDV@hfBBB B(A0A8DkEKBBBI 8D0A(B BBBA hg(goRAJA J DAA g $g o0BDJ RJBg_ LAB8hoBAA F ABC F AED Phy HlhPoBBB B(A0A8DP 8D0A(B BBBD h$P(hpSBAA ECB$i\ Y CBA `,ipBHB B(D0I8DPt 8D0A(B BBBH <8J0D(B BBB4iuPN 8C0A(B BBBA i(iq7BED Z BBA j $jq)8j`Ljq}BBA D(D0 (A ABBK  (A ABBE Y (D ABBE jC0`jtBBB B(A0A8GP 8I0A(B BBBO  8C0A(B BBBA 0kS7P8PkvBBA A(G0[ (D ABBG k.E0XkTwBBE B(A0D8Jt 8D0A(B BBBA WYUAlV$l؄G@lTlXfBEE F(M0D8MxOLAf 8C0A(B BBBJ bEWAcEFAGRBl14mYAGG0_8B@K8A0Q AAA @mc;0P8J@F8A0ddm{BEB E(D0A8Dz 8A0A(B BBBE  8A0A(B BBBE 8m" 8A0A(B BBBE HnBEE B(D0C8DPe 8D0A(B BBBA Tn`PtnBT A 8nhBBA A(D0N (D ABBA n\0nP!A[oDd oܗSBHB E(A0D8Dps 8D0A(B BBBF  8A0A(B BBBE o9pHo]BEE B(A0A8D 8A0A(B BBBB o1pX'D b,p @p| TpxA A ] K xpoS@p̠BAJ R DBK D GBC F DBA pf  p!A[q;C q @Ai H I@q, HTq(jBBB B(A0D8GP 8A0A(B BBBA qP4q,5ADG0 DAC DAqߟ^0\rBBA D(D0 (A ABBE k (A ABBG T(D ABB8prş0K (A ABBB A(A ABBr`A[rC0rLXAAD x EAL DAA,sDf _ AAB ] CAA HDsHmBEB E(A0A8DP 8A0A(B BBBA 4s.~PS 8G0A(B BBBE $s4A E h E h0sBAA G0  AABA $t0@t\ TtX0AnltRt\ (tXBGD0Z ABA tu0(tBAA ABu6%  uvDy C BBB E(D0A8GP 8D0A(B BBBH ӠPLBGB E(A0A8G. 8D0A(B BBBA d 1' /Hcā'؁0EBKE ] GBE ADB l#A] A C(@|BHR0b ABA l0T=BBB D(D0DPa 0A(A BBBE } 0A(A BBBA ܂EePdaBBB B(A0A8D@  8G0D(E DBBJ t 8A0A(B BBBA Pd"@L 8A0A(B BBBE X 8M0A(B BBBE d4 KEB B(A0D8D` 8A0A(B BBBH C` J`8@BBA @ BBB J DBA | ($vBAD W DBA ĄvK 8܄`BBA D(A0 (D ABBE mU0(4AI F A G ^ E D$`,7BAA oABR (,BNA oBB̅, $t!BDD FJB,|OBBA D0@ ABB@΢*0(\BDGDB$NBGD0}AB Ȇ,0D DBB H *BBB E(A0A8GPQ 8D0A(B BBBA 8A)P4XT<BEE D(E0O(M BBB(+0a(C BBBЇPxeKBD A(DpW (D ABBA g (H ABBE 8LL`|/BEB G(D0D8Dy 8D0A(B BBBA %<Ј<6GBB D(A0 (A BBBA 00 DmAk`ߡ?xTL ,8BAG  ABA M @Az(AAD0 AAA H0`,Aa E | 5t`<BBB B(D0D8DP 8D0A(B BBBC D 8A0A(B BBBJ 4 PO 8G0A(B BBBE Dx%YK0\MFD  ABA D4 {BAD | DBG O DBA ȋ- H<_BBB B(A0A8DP 8A0A(B BBBF ,WPPL0LcDF0 DAN _ AAA Z AAA L0ǡ;03̌֡ A, A@$KBEB E(A0G 0C(B BBBI 4LNBGG D(F0j(C BBBL BFI B(A0D8J 8A0A(B BBBG ԍA,BDA o ABG $١% `@LUBBB B(D0D8GPh 8G0A(B BBBE  8A0A(B BBBA ~TP,Ď(BDA Y ABA * @TBBB A(D0G@ 0D(A BBBD TL@(tBB D E S  H @D(BBE D(D0D@ 0G(D BBBH p@T 0I(A BBBE ] 0A(A BBBE J 0A(A BBBA ^ 0D(A BBBE p ɡ`KBD A(D0f (G ABBE C (A ABBA pC0X*0 DAD t AA <B 0TABBA GP  ABBE -P5$D'BGD MDDLԠ(DBDC DB4H#Aa`t{!A_0BEJ G0e  DABA P0ܒ`l&HBBB B(A0A8DP 8A0A(B BBBA PٟP(p,>ADG ` AAA %6 (QDz A Г'<X<Az7<$lAq E A E h@8BAD x ABA m DBE AAB0|< S DBE N DBE 8BBE A(A0(D BBB0< BIE E(D0y (B BBBA L~0(lpgBAG y ABA  AKB$AY H A@ܕpBBB D(D0GpR 0A(A BBBA  _ p`@ dBEB B(A0A8D 8A0A(B BBBJ Y8A0A(B BBB8ĖLBA D(D@ (D ABBA ,P@q (A ABBE 0dz B hHP^B A l9D0t H G I XBBE D(A0G@3 0A(A BBBH Z 0G(A BBBH O@L49BBA A(J (A ABBH u (G ABBG ,g (J ABBB @^BDD G0e  AABF D  GABB | f(L=BDD c GBB < CAB``4BBB L(D0D8DP 8A0A(B BBBH j 8J0D(B BBBH ęyAG e AA <7 <<8GBB A(D0 (A BBBA @0`<Ht8BBE B(A0A8G`4 8D0A(B BBBA `<[`H pBEB B(A0A8DP 8D0A(B BBBA X( P8xDWAG0Z ABB j DBA $ՠE0@ GBE 8ܛrBBA G(DPT (A ABBA 1P84BEA A(G0q (D ABBF pנ 0`KY D XE0VY؜=D n E > c A cAO E (0BDG@W ABI \@(t|BDG0Y DBD Q 0 !̝.$AY8 BBA A(D0 (D ABBA  &0H<0 BBB E(D0F8Ga 8A0A(B BBBI  8uBBD A(A0L (D ABBE (l:0q(C ABB $ A{ D K E HB`| Ht 8BBB B(A0A8DPe 8I0A(B BBBE 4Pj 8C0A(B BBBA LDABLA A(A0 (D ABBA Z (D DGBE H0$d(BDD FJB< JBB B(A0N (B BBBA ̠ER0HBBB B(A0A8DP 8D0A(B BBBA 8+PXdM(l_BAG0I ABE Ӟ:0[ CBA  AYء͞%(|BAD i ABA  8(D _P F A <l 2BBB D(D0 (A BBBA i0(̢ 6FDD \ DBB ޞ( bCB4 |BDD0T DBA ^ GBE T0HlnBEB B(D0A8DPE 8D0A(B BBBA NAPأ [ A\$BNA zBBL< LBB A(A0D (A BBBC Y (A BBBA ȝ)0@BPQ R(P0A|0D(A BBBPAK BA0Q @HBBE A(F0GPu 0D(A BBBA 3P<qBOF A(D0G@B0D(A BBBОv@8 BEI A(GPp (D ABBA H9PHdxPBBB L(A0A8G` 8D0A(B BBBA `(Ц\TBAD IAB $t8BAH iAB@۟_ Xt'l$|8BAH iAB՟] $|IBMD rABK \ DD d A  RD q K 8 \L BBB B(A0A8D> 8D0A(B BBBA YXB0NrUZA' AM AA ,d (DVGBAJ vABp|8AQ(@AAA N AAA ȩ  $NBIA ~AB  ADBp( BBA D(D@\ (A ABBE  (F ABBE D (D ABBB a (C ABBA ]8@̪>B{I,8 BNA N(DP (D ABBA <!:PXD?AG uAx LAY@QAOԫ tASV@.BBB A(D0D@ 0F(A BBBF 0\@~ 0C(A BBBA TAM DA0 8Ȭ BSL K(D` (D ABBA f` 4G A Pd BBB B(D0D8GPWB 8A0A(B BBBB EeBEXBFVA0mSK\AH,BBB E(A0D8D@x 8D0A(B BBBA x/@ LlBBD D(D0z (A ABBA M (D DBBB ,60^ (A ABBE 4@aBDG0] GBE Y ABA xb0<\BBB D(D0D (A BBBG Я!;0U(Af$$<@KBAD zFB,d F DBA | GBE T8 BFB D(D0G@w 0D(A BBBE U 0A(D BBBH #@  դ'D \ A <PdtArQEK|<BBB B(D0A8DP 8A0A(B BBBE < 8D0A(B BBBE P 8A0A(B BBBE 40PP>8D0A(B BBBHh4 BBB B(A0A8Dpx 8A0A(B BBBA 4Фwpq 8M0A(B BBBE (WBEA E BBA o 0 !^A@ O IPL!d)D d8|BBB D(H@ (A BBBA (ۤ@HHYPDXB`I@WB Q oa A AZ4VH (\BAF ] ABA   4 BBD u BBB |EBش¤& xX BBE E(D0A8Dpb 8A0A(B BBBE  8C0A(B BBBE U 8D0A(B BBBF pPpL#kAi0#qBAD G0h  AABA B0$/$%$ AJ<$P$DBW G l % A A \ A 3#%@Az8Ķ&AAD  AAA ! FAA L @BFB D(A0G@ 0D(A BBBA \֣@P|(BAD D@K  AABA o  DABG y  DABA зLo@@C@ A d E N E X A D A F E J A A0[$HTOAi A ^ A Dp|Hx`BGB B(A0A8A@ 8D0A(B BBBA иУ(@(l;BEG hBB 8(GTx)ht)DsL A CL)#BBD D(G@B (A ABBE V (G ABBB (ع2@a(J ABBHX*fBEE E(H0D8KP 8A0A(B BBBH PL4dEBDD i GBB CAB( BAA ] ABA $ȺQE _ ABE 4*|BDD v ABA cNB(6  (D8&BED VBB p JBB+AG ]Aʢ ̻*TF yAR A T A  P(Af(rD E DHD"AXdX:Ab E *#JTAHAB~мHdBNB B(A0A8A@n 8D0A(B BBBA 4@T)"LUDpBEJ L(A0A8E@^8D0D(E BBB4ʡ3@X 8D0A(B BBBA  LBBB B(D0A8J 8D0A(B BBBA Ta;Ht(@BBE E(A0D8DP 8D0A(B BBBA 0=P99!A_h BBB B(A0A8G 8A0A(B BBBA BFFINSx֡h'0'BDD G0  AABA ֡|08`( BEA A(D@ (A ABBA 8\@T)h)8|)BBA A(G0 (D ABBI ֡X0+!DT E C+8+BBA L BBE  BBA Dl (`-AAD [ AAA Ƣ  $-<AAA vAA(.SAG@i ABA f@L\.BBA G(DPR (A ABBH  (A ABBE `P|/?Ac A \p/BBA D(G@B (A ABBE X (A ABBA ] (C ABBE  z@(/(</kBND0u ABA (h40KAD0a DBA H0BBB B(A0A8Dp9 8D0A(B BBBD p8zAx0-(H8BCG c DBA t  09AM A Q A  (9AL C A O V A Y{$$ PjAG A A E Z4_$L@Azh9@|9eBFD O ABB a GBB FLB (0ADE  AAA Ţ+ dAA(5AsDH\96BBE B(D0A8L@ 8A0A(B BBBA W>@XTBBE B(A0G8D` 8D0A(B BBBA HhXpBxBI`$`(Dh9/BAD l DBA ,pE h ABE MABH<:BEB B(A0D8FP. 8A0A(B BBBA ^ P< >BDD A(J= (D ABBE L hArQ`|AAD G ;6(8ByAG t AC b AE XBBBB E(A0G8D` 8D0A(B BBBA `hVpDxBI`Lաr`4lCaKDD U DBA gDBL HD5 BBB B(A0A8D@ 8D0A(B BBBC 6@(N\(<@BBA rBB h ABBG/AmNOK@{ALNBBB D(A0  (A BBBF Y (A BBBH <X%0I (D BBBE A(A BBBOSBB B(A0D8DP 8A0A(B BBBJ d 8A0A(B BBBE \ 8A0A(B BBBG @$rP<DHQ^GBB D(A0 (D BBBA ,0@HRLOG D  DABE   AABA I*HSBSG E(N0F8D 8A0A(B BBBA PTGl0U BDD G0  AABA ğ0VMA@ E 4nBDA A(A0[(D ABB(`R0HDVBBB B(A0G8DP 8A0A(B BBBD JP4BBG D(D0x(A ABBr0@BBB K(A0G@ 0D(A BBBA H@$hT7BAA oAB  HYJBB B(A0g8O@X8A0} (E BBBA f08WBEE D(A0{(D BBBP0p ZG ZDHoPHXM`Z@jV@Z;DY A Z=D0V A  [ LiAF q AA 4ٟ LZ(`l"BNA  BBA  LXBBB B(A0F8DC 8A0A(B BBBA 5>(TADD0k AAA @' 0(XYBAG0 DBC 0\ZBBB D(G`M (D BBBH u (A BBBD U (A BBBA  `L\BEE H(D0C (A BBBF R (C FBBI hj04]AAD [ AAE R FAA 01 ]^}A] A Y  AU88BBA A(A0 (A ABBA tĞS0,9BRP [@ DAB˞@8BBD D(D@ (D ABBA @44HBIA A(G@(A ABBlHJ@(BDGDB6\4Bq2Hh`BJP B(A0A8G.8A0A(B BBB`H\BBB B(A0A8DPy 8D0A(B BBBA P8BBA A(D0 (D ABBA (Ԟ0D 4XBBA A(D@(A ABB.I@(PDBDD j DBE $/- N DBA LHD R,% @<0T8BNA W  DABA ,ў@PHBI@BBB D(A0DP  0A(A BBBA 4,PRXJ`NXAPXJ`IXAP$4[qAAG0eAA\i0(t[BAA _ ABA $ۡg L JFH $\HHb E R4BED A(FPq(D ABB$ ¡PRXG`]XAP<HBBB A(A0r (D BBBA Y0;|,BAD j ABA $  ABE @<BBB D(C0J 0D(A BBBA vhl#Aa`#Aa$DZBBCD rDB  ,8TZ BAA v ABA hHT [8[gBBB A(A0K(I BBB00HA@H0<BEB B(A0D8D@ 8C0A(B BBBA |e@(2BEA _DB,Jt A qIFF A F0fBGH DP(  DABA ,n}P(HUD X(G0P8F@N I A HtBBE B(D0D8GP 8A0A(B BBBA WPLNAK@@A@Y,Y@XT(>Av E At `XBBB B(D0D8DP[ 8A0A(B BBBA D 8A0A(B BBBE 4OPS 8G0A(B BBBE (Y H<YrBII E(A0D8Fp` 8D0A(B BBBG Wp4[`AQb AAE p CAA mAZH\^BHB B(A0A8GpX 8D0A(B BBBA `p\=A` A Z(cFBED q ABA Ρ c EAzc,@(AbHn |`\cBDA D@{  DABC L  DABE I  DABA t  AABE r  HABI a DAB@4eBAG  DBE  ABE 4 LPEAzhnAa E G04BBB A(D0(D BBB'0xfIAM E u8fFBA A(D0a (A ABBA P,d x HBBH B(A0A8GP 8C0A(B BBBE DP PfX LfBGD D(D0R (A ABBC s (A ABBE g(A ABB|ǟ 0XtfRdBB A(A0DP 0A(A BBBI PP\PLXh BBE B(A0D8D 8D0A(B BBBA d0rDAAD q CAA AAA$2AAA lAArHrBEB E(A0A8D@ 8D0A(B BBBF T,:@HtHBDB B(A0A8DP 8A0A(B BBBA TP0uCBIG R ABA ALI8VBBG D(G@c (D ABBE ,Pj@M (C ABBA Lu) HTu BDB E(A0D8DP 8D0A(B BBBF P88BEA D(G@ (A ABBA P,@l}G A (P~BGD0j DBA 0L~BBD D(G@V (D ABBF T (A DBBA 0?P@LEAzh$aAF E 78BBA D(A0l (A ABBA (0A(D ABBC@0A| 6A A  NH 7BEE E(G0D8D 8D0A(B BBBA  :0 Dj A } E P d 71x H @BKI E(D0D8E@ 8G0G(B BBBE 4 1g@V 8C0A(B BBBA @ BBE A(D0D@M 0D(A BBBA T G@t (7-Bj 'Q $7A 8 7sBBA A(D0X (A ABBA  0@, 8BEE A(A0G@ 0A(A BBBA p e;@ 8A( 8BBDD tAB @  p |AV 4 h (H dBAD Z DBA t K H @8 BBE B(A0A8D` 8D0A(B BBBA  2` :< :BBB A(A0| (A BBBA LêE0\l?BBB E(D0I8DCDJA 8D0A(B BBBA 0PBNA8BEA D(A0 (D ABBA <Ƭ0X:'lL:BBE B(A0A8D 8A0A(B BBBA G(\AAA  DAA M 44JD A AH D AB D AE lݬ_ UE @|?8@A~l?h? 4AWL,0?KBB B(A0A8G`|8A0A(B BBBA|=s`dBBE B(A0D8J 8A0A(B BBBL  8D0A(B BBBE t(G 8I0H(B BBBE G 8H0H(B BBBE i 8I0H(B BBBE h 8I0H(B BBBE G 8M0A(B BBBE G 8M0A(B BBBE O 8F0H(B BBBE   8F0H(B BBBE v 8F0H(B BBBE G 8I0H(B BBBE b 8M0A(B BBBE  8F0H(B BBBE g 8M0A(B BBBE E 8M0A(B BBBE |=TBG EEC HXBBB B(A0A8GPZ 8A0A(B BBBK P$ L=[BEA NBBHMB `\(tc AddBHE E(A0C8DpxSWxApxQOxBp 8A0A(B BBBA {p<;Ay,3DXGD`B\3`p|BBB B(A0A8GDeBN_AD 8A0A(B BBBC ADdBcMSASH$hPBKI G(D0D8F@ 8A0A(B BBBF pb@dLBFB B(A0A8D` 8A0A(B BBBE  8F0A(B BBBA b``DDMED B(A0D8L`k 8A0A(B BBBB PH`|0Vù h@:^H8EBEB B(D0A8JP 8A0A(B BBBA @9GP(` :SBAD j ABA 4! HBIB B(A0A8D`Q 8D0A(B BBBA S`$9ACD PAA< T(AS8p,BEA A(G@V (A ABBA Z@FL`AS E dBBB B(D0D8DZ 8A0A(B BBBE q 8A0A(B BBBA 47@k8G0A(B BBBlOBBE D(D0D@i 0A(A BBBJ K 0G(A BBBE | 0C(A BBBA ,Ϲj@HLBGI B(A0D8Gs 8A0A(B BBBA ͹:47A\ϻ0BOA ND  DABE 8(46BADA p AAE `~3 f DAA (LAG P DBA a  (6wBDA lAB$*  A ABE 0AV(HAHH0h AAA t 0DAA($AT$,XDX E N E Y A @PcBEB B(A0A8D 8A0A(B BBBE H 8D0A(B BBBE EIBD 8A0A(B BBBA  8A0A(B BBBE K 8D0A(B BBBE `IGBl 8D0A(B BBBE W 8A0A(B BBBE x 8A0A(B BBBE }CGB-FGB| 8A0A(B BBBE W 8A0A(B BBBE F 8G0A(B BBBE GGB]FAAVK 8G0A(B BBBE FODIGBFFB9FFANKAIVAFGBA_ALNA FKEKFKACGAgFLFIrFGBF 8A0A(B BBBE YCFA 8A0A(B BBBE VHKAFFA!XF0(>UnBEB E BBA RBB\>. `JB8|>0UBBA D(DP[ (A ABBA >{=P>UAS E A(>A A  A X A  ?P8?UFL y(P?UBDA  ABA |? ?HVpAh0EAL?VBBB B(A0A8G 8D0A(B BBBA @_$@HZD@L<@ZTBBA D(G@p (A ABBE V (G ABBE (@л @D(C ABB@[/D j@< @[+AiA(A[`BDD0x ABA DA~'0\A[ pA[A`0eAAY]0ADJAq A LA~KA[$A[bAJU0AABu084B\BBA A(I@a (D ABBA pB>0@B@\eD0`8B\BBB D(G@ (A BBBA Bm@$B@\LAG0EAA$C'20,BBA D(D@ (D ABBF <xH=@q (F HBBE I(H ABB<HdaBBE D(C0^ (D BBBA H`S0LItBBB B(D0A8DZ 8D0A(B BBBH hICb`I KBB B(K0D8GPc 8A0A(B BBBA ^FPI!P JT KBB E(K0D8DPr 8A0A(B BBBA 9 FPH 8G0D(B BBBE JWPJ_<J`BEE D(A0 (A BBBA K0<$KaBEB E(D0D@0C(B BBBdKU@lK8bXBBE B(D0A8FpoxsAAUpxHTBUp 8D0A(B BBBA 0KNp@xhAAPp(LcLF@Lc$Ab\L`tLcBFB B(A0A8G 8D0A(B BBBA  PBBIL!@LDjBBA G0P  FBBA A  JBBE +BDE RGBhYo- fDB$YuPAG [ DE _DYuY@ Y>aAG X AA (Yu6BDD hAB (Z  AGB8LZuBDD  ABB J ABA 4ZD>|BDD v ABA cNBZS  Z0vZ{BAD p ABA D[! $`[uQAN W AE _A[@ |C[vpAn[[Dv@AzX[=BBB E(D0D8GgZRA 8D0A(B BBBA P\Lp\upAn\,\(v@AzH\LvBEE E(A0A8L`  8A0A(B BBBA  ]`(,]PAAb A ^ E D B DX]r-$p]AOBGA AAB]_1 ]Ly ]Hy]P]@y H^lA BBB B(D0C8G` 8A0A(B BBBA L^`l^x^o8^ABBA D(D0i (D ABBA ^$0$^px=BAI mAB_|  ,,_px2BDA k ABA \_>2 $x_dyABAD vABH_y\BBB B(H0C8D@T 8A0A(B BBBA _@ ``ABEB B(A0D8D`j 8A0A(B BBBH hOpThB`ChNpRhA`3hRpQhA`XhQpQhB````yAU<`@RBBD GP  ABBA AXV`RXAP aVP8(atSBBA A(D0 (D ABBA da0HaSBGI B(I0D8Gp 8A0A(B BBBA aep$axFAAD0}AAb'0H,bTBBB B(A0D8D^ 8D0A(B BBBA xb||bTVgBBB B(D0A8DpC 8A0A(B BBBB W 8H0A(B BBBE H 8H0A(B BBBE cep08c$YBAA G0Y  DABA lc00cYBIK G0X  DABA c,0Hc4ZBBB D(G0N (D BBBG K(D BBB$dQ.08@d\ZBBA A(D0W (D ABBA |dZQAo E 8dZBBA A(G0[ (A ABBA d 00d|[CBIG R ABA ALI4$e[ SDD0| ABA xL0\eT0`teX\}BBB B(A0D8FP 8D0A(B BBBA A 8G0A(B BBBE ePeT^*Da A Hfh^BBB B(A0C8GP 8D0A(B BBBA `f:P8f|tBBE A(D0(A BBBf0ftBN E C0f`aCBIG R ABA ALI0g|aBEB B(A0A8D`{ 8D0A(B BBBA k 8F0A(B BBBE  8G0A(B BBBE D 8F0A(B BBBE  8I0A(B BBBE ? 8I0A(B BBBE  8F0A(B BBBE hDpFhA`hDpNhA`0hvH`| 8K0A(B BBBE  8K0A(B BBBE  8K0A(B BBBE b 8K0A(B BBBE D 8K0A(B BBBE _ 8K0A(B BBBE Hh|5BEB E(A0A8D@n 8D0A(B BBBA 0i;@0PiCBIG R ABA ALIid YQ DTi8rBBB B(A0D@H 0G(B BBBE ^0D(B BBBLiBED D(GPg (A ABBA  (A ABBJ LjNP`hjBBB B(A0A8G`{ 8A0A(B BBBJ o 8A0A(B BBBA j`,jpBAA b ABA k`qNH0kqUBEE E(G0A8GPk 8A0A(B BBBA |k#Pkr1AkHkr%BBE B(D0A8G`o 8A0A(B BBBA l&`@$l؈ BBE D(A0D@7 0A(A BBBA hl>@lAi E v$lr^AFK0IAAl#00lsBAA G0t  DABA mv.08ms:DLmtfBKB B(A0A8DPA8D0A(B BBBm,Pmt4ArxmBBB B(A0A8G ACHGGGGGGk 8A0A(B BBBH HnDhns|ns(Afn nsnPns7WHB F(G0A8DP 8A0A(B BBBA c$ox 88otBBA A(D@y (A ABBA toG-@o t oti]o,oo8tAD |o $p\tBAA AB8p DPp<BBB B(A0D8G`_8D0A(B BBB,pxBDD c ABA p $ptqBKA _AB qN L$qxBBB B(A0A8G. 8D0A(B BBBA tqLqs BLF F(A0D8G 8D0A(B BBBA q7[Hr8}dBFE E(D0D8DPX 8D0A(B BBBA Pr& PHpr<~NBFE E(D0A8GP 8D0A(B BBBA r Prrs~sA$,skAAD bAATsH  HlsfBEJ I(D0f (A BBBA N(A BBB,sNBAD 2 DBE s $tKAKD xAA,t- Dt؀+XtARpt܀At@AD vCtcj I DA ,tAD Y AE c AA t}l D CE uXIBr A H E 8uPuAOhu|uD PHu(eBED A(F@z (A ABBF D(C ABBu5!@Hu BBE E(D0D8DPT 8A0A(B BBBA $HvPPXP`DpvBBB B(A0A8GP8A0A(B BBBvP(vDWBDD y ABA $w80ADA gAA,w  HDw(BHB B(A0D8Dp 8A0A(B BBBA wL)p\w\SBBD G0^  GBBE Z  ABBA   AFBE O  GBBE x,0H,x@6BEB E(A0D8Dp< 8L0A(B BBBE 4xxkpS 8C0A(B BBBA 8xBBD D(DP (A ABBA xPHyĈBBB E(D0A8GPV 8D0A(B BBBA TyOdPty"8y4QBED C(D0X (A ABBA yXLG w AA yQ z"(z؊BGG AB(@z<BAG  DBA lz6 nABHzPdBBE E(D0D8DP 8A0A(B BBBA z$P<zPBBE D(A0| (A BBBA 8{z0LX{tBBB B(A0D8Dl 8D0A(B BBBF {"=${Ai E A E v0{<~AAJ v GAB mCA@$|BAA D0  DABA v  AABE h|0<|ȍBBB A(A0^ (D BBBA @|IBBG G@h  ABBA HSPDXB`I@$}@RHWPBXB`I@0}8D}DAYL\}-BBB B(D0A8GP 8D0A(B BBBA }$}`lsAFO}!O`~<2BBB H(D0A8Dpr 8A0A(B BBBE l 8K0C(B BBBE t~5rp~@Ai H I4~iEJD w BBB TBB~/ ԍAF4؍AFLЍAFdȍAF0|BID D@c  ABBA |?@HpGBBE E(A0A8Dp 8A0A(B BBBA 0SGpn8K0A(B BBB@LBEE E(D0D@Z 0A(B BBBA "?@@\BAD Kp{  AABG u  AABA p,|BAA L ABA @N P\PHBEE D(D0DP 0A(A BBBA [XY`DhBpIP(^PeXZ`BhBpIP<܁BBB D(D0g (A BBBA 0<04P[KRJ AAE p CAA m$Ab0BLD D@r  ABBA @@ BEE D(D0DP 0A(A BBBA 8P# PAXZ`BhBpIP[XY`DhBpIP@BBD Do  HBBB Y  DBBA ЃyBBE E(A0G 0A(B BBBA x 0J(B BBBF \ 0G(B BBBE R 0L(B BBBE _ 0M(D BBBE c 0M(D BBBE 6Є(LBBB E(A0 (E BBBA W (E BBBE 4H0TGa _C p xCA[ eA`A]Ѕ(D _ A d BBB B(A0A8D 8A0A(B BBBA  8A0A(B BBBA TJt'AaHBBB B(D0A8G@q 8A0A(B BBBA ܆`@ KAELTBBB B(A0A8G 8A0A(B BBBE hy;$6ADA fDAlLȇT6T܇NBB A(D0GP 0A(A BBBA aAP4%PT%KY@lBBB A(A0D@u 0A(A BBBA @Ј<*AY`@BBB B(A0D8D`hDpIhA`D 8A0A(B BBBA hApJhA``#P`6`J K<I r# HȉJBEB E(A0A8Dpz 8D0A(B BBBA wpH4!LBB B(A0A8D 8D0A(B BBBA L,AbXQ8ԊHBBE D(Gy(D BBBh,@ BBB E(A0A8G. 8A0A(B BBBA PAGFIP^#AaЋ1HBEE E(D0A8GP 8A0A(B BBBA 0m1PPDv A lb9@L BMM A(A0Q@ 0D(A BBBA ČC6@0=BED G0]  DABB $%0e  CABA (@AJM AAA l]]8BLI A(Dp (A ABBA ffpH܍ BBA J(DPu (A ABBA HXP`DhBpIP((dsPfXT`BhBpNPT:FpAp 0BNA W  DABA ,P}SDBIpAh0EA L)Ag8|4LPBLR A(D`(D ABBM#`X< BBB A(A0G 0A(A BBBF  0A(A BBBA `pF`0LBBB D(D0_8E@G8A0A (A BBBA A8E@G8B0C8E@G8B0"0x!ȐXܐBEB B(D0D8F`S 8D0A(B BBBA hApmhA`8Ch`XlwAY<XDBBL A(A0d (D BBBA đh$ؑ4UAFK0@AA@0TAY0-hHHBBE E(D0D8A@ 8A0A(B BBBA &@ؗnR0[̒#0(nBAD s ABA  ; X$HBBB E(D0D8GpxBXxAp 8A0A(B BBBA o{p @AJ i AA (ē'BMA ABz6 (9BBD hBB 4l LBBXt_D0ZpA800KAA K ABA h$1; kIBHLBBB B(A0E8G` 8D0A(B BBBA ,,`HhYpDxBI`l\VBBB B(A0A8G#EYAR 8A0A(B BBBA ~E`B̕,BAA D0 AAB=U08?A_ E YXVHljBBH A(D@ (D ABBA gHVPDXB`I@o@(ԖCBFDPf DBA <ܥ)BBB A(A0 (A BBBB ,@0E (A BBBA pLD ST!D\DlkBEE E(D0D8E@8D0A(B BBBg @)Ac$6A<BZXHp ~BIB B(A0A8GP 8D0A(B BBBA P$ܘ iAG q DE ZH<haHEE D(A0(A BBBADAL(\BAD T DBA  XBBB B(A0A8GpxWhxApW 8A0A(B BBBA *p([BDA GIBHH$BBB B(A0A8D`R 8A0A(B BBBA e`LBBB B(A0A8G_ 8A0A(B BBBA 9L$ZKB B(A0A8G 8A0A(B BBBH 0tBDD G0[  AABA /04ěXUBEE G(B0u(D BBB0d+Ai48L BKL A(G (D ABBA F$XAAD0OAA̜C0WKK,rBJH D0U AAB,x0,HBKF Gp DABxIp( BAD b ABA ! LܝBIB B(G0A8Z 8D0A(B BBBA 4,Y AVDBIHd BBB B(A0A8Dp 8D0A(B BBBA pОHBq A 8jBIH A(G (D ABBA (=DبPAh eAdPAh eAG,AjJԟALHBEB E(D0G8JPn 8A0A(B BBBA <JP\p*$DBAA |AB& HĠBEI E(D0D8D@` 8A0A(B BBBA @0A`0hAP_]0hD@HwDPBEE B(K0A8GPk8D0A(B BBB7PBEB B(A0D8G 8C0A(B BBBA HEBBerWEGNo 8K0A(B BBBE  8G0A(B BBBE we,̢BEA G0 DBB0`4BPG I(A0G8G 8D0A(B BBBA QXBBI|0`BKC Gp}  DABA УmpOAq A [ H$BBE E(A0K8DPV 8D0A(B BBBA p{P|8_BPL H([(D BBB0' RIBIDBLP L(H0K8E@8A0A(B BBB4\q@Z 8A0A(B BBBE (?BDD qABL\_BIE E(A0D8J1 8D0A(B BBBA q$0LOSG ^AAA X. (p\ADG0p AAA c0<(BBB D(D0Y (A BBBA 0h(T<`BBE B(D0A8G`hApUhA`G 8D0A(B BBBA I`ȭyA`0VAԧ#0PAh eA @PAh eA<,pBEE D(D0\ (A BBBA l0A`0_A@00ĨJ~ E Y A P E A B _$ OA\ E Y A N(4=ADD _ AAA `w HxBEE E(A0D8G`S 8A0A(B BBBE 4ĩ%`~ 8C0A(B BBBA $@AAG0tAA$0@<BBE D(D0G@ 0A(A BBBA i@<MBBE D(A0 (D BBBA ,%`0\ (A BBBE HܱBBB E(A0A8E@ 8A0A(B BBBA 4\ 9@^ 8D0A(B BBBE (hADD S AAA  HثԲEBB B(A0A8A@ 8D0A(B BBBA $+@HD(BKE B(A0C8DP 8A0A(B BBBA @PLBEE E(A0D8D 8A0A(B BBBA I( nBHJ UBBL Hh$iBBB B(A0D8J` 8A0A(B BBBA 4]NDBHAWHBEE B(A0D8D@ 8A0A(B BBBA dg@<zBBE D(D0D (D BBBA Į,05Ak(ܹAADP AAA ,P(DAAD0\ EHE pk{0Z CAA nAcA A ̯ }A A y)hLAB n L8BBB B(A0A8G 8A0A(B BBBA /<BBA A(GЀk (A ABBA ЀT7Bt$S0<0 HPLMBJI B(A0K8DP 8D0A(B BBBA  P(iBEK SAB BJE B(A0D8DP 8D0A(B BBBA Q 8J0D(B BBBN M 8J0D(B BBBE I 8E0A(B BBBA 4PH WBBD A(D0V (D DBBB _(A ABBL0$ gADD [AA$0,ADB |AA4X0 S DAE A AAE ADA\QBJ *г (xAAD  DAA A ((T6ADD c CAA T/ $lPAAD VAAx@vBBB B(D0G0A(B BBB: AH D [T0LmBA A(A0J (A ABBA t (D ABBE z8 BBA A(DP (A ABBA ĵ>P\\AZA8(BBA A(A0p (D ABBA d820 ̿ AG0A* 0XA` A uܶ+^ E CDyGBE D(A0J (A BBBA SD 0dAR|C$NBFG@{ABUY@Էh $JF4 BEA A(D@(A ABB$F@(@lBIA BBl9 FAK xA3 $BNA BB (lBAD ` ABA ,^ 0D BEA D0  DBBA xvA_ A T<FBB B(D0 (E BBBA D0 \AG k AA 4L 4LBIE A(F0(A ABB,*0K (A ABBE pxBBE B(A0A8N`hXpIhA`[ 8D0A(B BBBA i 8L0A(B BBBE (VD`H(D c`b/ t4 LD u E IIF x A H$Ļ|BAD@nDBK@L BDJ H(A0A8N% 8D0A(B BBBA TDtxSBB A(D0 (A BBBK A0ܼ4Bq$" @4Bq(d4Bq@DBBH E(D0Oe 0A(B BBBA HBBE I(A0H8IP8D0A(B BBBxt0pBPT P? DBBP$lBBAA zAB$B[ A $ľ<BAH mAB$jBAH [AB(XHBNA 2BB@ Xd#F\tx$t@BAH qABV8 ȿt@A~^%hAY A LO',PT {LDBBB B(A0A8DZ 8A0A(B BBBA  ,BUA D@ DBB6@(|ADA d DAC ,  ,D BHD  ABA tu (|IAA AB   EABJD0@ A n0>A|,,DBAA n DBA t  AABAFND n A BN E C<BBE A(A0 (A BBBA ,[0L```\\BBB B(A0A8D 8A0A(B BBBA D 8H0A(B BBBE 4MO 8H0A(B BBBE  wR0d@08(BBB D(A0U (A BBBA d0RAG`PAh eAAHb A +`\BBB I(D0A8DPe 8C0A(B BBBA D 8G0A(B BBBB Th htAF p AA  DP`@P<0AfPlAG0xA, ,1MAA ]ABA4P  Y(O0P(A W DBE kHLBIB B(A0A8G` 8A0A(B BBBA  `0KAB A P} hQPi A KO (9HAG@YABAj@6Al$*eA_@<%BBB B(A0D@ 0D(B BBBA 3@3AZAA@A~v (qHAA cAB DAD0 AA h]A[40sAAA e AAE AAA40 ,,"BCF  ABA $  e DBE 0H)AAD  AAA qAA| 'XK\AZ#,OAIAL$HBAk A @|Txht|p&a AFtpnR0[)#0#$$]AAH PAA8 AAAXCAApK yYA` vAF  8Av,/VD XUAStK E <AP JAHTP-Ag T#Aa0|:u8HTBBA A(A0{(A ABBb:0GAEnR0[L#08BBD A(D0 (A ABBA ${04@lVBBA A(A0H(A ABBxYA` vA& A[(BDD  ABA  <FRA,d@8A[(XADA z DAE 9 HpBBB B(A0A8A@ 8D0A(B BBBA @At A $S9H8$BBBB E(A0D8Gq 8D0A(B BBBA ,_(6BBA kBB?3 ,|BAA c DBE & 84OA{ I $ThSAAIPEAA$|ABKE `HB ADBLBBA A(KP (A ABBA  XU`BhBpIPN7P0AH A PI9 A(X0B8B@I 8t(/BBA A(I0 (D ABBA "m0<BBE A(D0 (A BBBA ( 3@0o(F BBB8t@AI tAX'L p, G THAM Z AB  FAd`\,D g; ,,`4BHA DP` AAB\LP$xD BCD AB  S A^ BY A C  iBD A EA <`  (T fAKV0s AAA 0lwBAD D0b  AABA !0(DFDD m ABA 4 HBBB D(E0m (G BBBB n (A BBBA `dBBB E(A0A8D` 8D0A(B BBBA 8D0A(B BBB6D`(AADA J DAE  AG0M AA 8 00P BBD D@  ABBA O@@| BEE B(A0D@ 0D(B BBBA b@(ZBBD MBB0 4L 5BDD \ DBB ACB ^Df A bxbA[ DAI ( AKV0P AAA  *00< ,Aa E L5td8!G U| ]0 BDA D0c  AABA 50HBBB B(G0D8GP_ 8A0A(B BBBA 0P$P\%ADD WCA(xd_BIA NBBBI @ {BDD O IBB _ IBE [ CBA +2 8  "BBD D(D@o (D ABBE ,\N@r (C ABBA 4AAD \ AAE w AAE  Y CAA HTBBB B(A0D8D@Z 8D0A(B BBBA 4@<TBBB A(D0~ (A BBBA 0(XLBDD p ABA | 8HAk A Q A d>Ax4-Y A N(ThBLD0X ABA D0@BBB B(G0D`B 0A(B BBBA nu`4zBAD JB  AABA 4 P dHxBEE B(D0A8G` 8D0A(B BBBA `,XBDD [ ABA N 0$DAY(\EBAA }AB H&d 8`wUFD  DBA CB$I  AABL0\BBB B(A0G8GK 8D0A(B BBBA 4tXBBI(UKDG s DBA  'E (BDG0L ABA (0@nR0[X#0l@PAh eAHpzBBB B(A0A8D`g 8A0A(B BBBA )`3Am| L,VBBE E(A0D8G 8D0A(B BBBI 0|H[BBI@ LDE A(I0G@ 0D(A BBBA L@H$L('BBB E(D0D8Dd 8D0A(B BBBH x$[AAA UAA } AKlAX A 8$9PAD  DBA k ABA `-Ak|pFDD _ DBE ( bCB 9 49Bb_LH`9BIB B(A0A8Ip 8D0A(B BBBA p4PBAA a ABH sAB,  ;hj l8L`L;_Dr A f#h!G U ]h4;0;XPL$>BIB E(A0A8G 8D0A(B BBBD nHtCBEE B(A0D8Dp 8A0A(B BBBA TVp(t~AAG0h DAA 0F#F/Db E CLF!LSB B(A0I8L 8D0A(B BBBH <)ED\NBBB B(K0A8A@8D0A(B BBB ?A` A E A PgFBB D(D0N (D BBBA  (D BBBE b08<AJD0w AAA N8V@DHBPI0x0L,BBE B(D0A8G  8D0A(B BBBA I BAI vA 8 88IBBA A(B0 (D ABBA ,tq90P (A ABBE 8BBD A(G0 (D ABBA >\0@IBAA JP  DABA J  AABE @:HP(\LAAB | AAE ,: A CAE L AAA 8BFD D(G@\ (I ABBE ,}@} (C ABBA $(KHA_ B Z A D0XDKBDD G0p  AABA @XAu H 5f A LxK> BBB E(A0A8D  8D0A(B BBBA 9$4HXH~ A W A _ A \(tTADD w AAA V !A_) $KADA BAA ,W@ThW/Db E Cx8|BBA D(GPW (A ABBA FP@BBJ A(A0L 0D(A BBBLvAQ B A(l=BDD c GBB @ CABaA_8 BBB D(A0(D BBBH,vBEE D(I0y (M BBBE A(D BBB(xUcIDA j GBE " \CBgAeXBFB B(D0A8D`H 8A0A(B BBBA ihXpExBI`@`@`<BAA ] ABE A ABE LAB TBHF B(A0A8DpCxOQxAp8D0A(B BBB0T@BLA Du  DBBA LxhUBBB B(A0A8D@+ 8A0A(B BBBE Z 8A0A(B BBBL D 8D0A(B BBBG  @H(BBB B(A0A8Dpf 8D0A(B BBBA Pppp @D e E F A FH4V*BBB B(A0A8DPo 8D0A(B BBBA jP88SBEE D(D0w(A BBBP 0`pV BEE E(I0D8GPN 8M0A(B BBBB  8D0A(B BBBA 0qPD8A0A(B BBB(WBGD@^ ABA 4$@8L`vBBA A(C0V (D ABBA 0$mBAA eAB`"HVBBE B(A0A8G@o 8D0A(B BBBH ,!@HL@W:BBE E(D0A8D` 8A0A(B BBBA rx`4BEE D(A0(D BBBHlBEB B(A0A8D 8A0A(B BBBA <e\pW TpHBEE E(A0D8GPSXK`JhDpIPB8D0A(B BBBHWBBB B(A0A8DP 8A0A(B BBBH FP4X PHBHE B(A0DpfxFJBVpf0D(B BBB:Ap\*BBE E(A0D8DP 8D0A(B BBBE D8C0A(B BBBLW3BEB B(A0A8G 8A0A(B BBBA h,P BIH G0 DABjj&>At0aBDD G0A  AABA 0[ [0HLBBI E(D0D8KPf 8D0A(B BBBA 4N PZ 8D0A(B BBBE ,i BRD e DBA 0  80BBA D(D0D (A ABBA l L,gBBB B(D0A8G; 8D0A(B BBBA 8( 8D0A(B BBBE T BBB E(D0A8DpxxHWxAp 8A0A(B BBBA dPp/HBBB B(A0A8A@ 8D0A(B BBBA @ ,BBA  BBA HKJ d8xD@<hBBB A(A0n (D BBBA c0<YBKD A(Gv (D ABBA @`d\BBB B(D0A8DP 8D0A(B BBBE  8C0A(B BBBA 8P= 8H0A(B BBBE d\BBO B(A0A8Gk 8D0A(B BBBA R 8E0A(B BBBE h,BFA X ABA uA $[BAD0PAB^E08(gBED A(DPh (A ABBA dOPlHgBHE E(D0A8GP. 8D0A(B BBBA P   AY0,  BDA G0  AABA ` o0| pH lBBB B(A0D8G`[ 8D0A(B BBBA  `H hBEE B(A0D8GP 8A0A(B BBBA H PHh t-BQB B(I0A8G 8A0A(B BBBA  `O 8  {H lbBBB B(D0D8DPc 8D0A(B BBBA H 3Ph ,Ab {Q  a$ lTD N(H0K(A R A  * H ldBBB B(A0A8Dp 8A0A(B BBBI L p,l BAA F ABA  Y P tBJE A(A0G@HNPEXE`I@q 0A(A BBBA  8@, qbBBB B(D0D8FBIBID 8D0A(B BBBA BNGjHQG]HNAo0 crBEBT`tBEB B(D0A8D@f 8A0A(B BBBA l 8D0F(B BBBE x9@HdBBB E(D0D8A@c 8D0A(B BBBA u"@X:BHB B(D0D8GPGXL`LhHpIPJ 8A0A(B BBBA tPX'LBH D(G0GP` 0D(A BBBE D 0A(A BBBA \k A,Ab4HQ8L BGD D(L (A ABBA H#BEH E(A0D8GPg 8A0A(B BBBA #PAYHr}BBB B(D0A8DpI 8A0A(B BBBA \UspH| EBOH H(H0K8U`e 8D0A(B BBBA \ `H BNB B(A0A8A@ 8D0A(B BBB4@4TXeBHE A(D0B(D BBB0MBDD G0k  DABE $0z  CABA (;BEG hBB (0tTAIG0W AAA $\PAAG0AAx00YLAD s ABA IAB (>BDD j ABB  CAB$8$BAA [AB `zL Y ABA ]Af A t.iAF `A|% s BI` A  Y 08$BAA Gp  AABA $lpX  AABE (EBDD wAB P  AGB8r`AA D0%  AABA   0 <@Ag@i AA `Y@$xaAAD0XAAO0$D<BID0iAB0$u  A0 aBAA G@G  AABA T@pt,(BDD s ABA $1 G ABB p*LHtpBIB D(D0D`~hKpUhA` 0A(A BBBA Te`$tXBAK FAB@"AX<vBBB D(D0 (A BBBA q0<BBE A(A0Y (D BBBE @X#l0n (A BBBA [ (D BBBE 'XK,(vBDA  ABA  <vBBB A(A0j (A BBBA @,Ab\(pAUFH}(sBAD L ABB Lv}BAD ~ DBE  DID D CBE  CBE $ t CBE H"AL A d2AG hA,X (LBDD b ABB @% _CB#AYx (VBJA DBBH dwAX A qEA{ ,aBDD  ABA qV 4(LBA A(G@(C ABB<sb@X)@lQBAA G0  DABA Z  AABE a0AF<BBB A(A0S (D BBBA ,$G0S (A BBBE TAZl HKBHA A(D`QhPpDxBI` (A ABBA (x`{hTpBxBN`EAz(+BEA I BBA @, \AxN(l9IDE `AA ADA@`BBE D(D0D@p 0D(A BBBA  4'@$@ zBNA dBBh   8Me R8 \BEA A(G@a (A ABBA  <@!s& !CD c E F A Kd!(x!dt7BDD W FBE $!& [ CBA H!BBB B(A0H8D`y 8D0A(B BBBA ,"nW`hVpDxBI`H"$*Ad`"}2Y A $|" AFI AA("k# R CAE AAA,"lwBDA D0d DAB#2e0#s 0#D#S8X#rABBA A(M@$(D ABB8# @HHPPDXB`I@lHTPBXB`I@\#sBBB A(D0e (D BBBE T (D BBBA O (A EBBE 0$00P$sBDA Dz  AABA $X?P c E F$xHL$ttBBB A(A0 (D BBBF } (A EBBA %=08(%DBED A(G@c (A ABBA d%@0%BDD G@\  AABA %@%,(%UADD { AAA (&t\BDD g ABE ,<&K x EBE ACB@l&BBB A(J0D`M 0A(A BBBA ,&`ahUpBxBI`&LtL&BBE B(D0A8G 8D0A(B BBBA D'd's 4x'#BBB A(A0(D BBB'{"0'sH'\# BEB B(D0C8Dp 8D0A(B BBBA ,(!p8L(0BBA A(D@l (A ABBA (-s@((1H($1BEH B(A0A8G` 8D0A(B BBBA )."`H$)h3BBB B(A0D8Dpx 8A0A(B BBBA p)u/pH) 4BBB B(D0D8Gl 8D0A(B BBBA )/$)5UBAD JAB$*[/  $<*5'AIE NGAd*'/ ACA*5AU*5*51*.AUP*5BBB A(A0> (D BBBA f (A BBBE 0+x.@0P+l79AF@pAp+7+d.+49.AF@eAH+D9 BBB E(A0A8Gp] 8A0A(B BBBA ,-sp$,B.AF@eAD,BAWL\,BBBB B(A0G8J 8D0A(B BBBA 0,.HXBBI0,n^BBD D@  DBBF -u0J@(0-oiAAG o AAA $\-oD0@ D H A { E -O0`0-C (-CBDD U ABA -$DAQ\-,DBBB B(A0J8Dpu 8A0A(B BBBA hxPDBIp0P./pJxTBBIpL.HHBBB B(A0A8P2 8D0A(B BBBA 4.E1BUBBI /J8 /nBBD D(G@O (D ABBA \/1@x/JtD W A /02" $/J,BDE SGB,/2H f DBB J CBA 0J&40JPBBA D(D0y(D ABBL010h0J+AG0aA010H0JBBB E(D0A8GPb 8D0A(B BBBA 0f1P 1K 1K41KAYHP1KBBB B(G0D8G 8D0A(B BBBA 011YXBBI(1L<6M^Hd<tBBB B(A0A8JPd 8A0A(B BBBA <6*P(<VAAM0X AAA <7-0=(WKAI0=7H=DW $\=@WDADA {AA=7 $=PW ADD TAA<=HWBEE A(A0D@0A(A BBB0>7@J 0A(A BBBE <8>WxBBE A(D0] (A BBBA x>470>WAO`>WBBB B(A0A8DP 8A0A(B BBBE O 8A0A(B BBBA ?61P4?sH?s\?0Xp?0XXHlBBA A(G0F (D ABBD S (A DBBD v(D ABBH="0DH;"p(pMrRBDD0u ABA M=400McBAA D0  AABA M`lSPh.AIO TDS`hBBA D(GvL[Ax(D ABBS>%ShThDYT_?0ThDThEAz`ThaAT E T?TiAFT i$D _T>  TPtT>Uh#AaU>0UhD0x A LUx>0`U|ietUX>#Aa4UiBED D(A0o(A ABBU+>w0,UlsFAD T ABA VV>h (,ViqBAA | ABA XVv> 0tViBOQ K DBB,VD>fAOIBIHVjOBB B(A0G8JPd 8A0A(B BBBA $W.>pP0DWr_BBD D@  DBBG xWJ?'@(WxjAX8O@R8A0AW)?0WTk8WPkBEA A(G(A ABB(X?E$DXkAAA RCAlXkBAD X?I X8l $X4lIAAA CAAX? 4XDlrEJG A(D@P(A ABB0YH?*@HLYplHBOA A(GgHRA(A ABBY ?ZYXm5AsY0?>0YlmoBKC IQ AAB4Z&?AGD0V8U@BHBPI0AA(LZpmQBDA FABxZ?g ZmZm ZmZATZ?4Y A RZp  [m  [mAW8[mAD0|P[h?08d[mBBA A(B0F (D ABBE 8[5?10A (A ABBA [(D ABB0[mmBBD D`O  ABBA \><`,\n>@\?%ATX\nMl\>AU@\8nBBD GPu  ABBA D  GBBE \n"A\\> @\nBJI A(A0D@w 0A(A BBBA 8]R>@ X]oBPBt|]oBFB B(A0A8G 8D0A(B BBBA DAG\~KIDI]=YL^xmBBB H(A0A8D2 8D0A(B BBBE d^>^q+Ai^2?d^rBGF B(A0F8DH 8A0A(B BBBB i 8A0A(B BBBE  _>v$@_q>BAA cNDh_@ WCB$_qAGD0tAA$_@c0A8U@BHBPI0(_TACD k AAA $`(q}AGD0nAA$,`@c0A8U@BHBPI0T`sh`@ $|`0qzAGD0kAA$`@c0A8U@BHBPI0@``q:BFE D(D0NP 0A(A BBBA a@_P0aL;Da@,XareBCA Q0I AABa@I0Xa8rnBEE E(A0D8GGbA_8D0A(B BBBbY@$ b,s$BAA [AB Hb@L Y ABA $lbs_AD i DE dCb@B b0s]bAAV<bdsBBB A(A0{ (D BBBA c@w08cs8LcA `cs@tcs}BBE D(D0G@ 0D(A BBBA c@1@cD0T A c@.0 dtGwBQ\,d@uBBB B(A0A8GJdA 8A0A(B BBBA Td-@\JIBGcBGPAdw(dwbBAA VAB$eD  @eBDD j ABB xlC CAB$l{9BDD0kABltC0$l{}SZ B m A _mRC%E8m{BBA A(A0 (D ABBA Xm#C0tm8|.AG dAmC m0|AQm8|YQl D m||$mC,D0R A D8D@DHDPn`|#D ^4nC' HnFAj A YhnC 0nCBIG R ABA ALIn؅nB\nCnЅg YX Ko`0o|{AQHoTGPdo؆)MBB D(A0Dp0A(A BBBALp4oBBKpm 0H(A BBBE o|xD l A  p9B 0 pzBAA G0a  AABA Tp Bg0$pp|TBJD }DBp.C  AABpzUBB A pB$pzLADF {DAqlC ,0qzBAD G0 DAB`q,Cv0 |qP{\AD B AA qbC 8qBDA A(F@ (D ABBA qCJ@Lr{BII G(N0A8Gb 8D0A(B BBBA 4`rC@XBBIHrBBE B(A0A8GpX 8D0A(B BBBG rD(ps{T8s$|\BPL H([(D BBB0TsD RIBIsuED0DsBBB B(A0D8 0A(B BBBA sE 8t|8t|BBA A(D@D (A ABBA XtYE@4tt}?BGK ] BBB ADB(t }4BAC e ABA tD  8t}BEH A(B0t (D BBBA ,uD/0(Hu}pAAG0` AAA tuD%0@u}BHA G@L  MABE Q  CABA uZD@`u0~ABDB B(A0A8D 8A0A(B BBBA kNAI`PvyDDpvBBB B(A0A8Dp8A0A(B BBBvDpv4hvQBKE B(A0A8G  8A0A(B BBBA AGGFJ`XwD!$xw2ADC gAAwADxwE w@wăBHA G@N  MABE Q  CABA ,xFE@0HxDBHA G@P  MABE $|xE@a  CABA `x|BBB B(A0A8D 8A0A(B BBBA KDHXyE0(yBHA G@R  MABE $\y!F@w  CABA yFhyBHE B(A0A8JG 8A0A(B BBBA AFGFIXzFC$z8z)Ag4PzBAG@lHVPRHA@d ABA zE!@8zBBA A(G@ (D ABBA zE@ztAU{E%dH,{`|BLD D(B0O (A ABBA o (D DBBE 8x{EJ0_ (A ABBE O(D DBB{؊,Ae A {E6{Ԋ(Aa A |E6|Њ0|E(D X E FP|HAg A ^p|E"8|BBD A(A0w (C ABBA |vEO0<|xBEE D(A0F@Q0D(A BBB0}iE-@Y 0C(A BBBA $P}BDD@uABx}:E'@ }܊RAr A T A }%E6}:Ap(}$AAD  CAA ~D0 ,~@~ T~h~D$D ^~A\0~nBKK L0{  AABA ~~-@~"BEE D(D0JQ 0A(A BBBA <'Di$\ЌXAAD0OAAHDG0('ACD P CAA KD ̏ HȏBEB B(A0D8D 8D0A(B BBBA @C4`\oBBA _ BBH dRD(ԗAD z DE ` CA Ā IZ f DE $-BAD bABh  BBB B(A0A8G 8A0A(B BBBA 'AFFNGSxH} YAJ0C AA H@0H8V@DHBPI0@ BBB A(D0G@Z 0A(A BBBA 8H@XD@l BBB A(D0G@Y 0A(A BBBA H@XЂ܊ BFE A(D0D@ 0D(A BBBA  0J(A BBBE ,H@Lp[D0VdIM08xBEA A(A0 (A ABBA Iw0<Ѓ<BDB A(A0o (D BBBA I@0,0HBEG D0p ABB`I0|>ExoI%TBBB E(A0A8GPXJ`[XAPb 8A0A(B BBBA $IP$(UAAD LAAPI `hlBBB B(A0A8J9NGF` 8D0A(B BBBA ̅I^HBBB B(A0A8B@ 8A0A(B BBBA 48Q]@n 8D0A(B BBBE $p\BDN@lDBQZ@ PD O AA ԆQ JD EQ H$BBB B(A0A8DP 8D0A(B BBBA dVQpP0ؔBDD D0  AABA rQo0ԇ(0VY(@MAAG0Y AAA Q#00L AZLpQ dh;D U E \/Am*Q #AY(̈@LAAG Y AAA P JDAXB A d4(ULBB B(A0A8Np 8A0A(B BBBA \ 8C0A(B BBBE JPp0BAA G0  DABA ( P0R  AABE +Bh4dPlH%BBB B(A0A8c 0D(B BBBA E 0D(B BBBE 0D(B BBBOb88؊BBE D(E0g (A BBBA P0H4:BIE B(A0A8G 8A0A(B BBBA OܙoOAY̋ЙSAz A VRO >H$BBB B(A0A8D`Z 8D0A(B BBBA dN`hqO5HBBB B(D0A8A@x 8D0A(B BBBA jO@T H,PBBB M(A0A8G 8A0A(B BBBA xO$ ,Lԍ(BBB G(D0G8D 8D0A(B BBBF 0$XBFA J DABXeO<HtBBB B(D0D8I 8A0A(B BBBA 9O9HNO=LpBBB I(D0r (B BBBE j (B BBBA dlPMBEE B(A0A8D`- 8A0A(B BBBA  8G0A(B BBBE ԏDO`(HQBDG h ABA  O \8dBBB D(D@ (D BBBA  (D BBBE D(A BBB5O@$3BAD hAB$ܐIBAD ~ABN H0"BBB B(A0D8GP; 8D0A(B BBBA 4|NP 8A0A(B BBBE (X7BDD W IBB $O& [ CBA dDBIB B(D0A8D 8D0A(B BBBA  8D0A(E BBBE 4p|BDD v ABA cNB^N  HĒ8BBB B(D0D8G 8A0A(B BBBA N580AJD0w AAA N8V@DHBPI0lM0HBLK B(A0A8G  8D0A(B BBBA ГM HdBBB E(A0D8DP 8D0A(B BBBA <MAP\#Xp̥BBB B(G0J 0D(B BBBA XBBI̔tM(puBAA [ ABA ;N X0BBB B(A0G8D`VhXpBxBI` 8A0A(B BBBA M`̨%Ac`ؕBSB B(A0A8N 8A0A(B BBBA  GAB]<N\AUx[OA,ܫAG P(B0_(B G AA O( ] AE 0ADE v(H0[(B cAANl ,/BlH!OI E (dAAK0r AAA $N\0H8U@BHBPI0HtBBB E(A0D8GP 8D0A(B BBBH NP$$hSBAA KABLO dO:@xBBB A(A0G 0A(A BBBF O ܘA\ A F D NO%$hIBAF |AB<7O Tx(htlAD W AA DEN> -BjșNI E @BBB A(A0K@ 0A(A BBBA ,(N@HUPBXB`I@X0AY A tUPR(DAA } AAA (P+ 0КLBAD G0  AABA P0 4PAT@LBBB D(C0D@ 0D(A BBBA ~Pc@0lBDD G0  AABA P_0(oKAA ^AB,PE TH$%BBB A(A0D@[ 0A(A BBBE  0D(A BBBA uP\@ܱԜȔAp J }P- @A J ,rPODزAZ0`̔BDD G0v  AABA YPY04BAD0D DBE ` CBA ^PU0,̲SBAA D0F AAB0kP0LRj a A Dh$BBB B(A0D8D`8D0A(B BBBPH`ОKA~ A JP[$Գ'ADD TDA(0ܳBGD0 ABA $\xPw0A8U@BHBPI08( BBA A(G@ (A ABBA ,P@i (A ABBE (̴GBAA ABPM $8Դ>BAD0pDB`Q0xԴAAQM(:BDD Z IBE $ؠQ& [ CBA XܴBBK B(A0A8D`QhPpDxBI`, 8D0A(B BBBA ,\Q`hTpBxBI`@'D \ B Q( ^ A D@ġ8/BBB A(A0G@/ 0D(A BBBA QJ@H("BEE E(A0C8D` 8D0A(B BBBA tLt7BFA G(FPM (D ABBE  (F ABBA آ&Q4PH0ԺBHA G  DABA <P,XdwBAA J0d AAB>Q000BDA J@  AABA 4أQ@aHSPDXB`I@THWPBXB`I@ܻ $ػAG \ KA $HTMADA DAAp2Q  dAZQXPAZؤP< AZ P%d$( AZ@P%dX AZtP%d|KBA D(D@ (D ABBA l (D ABBE  (A ABBE z (A ABBE 8 HP]@}(A ABBJ@HD(\@BDA  ABA )P d7BBE B(A0A8G 8A0A(B BBBA O 8H0A(B BBBE 8OE 8H0A(B BBBE DX(BM@`BBB A(D0G@v 0A(A BBBA O@dħXA BBB B(A0A8D 8A0A(B BBBE  8D0A(B BBBA ,O&@L BBB A(D0G@Z 0A(A BBBA O@@,BBB A(D0G@] 0A(A BBBA O@$@BGA rAB<O 8TBDA D(J0 (D ABBA OJ0T[BEH E(A0A8DPXD`_XAPT 8D0A(B BBBE PjOPO 8A0A(B BBBA  8D0A(B BBBE (lPAAG`y AAA P`(̼pBED s ABA ܪP; (QFAD w DBE $P] WCBH1HddP'f|)H_P'f8 BBA D(A0h (D ABBA {PC0ľ_D H E I(P7 m A 0DABHD G$ CBBxiP?(LGDB vCBA `P AJB<BBB A(D0G@0D(A BBB$P@DH7An A L`u BDJ H(A0A8N* 8D0A(B BBBA PЭ`BBB B(A0A8G% 8D0A(B BBBA PDBI4HjP3TTBBN`LGBBB B(A0D8G 8D0A(B BBBA SDBI4R!WBBI`BBB B(A0J8G 8D0A(B BBBA PDBI4SmTBBN`BBB B(J0A8G 8D0A(B BBBA ?PDBI4TTBBN$TIBAD ~AB|5V A`YFEE D(A0 (A EBBE r (D BBBE g (C BBBA  Uj0D,BBB B(D0A8P@8D0A(B BBB4tU@@A 8A0A(B BBBE PL\LBB L(A0A8M 8D0A(B BBBA cU40|+BhH_Ud\BBB E(A0A8D`$ 8D0A(B BBBA e 8D0A(B BBBE IJTn`7U4 ABED E(E0b(D ABBXD&BBB B(A0A8M`hPpDxBI`S 8D0A(B BBBA ,T`rhTpBxBI`гU FBe E Y,T @RThT |R\iT TX̴9T R T 0^D(XS l RlS dеyS c`4<FEE D(A0 (A BBBE r (D BBBE g (C BBBA \Rj0$|IBAD ~ABS #жR DBc E Y`<FEE D(A0 (A BBBE r (D BBBE g (C BBBA |gRj0XBBB B(J0A8DPXP`DhBpIPS 8D0A(B BBBA ,URPVXT`BhBpIPH(+BBB B(D0D8G 8A0A(B BBBA tREHBBB B(D0D8G 8A0A(B BBBA aRG$RSBAD HAB(K$<PIBAD ~ABdwR |`l@BDD D0[  DABE J  AABA ԹRZ0<,BBB A(D0s (D BBBA (0R0M(A BBB0\kBDD G0L  DABB $Q`0b  CABA (AJG0R AAA QQ00BAG D0x  AABA 0Q08LPBID A(G (A ABBA QaL^BHB B(A0A8G 8D0A(B BBBA 4Ql 8E0A(B BBBE @|Tx h,|`xBLI DpT DBBQOpHȼBBB B(A0A8E@ 8D0A(B BBBA 4Q@ 8A0A(B BBBE 0LBNA W  DABA ,BR}SDBI\A[ȽRLܽ04 LEB B(A0A8D 8A0A(B BBBA ,ER#0LBDD G0`  AABA S0$PqA[8X@R8A0hAľR00ܾnBEA GP  ABBA RXP,8@BEG A(D` (A ABBA 8|T`ehSpDxBI`VhWpBxBN`4̿0<H&UHPBBD D(E0 (E ABBE u(C ABBhT06/U  U $?0PBDA J@  AABA 40T@aHSPDXB`I@THWPBXB`I@<hBBB D(A0J@u0D(A BBB8T@IHSPDXB`I@HWPBXB`I@0NBDD b DGE JAB,U  LDFBBB B(A0A8G 8A0A(B BBBA @UDSA)AOB$cAY;D vc$ A(P0F(A 8<BED A(D@ (A ABBA xc@(hBDA AB c5 mAB0^BBB [ RDE MIEDAB4c$LL?BBG A(Dp (A ABBA WxXBBIp|cp4;BEF ] BBE ADB(Af c @$BHA G@M  MABE r  CABA hYcy@h#cp'AeHBBB B(G0A8A@ 8D0A(B BBBA 1c@(0tBFDp\ DBA \c+pHt8(BBB B(A0A8JP 8D0A(B BBBA Kc`P8BBA G(D@~ (A ABBA Oc)@8DRLHc `|7Aq|$cC E J#c$JY(2BDD `DB b ACB$t3BAD hAB`@_FEE D(A0 (A EBBE A (D BBBE ^ (C BBBA :bp0DhBBB B(A0D8Q@l8D0A(B BBB0 Bb@A8A0A(B BBB@ XTxBBB B(A0J8D`hPpDxBI`R 8D0A(B BBBA ,a`AhTpBxBI`|  0 D X l   `BFEE D(A0 (A BBBE A (D BBBE ^ (C BBBA  `p0$,3BAD hABT`hBFEE D(A0 (A BBBE A (D BBBE ^ (C BBBA `p0(p7BDD W FBE $`& [ CBA $@`3BAD hAB$h43BAD hAB4LBDG0\ DBE v ABA _`N0,PBDA F0~ AABe`0,@,Aj\7`U(tBGD0n ABA  `0$+D b_> c A L BBB B(A0A8GL 8D0A(B BBBA <_*@\PBFB A(D0G@ 0M(A BBBE 0`@a 0C(A BBBA L~BBB B(A0A8J; 8A0A(B BBBA 4$`OGFIASH\PBIB B(A0D8GPA 8A0A(B BBBA fPp=g 0Ej  g"8L$$`,@BBB _RDf" MIE$DABf$@fH8IBKB B(D0A8Gp 8D0A(B BBBA PHf]Hp#BKB B(D0A8G 8D0A(B BBBA 9ff3D \ L FLBBA A(D@E (A DBBE t (A ABBA `Kf0@0|p?BIE O ABA BLI|,HBBI B(D0k (E BBBA G(B BBBe0L0,BBB B(D0A8D 8D0A(B BBBA ce!gA@@h BBB A(A0D@ 0D(A BBBA 8gE@X 0HT A Rx$ hAD aAg% \ qHy A  bIQ A f 4Bq$ BAD ABDf9 \ARtf (tBIDD ^DD if ACB4tzBBD A(D0f(A ABBf00,BDD J@i  AABA `eA@|$Abe<1BBB D(D0D`U0A(A BBB0e` 0D(A BBBA H0tBGH B(D0D8Dp 8D0A(B BBBA |hUp"AX\AS A kdBEB E(A0A8D 8D0A(B BBBE w 8D0A(B BBBA ljn40|BDD v ABA cNBj  \XAY 4Ij4H:BED D(A0c(A ABB/AM ^Ai& ` AA 0 BAD D@   DABA i`@($XBAD MABPk# l)BfkK(YBAD NABk  $&Ad@JkHX1BBB B(A0D8E@ 8D0A(B BBBA jh@8 BBD A(E0 (D ABBA j00H`BEE E(D0D8DP 8A0A(B BBBA hjP0BBA GP  ABBA Ak"P(aBAD VABl"   )Bf<lC(TbBAD WABl 0,TBG EEkC @TBIB A(D0K 0D(A BBBA ,k0L"BKE G  DABA lo8SBLA A(K (D ABBA l8TBID A(K (D ABBA 0Pl<LeBID A(K; (D ABBA l8wBIH A(G (D ABBA m8iBIH A(G (D ABBA <mLXBFA D(G@ (M ABBE H (C ABBA  n@0hBHA G0K  MABE $^n0w  CABA 0 BHA G0K  MABE $Tn0w  CABA 8|0BFD A(GP (M ABBE ,nPa (C ABBA 0BHA G@Q  MABE $o@w  CABA LD(BFA D(G@ (M ABBE D (C ABBA o@(BDGDBo8 BBE E(A0A8Gt 8A0A(B BBBA DGFGFX 8A0A(B BBBE AFGGFS\o(X&BFA h ABA p @&BAA D@D  GABE s  AABA $<TpA@c  AABE Ld((BBA A(DP (A ABBA  (E ABBE ,pCPP (A ABBE h* d*[BD d EA o L4*BIB E(A0A8K 8D0A(B BBBA od&BBB E(A0D8D` 8A0A(B BBBA  8E0A(B BBBE 4 p1`Y 8A0A(B BBBE D BBB B(A0A8G{ 8A0A(B BBBJ IFGGJ^BFGGJ^oU** ,*CBED D0n ABBHdo0d* Hx*TFBE B(A0D8E@ 8A0A(B BBBE 4o@J 8C0A(B BBBA H`+BBA A(K@UHVPDXB`I@? (A ABBA HuoY@8d,BFD A(GP (M ABBE ,voP (C ABBA -;A'L@.BIB I(D0A8D 8D0A(B BBBA <o8\wBIH A(G (D ABBA p88/wBIH A(G (D ABBA *q `0( \0BAG0^ ABA Lq0d81(x41BAG0i ABA XrV0H1BBB B(A0D8DP 8A0A(B BBBA JrPL(3<BBG A(Dp (A ABBA TxXBBIpx\rp(4:BEI aBB r ADB<4BBB D(G% (D BBBA $Wr=@6AFX6GA A Ex@r6EACr,7{BEG A BBA q  HL7rBBB E(D0A8D` 8A0A(B BBBA \q `H|`9<BBB B(A0A8JP 8A0A(B BBBA rqP4: (0:3BEG \EB (/r  AEB@L :BBE D(D0DP~ 0D(A BBBA qPH|:BBB E(D0D8B@U 8D0G(B BBBE 4q@I 8E0A(B BBBA 4:=AD m DA X:l: :zq8:BEH A(G@ (A ABBA /q%@8|;BBA A(GP (D ABBA <pP$XD=IAAA CAAq (T=>IDE _ DBB q XCBH=+AI _Ahq" (`AAG e AAA HFq `<,Ab|=^AXT= P=jq@H=ADB  AAA g AAB B DAE ,qO A AAE BAA$H=[AAD RAApq  = ==1Ae E Ap@=BBE A(E0_8N@I8B0A(A BBB(tp20D>wR0d\rp@0(pp BAA  AB80>BKD D(T@d (A ABBA $>gADD [AA>>(}<>(P>BAG0~ DBA |u}60}(t?#AY?IAC(?BAA AB } 8(d@pBBB A(A0Y (D BBBA d~08x@BBA A(A0/ (D ABBA ~U08 DBBA A(A0(D ABB0,4EBAA  ABA dِ H\GBBB B(A0A8DPU 8D0A(B BBBA *PLHLBBB E(A0A8G` 8A0A(B BBBA L]`Hl@{BBB B(A0A8DP 8D0A(B BBBA [PM5Ak<MBAD D0^  AABA R DAB4l0P N1Ak A CpG&8NoBED D(B0j (A ABBB (0A(A ABBN@(N/BBJ D@  ABBA ^HPPDXB`I@$H@AHTPBXB`N@HpN BBB B(D0A8Np 8D0A(B BBBA ]p8PZuBDD E ABA G ABB 8Z!BID A(K (D ABBA T(pl[^BD(F0K(A U EA )  [BPB4\SBHE G(D@q(A BBBЮ@0,\BFD G0  ABBA `0$|@]IBKD@tABW;@P]cAG YAZH (]WBAD LAB ^  <]P]d#x]H]BKE E(D0D8FpN 8D0A(B BBBA ,T^gBAA GpT DABp($x^9BAD nABPX. @lp^BBB A(D0D` 0D(A BBBA &`a0acAi A ~ A j A F A F780cBLA A(KJ (D ABBA lc)Ag3LHcFBB E(A0D8E@ 8A0A(B BBBE 4 N@i 8C0A(B BBBA ,@ ,dYBAE H ABA p ư $ @d<BAA tAB  $ @d9BMD0bAB z0 @d9, ldhBED J BBE P 5 ABBt d AY |dbA` I< duBIH A(G7 (D ABBA  ۯ0 eD eLX e~BBB B(A0D8G{ 8A0A(B BBBA  $ g@ gUBBB A(D0D@ 0D(A BBBA  p@@ iT ih i&Ad L iBDE B(A0A8G 8D0A(B BBBA < ^*GBAGDX(, kPBDD0q ABA X b0p k  R'Aa k k5Bh E A )2Y A \ kBBB B(D0G8Dp 8A0A(B BBBA xXBBIpPߴp<p 1ؗ'XK,1BAD  ABA 81? A DBE [ KBB AAB24,2AVD2(>A|`2Lt22D2P2L2_#NT(2@BAD AB3> @$3 BGI D(D0D@z 0A(A BBBA 0h3@ 0A(A BBBE @3 BBB A(A0D@ 0D(A BBBA 3@4̞AX4 H44BBB A(A0k (D BBBA A(C BBB4r0<4ܞBEE A(A0 (A BBBA 41x05\'5u(5d+<5pAnX5?Yp51Ao5'@5VBBB A(D0D@ 0H(D BBBH 05\@) 0D(A BBBA H6P.BEB B(D0D8B@ 8A0A(B BBBA h6@66l6AM$6AGD0AA$6Y0A8U@BHBPI07T(,7`BIG ABX7w: $t7YALS0vAA77BAk A L7BBA A(D@P (A ABBE g (A ABBA 8FA@88=L8W`8&Ad|8,8TH8TBBB B(A0G8Dp 8A0A(B BBBA 8jp9?AX E `498H94D B A d9( x99L9AAG`< AAA p HAE D HAE IAA9`5`(:ԧ3BDH aAB4:Q (P:̧BAG0n ABA |:[0(:|BDDp] ABA :.hpH:TBBB B(A0A8Gp0 8A0A(B BBBA $;2pHD;BBB B(D0A8D@ 8A0A(B BBBA ;_~@;L7De A L;_;X*De;L<\nBIB L(K0D8\ 8A0A(B BBBA `<K\<\bBBB B(A0A8GHlBL 8D0A(B BBBA h<~J ApBlHlAAEE}*EtAdKEHcdGEGhJhBGGEHHnNDEJHHn6AqBHHEnKeB,MeBKdAdJjAHEEq(L>;AAA f AAA x>/ |>BBB B(A0A8DVAjBM 8D0A(B BBBA DfBEkB\?k -AkBG`ASEkArDfBODeACDfB EkAAjBXEkADeAyHfAKaA GkAOHgBgGaBAjBDdADdB(p@IADD x AAA @FG (@aBEA l BBA @F (@G?BEA 2BB(ALO BQF IAZD8DMBA A(D0q (D ABBA DZ0JHDPBBE E(A0A8G8C0A(B BBBHEnZhESD o E EIZ! `EзE̷bAP A E"ZJE EMFF0FADF(HXF$BBE H(A0A8D@\ 8D0A(B BBBA FYl@F F6AtFYeG G;ARA ]A(8GԸAADPT AAA dGY0P`|G`BBB B(D0A8Dp 8D0A(B BBBA  8H0A(B BBBE GYYp(HAAD  CAA ,HY DHbA`\HY*pH< $H8\BDE MAB HX a GBB 8HLBNH DHOPRHA@  DABA  IXj@(IAUDI,Y%d\I @pIBEE A(A0D@z 0D(A BBBA IXn@(IfBDA [AB$JY5 A ABE $(J4ZBDD0LABPJXK0hJT7A\ F JX $J`7BDG0eABJX 0\ABJX3AiK< K8 (K42Ap@KXTKH2AplKX(KX BAC VAB,KXBPA N0z AABKXKLXARL(0Lܽ8BED dBB \LX ABB(L̽VBDD } ABB LVX CAB4L9XBBE D(A0(C BBB M:Af A H A H,MXX@MLTM'BFB B(A0A8G 8A0A(B BBBA MzYM([M([$M)[NBDD @AB`NxEBED D(D@ (A ABBH t (G ABBB r (A ABBA xNZ1@NNZ(N=BDD k ABA `NBBB B(A0A8DP 8A0A(B BBBE h 8A0A(B BBBA LOKZ1PlO0 (O,]ADA l AAA (O`_ADA l AAA OY O| 4PxfBAA i CBH _AEY 8PBBA I(Jr (D ABBA PXQ ,QkBDD D@U DABDQZJ@0`QBHD G0|  AABA QZS0(QBAD x ABA QZ Q,Ab@RBHA D0q  DABA N8V@DHBPI00TRCBAA G0  AABA RZ&0RhGA}0RmADE g AAE pCAHRBBB B(A0A8D@v 8D0A(B BBBA @SnY(@0`SjADE g AAB pCA0SXfBGA G0L  AABA SY 08SxBBA A(D0Q (D ABBA  TX0AtUAUUW%dLVRBBA A(E0C (C ABBE ~ (D DGKE (XV@W 0A(C ABB8VxBBB A(A0}(S BBB(VV(0^(C BBBVW;AyWV4W"A`LW6`WV$tW@BBB _RDWTV" MIEWDABW:V$ WAD  AA X"V ,,XaBDD B GBB $\XU N ABA 0XtBBB [ RDE `ENXU ADBX$DABXgU$P Y@lBBI A(A0DP 0A(A BBBA AXX`BhBpIP`YUPHY<BBB B(A0A8DP 8D0A(B BBBJ Y7UPYZ:ApZ80ZBAA ` ABE T HBE 0lZ}U1 E KDE H CBA 8ZBBB A(A0(A BBBZ>U20XZwBBB B(A0H8D`! 8A0A(B BBBA AhXpBxBI`X[T`Hx[BBB B(A0A8DP 8A0A(B BBBA [ UhP([X>BDD j ABB \(U CAB4\HAD w A P\T# 4d\hBBA A(A0(A ABB\T60(\CBAD xAB\H<4A` E ](]>BDD j ABB @]XT CAB@d]BDE G@`  AABA AHVPDXB`I@H];BBB B(A0A8DPV 8D0A(B BBBA ]S:P^(^<^$P^@BBB _RD(x^aS< \ ENE ADB^DAB^US$0^BCA G0x  AABA  _-SP08(_TLAA Z DKE _ CBE d_;(x_BAE ^ CBE _R# P CBA _TAD } AA _R ``,`@`'Ae\`mRt`8`t9"BBA A(D@ (A ABBA ` R@`\MyH K`?aTaAD0A4aQ$0(La SHAE t AAE xaQi X CAA <a0AAG0o8R@H8A0D AAA zFJaQ.0$a.AGA bAAbQ 4bx$HbcAAD TCApbGQ ACAHbBBA A(D0V (H ABBE (H CBB8bP;0S (A ABBE T(C ABB8cOBBA A(D@>(A ABBTcPg@4pc ;BDD a GBB AABc$cP8cBBA A(A0 (A ABBA  daP\0\(dBBA A(E0Y (H ABBE H (H ABBE j (H ABBE ,dAP0H (C ABBA ddPAY$d>BBB `HK eO BEK,e#@eOTehe|eFAc E eO"aeee`AZeROC, f BAD  ABA BDD j ABB gN CAB(h|>BDD j ABB ,hN CABPhl4dhhsBDD N ABA LGBhhhh-Ab A hM, i i4iHi\ipiM/D _ E FHiBDE E(D0C8Fp 8D0A(B BBBA iPi\*ADA jM A DAE 4jHHjLAT$`jAAD n CAA $x i1 gDADx Xxi8AQ E `xx5i8AQ E `xMi8AQ E `xt$D _xMi8AQ E `xl$D _yMi8AQ E `(yd$D _@y|$D _Xy5i8AQ E `xyty$D _y!i8AQ E `y9i?AX E `yX$D _y@i8AQ E `zP$D _4z@i8AQ E `TzXi8AQ E `tz($D _zXi8AQ E `zpi8AQ E `$ziPZ B J B `z{i{-Ab A 8{i,P{AUl{i%d{8AQ E `${'BIE SAB{zi BLI@{BBB A(D0G@z 0A(A BBBA 0|2i@P|d|x|AU|i%d|AW|iQ,|uBKA T0M ABB}xi0<,}8BBB D(D0 (D BBBA l}#i50,}rIDK G ABA L}i }P8}DBAM@QHPPDXB`I@ ABA $$~hk@AHTPBXB`I@@L~BBA M0z  DBBA A8U@BHBPI0~h0~A\(~KBHA wBB ~hh  AEB8BBA D(D@z (D ABBA ThB@xplBBB B(A0D8B@ 8D0A(B BBBA M 8H0D(D BBBE u8H0A(B BBBgX@< BIB A(A0 (D BBBA LgB08l AJD0@ AAA H8V@DHBPI0g0 \nAM c AB mg FA (1g<PgdxxfpALPoD@BAA M@  AABA THUPBXB`I@xfB@ 6A_ A 4(4{BBA V IBE KBB`Jf |`)ActXf/AF؂%<BBE D(A0 (A BBBA ,e04LP|BBA A(D0h(D ABBe0,|ZBED G0B ABBЃe)00eAY$dVAAD0MAA@eC00XtBAA D0A  AABA {e&0 6Al؄B[0oE5e0$ܚ4d(,YBEA LBBd_ 8DnY4PwBBB D(D0^(D BBBc0$BBAD wAB8̛BFE D(J (A ABBA }c%4$BBD A(D0(D ABB\Nc 04xzBBA D(D0f(A ABBc 0̜@^AG TAb# h $dMBDD AB@b XtCAAp|bG(bBAA ZABb (̝KAAA } DAA Bb[ $OAAC CAA,8]b, M AAA I AAE $hWALS0tAA1b0(A] A O E I A A0ԞHBHC D0  AABA a%0$aA~ E C DsAW`U AA h b$`(AAA h AAA a ğh؟d `'| ,xlBLA D0S ABBD]a+0`lamD0hxdD0_a0AP@tAĠa@0ܠ jBNA DP  DBBA ]aqP,@ @< TadAP QAt'D ba ,FBAI G@n AABСya@aAFaAFaAF4a/D jLa)D dda)D d|ahAP0UApNBF A %bJ@ԢBIE D(A0DP 0A(A BBBA bP8D W A TVb HhtGBBB E(A0C8DP 8D0A(B BBBA 4b;PD 8A0A(B BBBE T@BIE D(A0DP 0L(A BBBE D 0D(A BBBE 0DJbPa 0C(A BBBA xOb^b,HLBBB B(A0A8D`38A0A(B BBBbP`4 bUBA A(D0(D ABB$XrcAAA AA8<BBD C(D0_ (A ABBA cH08إBED E(J0e (A ABBA cn0H0BBH E(D0A8FP 8D0A(B BBBE 0|c"PU8C0A(B BBB<<BBA DPVXB`KXAPT  DBBA Nc\P, BFD DP~ DBB<^cPX APt dAD ]A"cD P@ BFB B(D0DUOKA 0D(B BBBA b  4 AP,P HBDD O0f AAB$b"0[ CAB  & ШcbCD e E F A IH BEE E(D0A8F`u 8D0A(B BBBA @L PBX E pT`| BIE D(A0D@ 0Y(A EBHE [ 0D(A BBBE 0az@m 0C(A BBBA ( AN0j AE ZCa00\ Da/D _ E FHdH BBE E(D0D8F` 8D0A(B BBBA L BBA A(D@O (A DBBE y (A ABBA 5aB@L BBA A(D@O (A DBBE y (A ABBA l aB@L BBA A(D@ (A DBBE O (A ABBA ث`<@`X LBBB B(A0A8DP 8A0A(B BBBE @ 8A0A(B BBBA X`2P8x$BDD l DBE \ ABA s` ЬF`OAM`G,@a)D d,XBED M BBE $`T O BBA AP4̭ BEA D(FP(A ABB`qPL JED R(B0B8A@AHAPAXA`AhApK W BBA p`J FBC%$APԮ('AJ E O8$AJ B OHAS0LAULPIAGh`Cl hlAG K AA `G (ЯVBDG0l GBE  `n0\ ABA  T`&ZH`8b`{BOI A(A0G_IPAMKA00A(A BBB ybADAb԰:AJ A mb< bKAD  KDE AABADLmcBBB E(D0A8A@8D0A(B BBBc.c:d=б.d( dh ad   4Ed4HEd9BED V BBE JBB4Fd<BDD _ ABB JABJd̲p4d"dCS @  <A4c4Hd\dpd33dA`dOd+,feUDC DBAe e8eBHD G(D(D ABBTfhf|lf4`fSBDD  ABB AAB(ȴ{fLBAD AABffVAT4$f<BDD _ ABB JAB\P 4pfSBDD  ABB AABf4f9BED D(A0b(A ABB4f;BED D(C0b(A ABB,f@gTg hg|g4gABBD D(C0k(A ABB,ȶgjBDD D0W AABg&Ad$g/ADA fAA<g Pgdg5Hl(hJNDD lCAA,h4hԷADD oAA\qpd5Gm4ZBED K(D0y(A ABBYD0TlSEB B(A0A8G`b 8I0H(B BBBE D8A0A(B BBBAH)FD0A8`WBEA A(Gy(A ABB"AX@BAD v DBE Q ABE AAB@BAD r DBE N ABE AAB@nAT\l&p~?KpA00D k¾Ⱦ<G t( :BDD iDB$8AADPAA\`kBBB B(A0C8B@ 8C0A(B BBBE A8A0A(B BBB(9BGL K(D0(\BDA LFB7D 0mAk(LoBBD GBx (BAA AB(IBDA ~AB$PACK ~AA AL E A$@PACK ~AAhAL E A4BMF J JBE ]AB] S$c/DO [v.AIO T$G0@#BBB E(D0A8DtA H{HAK AD A=AV$= BDD FIB(5*BDD XAB@3 AHT,<BBB E(F0A8J@8A0A(B BBBBP4BEF D(G`u(D ABBrBTm@BQ0gE0,BJ0ZEPBOl5BG0fETxL$OAAA {KA8Hk(#<GAD [DA("A`0D%dGAD DPN AABA0xUgGAD DPQ AABA0bGAF DPJ AABA$gBAH XAB AJ, BAA GP AABPL AdEG BPBI2g0I9   0 D=Ah E Jdx#AXM* * (/4C6HeGd)AY$9ADD kCA`BBB E(A0D8DP 8D0A(B BBBE C8A0A(B BBB  H !BBB B(D0C8A@8D0A(B BBB(lgPKCC {AAALOIE B(A0C8FP8C0A(B BBB4.sBBA A(D0b(A ABB i4eHV\GpC?;(AfG%AcT<Azx1N_A#|AD sC4H\ p8iBBB D(D0S(A BBB*RF5AN dAHBEE B(A0D8Gw8A0A(B BBBD. $X&5AAD lAA38'iBHB G(E0A(I BBB8TBBA A(D@(D ABB  4 H \ p @BBB A(A0G0D(A BBBS K"AZ E AMAFDAF$,;_BCD RABTr%Ac8lBBA A(G(D ABB8pBBA A(GY(D ABB  4H\ A^x A^ A^$JAAA DAA$*AKD WAA$*AKD WAA$(*AKD WAAP-BjlmAkTqAo$sADD gAAAZ$ADA AA(}CBDD02DB06\YH6\Y`9TYx9TY9TY$30AID _AA0;?AIE V DAE KCAF?QY(mBID BB(HBID BB(tBID BB( BID BB(BID BB(BID BB8$ BIE D(D0(D BBB$`ydBAD YAB$dBAD YAB(BID BB({BID BB(BID BB(4BID BB(`BID BB(BID BB(-BID BB(BID BB(ABID BB(<BID BB8hU BIE D(D0(D BBB(%BID BB(BID BB(9BID BB((BID BB(TMBID BB$dBAD YAB(BID BB(BID BB$'JBAA BAB$(IoBAD dAB$PBAA ABx'AAYYD0T`BBE B(D0C8J 8A0A(B BBBE O8A0A(B BBB$\18y-L`*t''$KBDA @AB'F[$wAAD nAA@JYXuZap)GYMAK6$MAK(5BID AB8 BBA D(D@(A ABB\z4Bqx԰=c R4zoBBA A(B0](D ABB,nBHI L0J AAB1NT(NT((NT@((NTDX8BBB B(A0A8A@8A0A(B BBBJNU uAsj(NTzvAt(NTuAs0E(NTHUuAs`(NTx(NT(NT(NTA` E ZSAQ$S]ADA TAA$yAw@#AO E M`t5A] I M5A] I M5A] I M5A] I M$bAGA VAA$0RKAGA AA$Xu\AGA PAADBEB E(D0D8E@8A0A(B BBBT,NUh5NT=Ab E T$NBDD @AB@<Ir(\oBAA gAB(+BID BB(BID BB(?VBEA IBB$ imAAD dAA$4dBAG VAB,\BKK L0a AAB(DlBDI YAB4UBGA i ABB WCB(BAA AB5?NT$4\ADD AA,\NHD pABA8gg(BEA AB( fBJD RAB8F BBA A(A0(A ABBD<*BBB E(A0A8GP8D0A(B BBB4TBED D(C0{(A ABBA]0|A+D N$&@ADJ0nAA<>BFE A(D0G@|0D(A BBB(\JAJAAA- iTIAz qTQA H kBEA D(E0} (A ABBE K(A ABB4$ BBB A(A0(D BBBH\s BED D(B0m (D GBBE A(C ABB H BBB B(A0A8G8D0A(B BBBD BBE B(G0A8E@8D0A(B BBBHP,BHE E(A0D8D`8D0A(B BBB6Am 8 BIE D(D0(D BBB$DAFA yAA0fA\ E C4PBDA w ABE MABHWBEE B(A0D8G`8D0A(B BBB&$ JAAA DAAB"A`,H"A`HNcBP KE(hBAD ABD4GBBB A(D0(D BBBSAV zA9AP(3BAD ABDA]$\AIN0AA$_rADG cAA(8BDD jABAI$AXAU4!AY E A(T^BDA SAB    \       4)BfPJBD ~EpOEI$~BBD0nEB8[PBEE G(G0n(A BBB$o[AK u AB SCAR0ARHAR`DtBBB B(A0A8DP8A0A(B BBBEA4xBEE E(D0X(D BBB({BBH jBBH<JULBB B(A0A8GP/8A0A(B BBB$S)BDG GIGTmIc(kBAA cAB$CBEA vBB AF48BBD A(I0y(A ABB4pOBBD A(D0n(A ABB,eLIA EBB3Aq(BEA BB4 GBAA f LBE AAB4XBBD D(A0(D ABB$APAP E n$~BED@DB4KBAD b ABE VAB<0#$P?dBAD YABx{ $pdBAD YABAF<BGA D@  AABE D CAB    #AO E M@ *HO E M`& AFx AF  A @D w- )  AM$ :BEA nAB8+ L D`' LBA Z BBB J BBB BB8 LBA Z BBB {BB!bg!*PYy!*$!8!4ZYP!(d!=cI|!""%AQ E M"BHg E M">Ep E C\"BBE B(A0A8G` 8D0A(B BBBE D8C0A(B BBBTdV#BBB B(J0A8D`vhIpKhA`A8A0A(B BBB$'$ $AJ$$KAA E C0$KAA E C$P %VAG t CE NC$x7%IAG g CE NCX%+AQ K Mc%+AQ K M\$Z%cBHG0NAB%VAT$8%BHG0oAB$`+&BAD AB(&HAD AB''VAT$J'AIN0lAA '( 'WBEE FBB L'HBd E T E C4p'BBD m BBE iBB8](]BBA D(A0L(A ABB(~)BCA AB()BAA |AB$<>*CACD xAAdY*5A3r+)AgH+0BEB I(D0D8DP8A0A(B BBBc- o-  {- $ - 8 -OAMT -h -.TY -jAh .4Ar$  .HADD yDA @. ?. >. @.0 B.D 0. X %. l . .  . . $ .AAA AA0 .XQAE vG AAAX .BGB B(A0A8DKPRA[8D0A(B BBB4t i/BEA A(A0m(D ABB8 /BBE A(A0q(D BBB( /=BED mBB( 0BBED rBB(@ $0BBED rBBl :0aBu E d4 {0BBD A(A0(D ABBH 0[BEE D(E0c (M BBBE A(C BBB4 0CBED [ BBE MDBH 0\\ 0BBB A(A0D@Q 0E(A BBBE ~HFPOHG@Y0A(A BBB D1 E1GBD {E l1AZp1(Af$|1{D v<11BnXX1BBE A(E0L (D BBBB N (A BBBE A(D BBB%23YY@2hA` E A$2dBAD YABH2BBB E(A0A8C@8D0A(B BBB\`<4BEE E(A0D8G`M 8J0D(B BBBE 8D0A(B BBB44AAw E C,4BDD G0 DAB$|55OL<5D ST5D Ql55}5RBF E D5 5AG A/7-7AZ-7AJ E A$<75BDA jAB$d,7BAK AB$7OAAA IAA87`BEL D(A0@(A BBBH7BBD F(A0 (D ABBE A(A ABB<8/AX E P\8Mcc E A|83Aq8@D {$9MBAD BAB8+9BEB A(A0(D BBB9 $$9BBD0EB<L(:BDA D0]  MABE  DAB@:JBBE A(D0NP"0D(A BBB;SAN BA$!<BHG0DB,<BAD M0 DABH="AW E D$h=5BDA jABT&=BEE L(A0C8D@lHFPBXB`M@\8D0A(B BBB[=;BGPlE(v=|BAJkAB4=4H=BQA  DBE ACB,f>BLI Dp DBB,>BLI Dp DBB{?VAL E C?VAL E C ?VAL E C@@VAL E C(`S@BAA AB@ @aA_%AOAM4XAtBEA A(C0^(D ABBAMGrPC0ARAH E CPA)AghB'AeB9IQ E Y(B$BGADA ~AA@:BgBIE A(A0DPH0A(A BBB$]C 8]C]BDH LAA\CGxDG{D*D0eD-D0h DGxBQ4EhAGH0P8V@DHBPI0`AA8 AEBBA A(D0(D ABB8\GBBB A(A0(D BBB]-IcL]IBD M LBE  BBE V BBE ABBT^DE^ BEE B(D0C8GP8D0A(B BBB$`_5BDA jAB$_5BDA jAB8"_QBEE E(D0p(E BBB7_\AQ`HA4 s_BHK T ABA LDB4D_BBA A(D0(D ABB|I` AZ(Q`ABAA 9AB(faBAA AB(aBAA AB(bBAA AB(DcdBAA AB(peBAA AB4eBBA A(DP(A ABB@eBBE A(K0GP0D(A BBBHjgBEB D(E0Q (M BBBE A(D BBBHdgBJB E(A0D8G`8D0A(B BBBj4jyBBD A(A0e(D ABB0SjFAJD j CAE AAA0ejDcjXajl_j^j]j\j[jZjYj Oj Bj/Bl(Uj1AoHDjjBBB H(A0D8DP8D0A(B BBBHlwBBB B(A0A8A@^8D0A(B BBB-m,m $ !mBAD AB(, mBBA BB0X m*BDE J GBE ACB mAR E C0 m*BDE J GBE ACB mAR E C8!m;BBE L(A0(E BBBADE D(D0D8D@DHDPDXB`U0ЙKAI1($1VKG0DB$D1BHG0DB0l1BBA D@ DBB18Sak E A1kA,14BDD G0 AAB` 22BIB E(A0A8DPx 8J0A(B BBBE 8D0A(B BBBp2hALPVD2Ԡ+Bh42BID A(A0(D ABB$2BDK yABH 3&BBD A(B0 (A ABBE (D ABB(X3w?BGD mBB\3BBD A(B0U (D ABBE ] (D ABBE A(D ABB3/Bl4!0VY49/Bl$44LlBDD@^ABD\4BEE E(A0D8FP8A0A(B BBB04YAAB C AAE HAA(4HADA ?AA$50BDA AB(,5uBAA mAB(X52BAA }AB(5BID BB(5@BED pBB$5)tBKD0\DB$6utBKD0\DB$,6tBKD0\DB8T6 -BBD D(G@(D ABB86-BBD D(G@(D ABB6jBD ^E69$D _,7EBAG G0} CAB`47XBBB B(A0D8B@$ 8D0D(D BBBE A8C0A(B BBB87BLE E(A0n(E BBB7A7j8] 8V,8Q 4@8FBAB B ABE ABx8GAE8 @8AAD@UHHPUHA@Y DAE DA8Z 9R;BGPlE0 9mBGG0x KDE xABDT9ѰOBLA JaYDBI DBB$9ر1BAD VDK9AQ$9AAA AAH:A4BBE D(E0g (H BBBE (D BBBT:)5Hl\p:BBEB B(A0J8D^RBBI8A0A(B BBBH:޵NBJI B(A0A8D`&8A0A(B BBB$;mG Y(U0B8B@I j$D;%mG Y(U0B8B@I jl;jA,;AJ W(U0B8B@I A$;oADA fAA$;qADA hAA<<FADA x AAE A DAE ACADH<$BBA G(D@WHXPBXB`I@(A ABBD<xVBBB A(JPWXX`BhBpIP(A BBB\<BBB B(A0D8Gc[BBI(8A0A(B BBB$8=xAV H P E C,`=AJ W(U0B8B@I `C,=AJ W(U0B8B@I A,=AJ W(U0B8B@I AL=BHA A(GVUBBI(A ABB$@>{xAV H P E C,h>AJ W(U0B8B@I fAX>GBBE B(A0D8D`ah[pBxBI`8A0A(B BBBH>IBBB A(G@ (D BBBE N(C BBB`@?BBB B(A0D8DP\ 8D0A(B BBBE D8C0A(B BBBT?BBB A(D0D@ 0A(A BBBE 0A(A BBB`?yBFB B(D0D8Dp 8D0A(B BBBE D8C0A(B BBB``@BBB B(A0D8DP_ 8D0A(B BBBE D8C0A(B BBB@@LBIB D(A0Do0D(A BBB`ABFB B(D0D8Dp 8D0A(B BBBE D8C0A(B BBB0lA:}ADA g DAE ACAAAG ATA%BBB A(A0G@ 0A(A BBBE D0A(A BBB`BiBBB B(A0A8GP: 8A0A(B BBBE D8A0A(B BBBT|BBBA D(DDDDDDgU(A ABB0BoAAG0 DAE DCA0C7}ADA g DAE ACA48A0A(B BBBLK @LA?BEB A(A0D@$0D(A BBB M< 4M1HM6(\MAUDA AB(M_FPH |BBM@D0{(M=BED mBB$M0dBAD YAB Nl*Ah8`BNB A(A0(D BBB(n`BAD ABXB{H|~rBBB B(A0D8D~ 8A0A(B BBBA `~̩BEE B(A0A8GL 8F0A(B BBBE 8D0A(B BBB(,=&BED RBB(X7VGED xIB$aBDD FGBT#BP E KHW'BEE B(A0D8FP8A0A(B BBB2pD@k0;Fo(LJOIC cCBA4xǬZBBA D(C0C(A ABBA}ȀTlN\AP$PBAA HAB( ʭBKL@cAB4LFBA D(D0(D ABBȮ 4BLA  EBE ADB@2rBAA IX DDDE w AAB(`<SQBG0BE\pw l_#B`(fSBEG @BBH}?BHB B(A0A8GP8D0A(B BBB@p TehX |N\AKBPS U(A0A8U DDDE G8D0A(B BBB, <"BEE A(D0GP0D(A BBBD˴ X״+lAPgBBB B(A0A8IWDDDIH DDDE DDDI8D0A(B BBB Ƿ.D0i8$ݷBEA A(G`k(A ABB4`#BEA D(D0(D ABB8BBI E(G0(E BBB4ԅBIE G(D0z(D BBB4 {BEA D(E0q(D ABBtDϺBIH E(D0D8B@\ 8D0A(B BBBB H 8E0A(B BBBB |8D0A(B BBBІ4hBID \ BBB rBBH3yBIE D(H0Y (A BBBB p(D BBB8h`nIBB B(G0L(E BBBDBFB E(A0A8D@p8D0A(B BBB(ݻ'AFD@AA `-t $t $ ot p o r = p $t s Ut = p $t s Ut =T <t >= `?= \= >G> &=> @?Q> ?t t t t t t |u r2 u u  ٰ r2 u s = p $t u  v v v v v v v v v v v v v v v v v v w  w w w !%w "-w #6w $?w %v v v v w  w w w #w +w 4w =w Fw Pw Xw w (w )w *aw &hw 'ow ww +w ,w .w 0w 1w /w w w l   I1 } CX }  I1  I1  c= !} = p = p  v0 h 4 ? / / , , , H , Q , 1' Q , 1' , , , u      @Ƃ ς |= |= |=    b  ٰ ٰ ٰ |= ٰ  |= ٰ  4x  |= ٰ  |= ٰ  ٰ { { { { { { { bl bl bl ٰ ٰ u Z ٰ u Z bl bl 7 bl bl ٰ  u Z {   { ; ; 18 88 G8 ٰ ` Zb { ٰ ~ z Z |= ٰ Z ٰ Z y, s ~ B Z ٰ Z s ~ V a s ~ V a s ~ 1' l w ٰ Z 2 2 2 Ye 2 2 2 Ye ! ٰ u Z ٰ Z ٰ s ~ V a |= ٰ ٰ { bl { ٰ { Z |= bl u ٰ u Z |= ٰ ٰ u Z |= ٰ Z |= 2 ω ۉ    + : G U d r  Њ ݊   " 1 ? < < l 2 "2 O> p W] _] N] D] ˚ @- M d /  ! - K  Xo " po " ٰ ` X T v k \  SI*q  .$ .$ .$˜ .$՜ .$ .$ .4$ .L$ `.d$  *.|$   .$  ".|$ $ `.$ s .$+ `.$7 .$B .$L  .$V .$i @. $s .$$| `.<$ .T$ .l$ @.$ .$ `.$ .$˝  .$ם .$ `.$ .$   .$! .$" @.$#- .$$9 `.,$%E .D$&S .\$'_ .t$(m  .4$)x .$* .$+ .$, .$- .$.  .$/ @.$0 `.$1 .$2 .$3Ξ `.$4ڞ .4$5 .4$6 @.L$7 .L$8 `.L$9 .d$: `.|$;_ .$< .d$=  .d$> .d$?% `.d$@0 .d$A; .d$B@  .d$CG .$DM .$EW .$F\ .$Gj .$Hr .$IM  .$J .$K  . $L .$M `.$$N  .<$O .$$P$ .$$Q ~.T$Rğ }.$Sɟ  }.l$Tҟ |.$Uڟ  |.$V {.$W  {.$X z.$Y y.d$Z x.d$[ v.$$3 '41"gK ( & - ^3 ޞ ݴ Ο c < ן |b $ C Q eL / p e~ z r 87 L#ON3 2:X #     &$%V;().&$%0',-2+*K"!p (+),*-10R  } r /.<W 546357q 8| 9:=> ?@!"AB/CDEGF MSHIJPQTRUWYZ[Mf: 2+MMg4$MM&KMMS <38*MMMMMMMMMMMMMMMMMMMMh_XWY  MD' 3ray']@8MLP(M)M%- )rL )N |kM` $5IFMMMMM~M#MMM?xM g  #MM$KAq+"U Y$MPMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMM2 g ű r2 y x= ! u  á ' С gK ("gK ("ʰ J S H H = p u8 T v8   ' @ Ϫ } M? K    /  4x 2 U _K _K   v0    )? ״  ܴ f r ʵ ӵ ߵ   2  H H = p 2  H H = p \ f 1 k r z : ö ȶ ʷ 34 ж ض ߶     ) 4 ? I ŷ R _ j t з ط ߷ y4 {E B  # ( 3 oq m  ^Cq -q -sq - @ (CP-X-o`: Ϊ U-hp oooo~o%S-6@F@V@f@v@@@@@@@@@AA&A6AFAVAfAvAAAAAAAAABB&B6BFBVBfBvBBBBBBBBBCC&C6CFCVCfCvCCCCCCCCCDD&D6DFDVDfDvDDDDDDDDDEE&E6EFEVEfEvEEEEEEEEEFF&F6FFFVFfFvFFFFFFFFFGG&G6GFGVGfGvGGGGGGGGGHH&H6HFHVHfHvHHHHHHHHHII&I6IFIVIfIvIIIIIIIIIJJ&J6JFJVJfJvJJJJJJJJJKK&K6KFKVKfKvKKKKKKKKKLL&L6LFLVLfLvLLLLLLLLLMM&M6MFMVMfMvMMMMMMMMMNN&N6NFNVNfNvNNNNNNNNNOO&O6OFOVOfOvOOOOOOOOOPP&P6PFPVPfPvPPPPPPPPPQQ&Q6QFQVQfQvQQQQQQQQQRR&R6RFRVRfRvRRRRRRRRRSS&S6SFSVSfSvSSSSSSSSSTT&T6TFTVTfTvTTTTTTTTTUU&U6UFUVUfUvUUUUUUUUUVV&V6VFVVVfVvVVVVVVVVVWW&W6WFWVWfWvWWWWWWWWWXX&X6XFXVXfXvXXXXXXXXXYY&Y6YFYVYfYvYYYYYYYYYZZ&Z6ZFZVZfZvZZZZZZZZZ[[&[6[F[V[f[v[[[[[[[[[\\&\6\F\V\f\v\\\\\\\\\]]&]6]F]V]f]v]]]]]]]]]^^&^6^F^V^f^v^^^^^^^^^__&_6_F_V_f_v_________``&`6`F`V`f`v`````````aa&a6aFaVafavaaaaaaaaabb&b6bFbVbfbvbbbbbbbbbcc&c6cFcVcfcvcccccccccdd&d6dFdVdfdvdddddddddee&e6eFeVefeveeeeeeeeeff&f6fFfVfffvfffffffffgg&g6gFgVgfgvggggggggghh&h6hFhVhfhvhhhhhhhhhii&i6iFiVifiviiiiiiiiijj&j6jFjVjfjvjjjjjjjjjkk&k6kFkVkfkvkkkkkkkkkll&l6lFlVlflvlllllllllmm&m6mFmVmfmvmmmmmmmmmnn&n6nFnVnfnvnnnnnnnnnoo&o6oFoVofovooooooooopp&p6pFpVpfpvpppppppppqq&q6qFqVqfqvqqqqqqqqqrr&r6rFrVrfrvrrrrrrrrrss&s6sFsVsfsvssssssssstt&t6tFtVtftvtttttttttuu&u6uFuVufuvuuuuuuuuuvv&v6vFvVvfvvvvvvvvvvvww&w6wFwVwfwvwwwwwwwwwxx&x6xFxVxfxvxxxxxxxxxyy&y6yFyVyfyvyyyyyyyyyzz&z6zFzVzfzvzzzzzzzzz{{&{6{F{V{f{v{{{{{{{{{||&|6|F|V|f|v|||||||||}}&}6}F}V}f}v}}}}}}}}}~~&~6~F~V~f~v~~~~~~~~~&6FVfv&6FVfvƀր&6FVfvƁց&6FVfvƂւ&6FVfvƃփ&6FVfvƄք&6FVfvƅօ&6FVfvƆֆ&6FVfvƇև&6FVfvƈֈ&6FVfvƉ։&6FVfvƊ֊&6FVfvƋ֋&6FVfvƌ֌&6FVfvƍ֍&6FVfvƎ֎&6FVfvƏ֏&6FVfvƐ֐&6FVfvƑ֑&6FVfvƒ֒&6FVfvƓ֓&6FVfvƔ֔&6FVfvƕ֕&6FVfvƖ֖&6FVfvƗ֗&6FVfvƘ֘&6FVfvƙ֙&6FVfvƚ֚&6FVfvƛ֛&6FVfvƜ֜&6FVfvƝ֝&6FVfvƞ֞&6FVfvƟ֟&6FVfvƠ@sdZeddS)Tz Hello world!N) initializedprintrrTools/freeze/flag.pys%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%% %%%%%%%  !"#%%%%%%  !"#%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%S-q "l q -l q q kr r k#%r q 0"l  q -l ( q =r  Cr "-`-Mr 0-- `r 8-- # SF"sr -}r  "r ~"r "r x" "@$ l`"r "r %"r e%@"r "@- `W8s  s il T ~ xs X < Ek 0s l J @;s xQs H Zs bs os 7 @[ "-r2 s r2 s =} r2 ( s r2 s }  s s s s s u  s b ̯ "s `"^x "c O@" " o  "8g P"Kg @" b "+ b "2 b  "s n\ t i-0t ,t x0D"мX pO-@-h`0= A" A"p A"V^ "^x C`"c "Kg w " v_ C ""l "-l " z$" u  p Db It uu = (  s XUt Yԙ `V^ ; "ct m@"Kg "^x "c " "̯ p" PP" ? 0"+ "2 " A Ж"8g " p" o #@"-C \ ^x 8g  C  ̯ yt -f t t -ct u  -l  + 2 -t V^ S "^x  " k `" @"_ "Kg _ "u  @u t ԙ (V^ ? ̯  ?+ :  "yt ^x " X" `" @"_ C"c o"8g [" c o B"t u  @u t ԙ (̯ V^ ? ?2 F  "yt Kg |" o B" P8g [" ct u ^x     _ Kg  + 2 y̯ ? 3u  @u t ԙ (̯ V^ ? ?+ :2 F  "yt  P8g [" c o B"^x " `" @"_ C"c o" X"Kg |"t -0u -u @-t  _ Kg + 2 ̯  yt u ^x u Z?u + " Z`"2  "̯ @Z" <" e " "Kg `"[u " " "c "8 "^x  "fu `"s `"8g  " o p @"s [ t Yt @u P-@ `-tu ^x >&" " "Kg `"8g c`" p" o -l"̯ `" PA "+ "2 D" Щ@" "yt Pu u u u <> u ԙ ̯ -u  ^x P" W" Ɣ Kg Ov _v ^x 8g ԙ t" r" `"-P(-̯ u - = p_"fv M"Zk @"dk "+ `"|v q "qv "zv `"v N"v "v @"W` P"-w `" `"w "ƅ "w 0"m 0"!v `"+v " "ƅ "w P"< PS "w @P"!v "+v "x x x *x :x Hx ^ \x ; A #cx A #mx @ #`g @ #{x  #(  #x > #x @ #x ``#$b Џ#k - #x p"x =2"Is #-x "-x y @v fDy &(#1y Ey   Xy `y xy y y y y y y y y z z "z *z Fz Oz Wz uz z  @%#z @%#oS "$#z ] $#S P# $#z ##`S @##S ‚ "#z ?@"#~I `6 #I :#9S !#I =#z =#H .#US p" #z 2#S =#z  #S #z @#S p&#z 4 `#S P] #z ̓ #S #`# {  -  @&#-{ +{ П@.#3{ m -#;{ m -#C{  -#K{ em ,#T{ `,#\{ 0m  ,#e{ .m +#n{ ,m +#w{ m @+#{ ܪ *#{  *#{ W @*#{ .#-{ { { { { { { { { { | | - $ `B#0| B#o @#6| `@#g >#@| }>#M| =#W| @<#Wl @;#g `:#a| a  :#n N9#1h {@9#g| .8#r| <7#z| 6#h  6#| .`5#| `4#@-E| B#-2 | < @J# I#k @I#| 2I#| | H#| K#-- ԑ | @^# t ^#| p@^#| @^#| 6`V#| @^# t ^#| `@^# t ^#| @^# t ^#| @^# t Ь^#| @^# t `^#| @^#| Y#| @^# t ^#| @^# t в^#t \#| @^# t ^#t \#| @^# t ^#t \#| @^# t ^#t \#| @^# t ^#| @^#| @^#| @^#} p ]#| д@^#| @@^# t з^#~ P3`#)} `#- t | P-} 0-} -`} -} -1' ~ > ~ -;~ -} ~ `j#~ i#~ @i#~ d h#  g## g#? `f#E# 0e# k#- tR M  % * E ) 7 p 8 TV3a Ӎ Jz HSUO =p#V @p#  p#| sSo#a sSo#1' Ԧ `o#_v o#f Vn#^ n#O^ ۏ m#Q m#q ?`m#| q#: 0? m#y l# l#E^ ʎ @l#t L l#} s @q#| _ q# r#a q#| q#| q# 0h# | p.E 0@t# t#- ش M  @`- -@@$|  #|  #|  #$ `@#&Q #yQ #iQ P@#P `#Q #^ ? #Q @#Q #> `#Q #Q @@#Q @#x= B#* # 0@# #. d #2 #Q @#Q @#9 ` #F #Q @#F #Q Ya ~#Q Xc ~#> P@~#Q qb ~#Q a }#Q c }#Q 9b @}#Q b }#Q c |#Q a |#Q c @|#Q b |#Q {#Q d @{#qQ {#> pz#> z#Q _@z#Q b z#D0y#ry# p @y#D> Py#F x#u: x#{j Hv#P ``u#> #`- c= ]   (|  t  ` ~ ]| P| } }M #B= e@# @#.0€ D`#Up.?0`xO 0  C I  #r^ #Y  @# К#~^ . < #C ~# F 3#C #D #C #>D P@#+ #1D p#C ##D @#= 0s#> {#C Ђ#8C _ #C @#iD `#D  #,> p|#X> #qF p`#E #E Т#D @# D Ј#C p# D #C @@#B 4#C @#C 0#IC `@#tB G#C #fB D`#DF 0 #l M#F #F #e .- F -C q r#m #F P#Q #w @#| #֤ `# # p@#| # # P 0 8 h  7 ``# #ű #7 p #h `# >#S `#| # #́ Pց 0 ,} , = ( 0 8Xq #F #  pA`# 0# # # #$ @#V .`-q @-m -F -| -֤ -Q -w - `- [  ..0- @-h l XС@.#`.@.. -S - ؂ ``L` @#@ ..@.     ' 0 : A P Y g  #j u#p #y #`. #.{ #`1 ƒ ˃   . J f 6 o x R    ʄ  2 : C L T ] e m v } { { { { { Hƅ ߅ ΅   I * f: 4 @ N d t  A  ٰ ` # # : #{ # ן @# ; #!v P4+v @7̯ C{ p[P$C `L$ K$; @@J$v= mF$Ɇ q@F$gn aA$І nr`@$n s?$j @?$׆ >$߆ @8>$  >$n ?u`;$L n8$* 7$+ `6$ 2v5$ v5$ w 5$:n W1$n Y-$j @,$ By*$+ o($\ @&$NR P@%$n x"$f: +@"$ {!$! !$: ,$: 0"@$Yn \ $~ 4 $' L|$n z$n n$q< 0H`$- ` $> |$U }`$?e ;5$Pe 5$ee !6 $e 6@$e 7`$l 7 $f p` $+e o2 $x 7 $In 2\ $  $  $  $:k % $ 20$ 8$ j @$ y `$  $ A$n B|$ o |@$ `$LJ $h @$χ p$և A$h @$އ $Lk /$v U8$e 8@$# 8$ ~$ U9@$"e 0#}< K#e :@# b:#e :#  #e :#0#̯ #g ז@# `# # À#o I}#7g ł#^x @#Dg #=g #Cg Y#Kg `#Rg a#Jg `#Qg `#}l b# #  # ## #j  #j  #) = #/ `#g Η#)o (`# o ϊ`#Yg @#ig Đ@#9 #I ;# р @#5 #< r`#d +)  #B Ms#L o@#V ՛`#c #n P#z Q# Q# @ # # - # # 0# Us @#wg '#xg u# C # H#  #vh #h  #̈ 1#ֈ 70 #pn Cd#n f#n Aj#n `l# # ` # #`#g # ~@#g #; 2@# r # r#* #* # . #`!.N #!. #@!. #.  #.  @# ._ T$#.- @#-:n "-n $-gn $-І $-n %-{ $-* - 0- - -{ -- `%-C P%-; %-v= p$-j @$-n $-L #-+ @"-+ "-\ !-NR p!-: P!-: !-Yn -n "-j !-n --j `-j 0- o - `-xg @-pn -n -n -n -; !-f: P-* e H6/ ".".$-Ɇ #- #- "- !-' -> -U t -p - ~ P - - - so }  1' -5 -< -B  Ë Ӌ     " . ? G Lb M~ N O Pь Q RS T" U= VU Wr X Y Z[ō э     ' 3 ? K V e p |    Ύ   _ / 0 `$ 12 2@ 4O 3[ ad .q     WЏ V $ % & ' -4 e@ fL gX e p (  ) * Ð Eא F h i <  +' G9 jE U lc n     ő ԑ w x y z { |" S6 TJ mS _ k x X U 5 8 > =֒ 9 @ ? A 7 6' :/ A X l ,z   o p ; Ɠ ד !  q r ") n6 D W Cb M{ NI J OŔ Pܔ Q R D% K9 LO Y #f Hv  B s t < uŕ vҕ ݕ k } ~ % : \I ][ k } ^ [ YÖ Zؖ b c d -̯ p- -V -c -n -z - - - @-  `$s ؟ @`$ 6 _$" u]$, @ `]$6 O_ ]$k i `\$@ (_ \$N ]Z$:o _Y$V ׹  Y$` `X$m M X$m MW$m 4 V$k U$t T U$"/ `$`W.&-N &-:o ٰ  '1 W] ptq6 _] N]  D] $ ^ ̯ f ٰ @'-Pp  8 `߅  `i$].× ͗ ח ݗ 2 h"2    H  pT ! b $ b $ ' 0 ] : = J M U X k b n b q b t w %` ~` t` ) / ʘ ߘ   H<  $$ p1`$f :$* 8$4 $m ?$ P`$F $,- 1$( `$O ->  $b $q /  $ p$  $ І@$  ~$5? }$/ p& |$/ {$ҙ  z$ [7y$ 7`y$ `}w$ |@w$& Ru@u$Z t$5 t$@ ss$C [`r$R @_q$5^ ƈ p$[  p$tn$ @n$m m$   m$N n)k$ [@k$ [j$ٰ  $_.> / t '-H< × ͗ њ  S po  i$`].ޚ $@^. $`_. @j$].    = Kg '-p'- $   6 ֵ ( 0> D] @B PT X = Xo g,- \ k v v0  " s d  B  ! 4 po  po Xo u f  t  @  N$] <`$}* $ `@$ $n.Kg ^x  \ K$ v  $w  $w $} @$[ $ʛ $m >@$ $ ``$- `$ٛ P$ `$ $f j`$@$ p. Bc  # + 4 D I '-f S #{ P8 + b C ش O{   * Ҵ     q<{ \(-7-$$$$$$$$p$h$`$X$P$H$D$@$<$8$0$($ $$$ $$$$$$$$$$$$$$$$$$$$$$$$$x$t$h$`$P$L$H$@$8$4$0$($ $$$$ $$$$$$$$$$$$$$$$x$p$h$`$P$H$@$8$0$ $$$$$$$$$$$$$$$$$$$ `$P$H$@$8$0$($$$ $$$$$$$$$$$$$$$$$$x$p$h$`$X$P$L$H$ $$$$$$$$$$$$$$$$$$$$$$$x$p$h$`$X$T$P$L$H$@$<$8$0$($$$ $$$$$$$$$$$$$$$$$$$$$$$$$$$t$p$h$`$\$X$T$P$H$@$8$0$,$($$$ $$$$ $$$$$$$$$$$$$$ $$|$x$p$l$h$d$`$X$T$P$H$@$8$0$($ $$$$$$$$$$$$$$$$$$$$$$$$$$x$p$l$h$d$`$X$T$P$L$H$D$0$($$$ $$$$ $$$$$$$$$$$p$`$X$P$@$ $$$$$$$$$$$$$$$$$p$d$X$T$H$@$8$4$($ $$$$$$$$$$$$$|$p$h$X$T$P$H$@$<$0$ $$$$$$$$$$$$p$h$P$8$0$ $$$$$$$$$$h$P$L$@$0$ $$$$$$$$$$$$$$$$x$p$h$d$`$\$X$T$P$L$@$<$8$0$,$($ $$$$ $$$$$$$$$x x x *x :x Hx ^ f > t s 4 d !  B N $`."   " ش >| $ @$Ҵ X $ $a @$ e - <{  ش G$C I$ $ A k 2 / % 6H ޠ  <  p\ h P ' 0 @ rX d 8\\t t {+v !v w !  + { { M Q h | $| $| $ ``%h % 5%A @h% g@%=T `z% `%f d%; P% `m`% 0 %E @% d%: P7 %  %n  %)  % % u% P%W 3@%A %$ 1%o ́% `%/ Pg % 0Q %7 pl$ 0$ `$ p $Z] 0I`$ $ k$Q $ w$@ [@$ 9@$ @$v* $ `$v $ %. J- :    L K- I p = Xo  / K-Q po  J-J- M  |   ! L ! R4 . a  8 < L C I Q 9M } F . ` i ] m { $ ~ E  c= M  # Ҵ 3 !\ 4x  Ϣ Ƣ ̢ آ ]   N " B ~{ m   " 4x B  " N  ] آ ̢ Ƣ Ϣ ]  3 B  i ` 4x 9M . F } $ 4x 4x ~ 4x E 4x  4x c= ] \ M 4x 4x 4x #  4x # # # Ҵ 3 ] 3  \  ! 4x  B  4x RR! RL R 4 3 a . 8  3  3  3 3 3  3  N 4x <  4x L 4x  L 4x  C 3 Q  ] 3 Q I   ] 3 Q I  B  3  I 3 3 3 ! ~B "   $ M t %@l @%9 kc %.^ K-t ʰ J ! B ! ~ x pq ߅  / { ! { { y£ ϣ U[ \w  mG #H Mr EJ J K L s [ !M M ;N N O ]P X Q Q q S T U cV W W X H I R 5S ;Y Y UZ ϣ { b   F &\ @&֤ & & s& `& 2&N  &3A 3&1' @& &01 &B Ј`&^ @@&_A @'&.  &u8 `&/1 p`&eA 4@&lA *&T &B  & @&v8 Ph&+ p5&ot p@&F l&2 О&v &4 M&< p&D P &L 09 &T ]@&\ 6`&f M&n 7&x & & & `8@& :&) C& @&yG b&0 p `&t E & L@} &| `& t & .ܤ `0 @.> = p K- PL- F 0L-֤ L- L- D @ .{ D0(( ps2tR p `" 3P M `# -P ,c  q (~      X P &X# & `0 W`& 8& pd&t  @&% *y rA &| &* @&ѥ &yG `U`&t ` & &     M p .G M p .G  ( ( $ | . < G Y f n  z Ŧ Φ צ   ( 0 > K S  # F d m u T 3p ǧ ӧ ۧ f    & 2 : C K T [ c p ~ è ʨ Ѩ ب n ߨ   # :  s ѥ y0P è  * 8 tR M {  " % yS @2  @2 # H2 F H2 X x'`+T T̚ K XhS d e d2 # ceF cp\(  h  è ʨ PѨ  (ب  Xߨ $d  PVm aD Hu a=E 3p (3y8PH F 2 ^ ]^ ]` ` 0: Н` Н0:@ `x 0:ӧ @`ۧ @0: 9`H 90:f L L~  `/@ p\ p X 0F x  E_` E_0: r``0& r`0:h2 f`: f0:C (@ `K (@ 0:8T 0S`p[ 0S0: 8 HpŦ P eΦ X`  ePצ ` e hp e p  x@ e0 P eh   e  e( 0  ec `Hp 0:~ ` 0:0  e(>  e` p `ǧ 0:H  e mP+n p e abz a;X mP+  e 0x 0n  u  -b*t z -bt X (@ 2Ŧ 0 eצ 80 0p&^ '&1' &!G$} I@&| `& t & | L-= |  @$ }  ʩ S  &| ^ &} &| P&Q & `& H&a H&ҩ @&$  &9 &ک & p& ``&  & N&Q ` &| &: ^&t `& &/ @@&K ,&0&p4@  ;p0 H&a &$  &ک & ``&  & N&| &t `& &K ,&[p4@  ;*/ M {0 @$ }  y 0&| 1' &^ = `&0nPh } 0J&| `& t  &} 7 &| N>`& t x  & t @&ƅ  &˚  h@//@8 `./P@"1/1/ 1/ 1/01/01/@1/@1/P1/P1/`1/`1/p1/p1/1/1/1/1/1/1/1/1/1/1/1/1/1/1/1/1/2/2/2/2/ 2/ 2/02/02/@2/@2/P2/P2/`2/`2/p2/p2/2/2/2/2/2/2/2/2/2/2/2/2/2/2/2/2/3/3/05 {#05 {#rp Om05 {#o05 {#p Oܗ |  ϣ M | _ &M  dh+ {  - M { # L-! + ! b # { # W{ ( W P P"  |  ( P& &} && &) Ї@&/ &4 &: `&B &M E &Z E @&O &ƅ W&g &A )&o 0&v @  &{ `&!v 0S+v W0$PScM-A > ) 4 0 p@&t &&| p&/ 0@&Q & &Ҵ и& @& P &@& P&a @&y p& p`&| 'y y y `M-/ M Ҵ M-0  / PM- 0M- bH`'n 0%H0't P'ش K'/ P4'Q . ' 0`'Ҵ V ' 0' W'p'0 V' 2'a 'y @'0%} '| R@' @ 'y o 'pT7 @ 'y O  'pTy /  'pTҴ 9 /  & 0 Y  0 ( 0` '/ I' ` '  'Ȭ 0Ҭ 0ܬ 0:  p 'yG \@ 't P  'pJ0ft7= 7+ @04 k h 0 R ' N/M- M-/ M- A Xn PpH_ y X't @' j'a R 'O @1`'O^ 0 '_v 'Q  ': P'^ R'1' @' `' 'LPp0LVpqPpd, } 5@'| ' t `'} @T@'| =' t n 'j N-} b'| =' t fn '| t=' G G $ í 0# 8ϭ " Xۭ ۭ  N-'  D N E Z0     (' 01 h9 XG Y s`%'t m  %'I  W 0_ x j r @ }    i i C.'Ȭ .': :-' `,'A ` +'A `*'ɮ `_*' P*'A;  ('] c &'yG I&'@8JP<Bi6`u@ i;AԮ %'Z/ u 0Au = A u /= u ̯ 2 2 Y2 ( 2 Kg B;2  Kg c { @ ( 0 () 2 =  { @E ( 0X[ Bxd m x   `  Ee0'9 f 0'̯ ae/'{ @ ( 0 Bx  pï   j1'8 $@1'˯ N1' d2'9 Kf2'̯ 1' f2'9 je2'̯ 1'9 ̯ 8|  t  t2'4x @ v0 @ 4 @  H ٰ PҰ | [ ^ C Ys { @ް H ! P  X |  4 @* ! H B P8  XI d `Z s hi = @ > H P ű X ӱ `ɱ l/!hhDڱ P@h/g@n/hhD P@h/gp/hhD P@h/gq/hhD P@h/gs/hhDP@h/g@u/hhD(P@h/gw/hhD- P@h/gx/hhD= P@h/gz/hhDR P@h/g@|/zhhDd P@h/g~/chhDx P@h/g/QhhD P@h/g/AhhD P@h/g1hhD P@h/g/!hhDɲ P@h/g/@`DP@` /_`/@`D@` /_ /@`D@` /_/@`D`@` /_/@`D@` /_`/@`D@` /_ /@`D8@` /_/@`Dh@` /_/@`D@` /_`/@`D@` /_ /@`D @`/_/@`D۲ @`/_~@@D @`/@/o@`DH@`/_/c@`Dx@`/_/Q@`D(@`/_/C@`Dh@`/_@/0@`D@`/_/ @`D@`/_/@`D @`/_h<D p =k/`/tv _h<pzD% p =k/`/;_h<Ї D= p =k/`/_`/@`DU @`/_@`D@`/_/@`IDl @` /@`D @` /_ /@`D @`/_/pD0<0//pD 0<0@/pDԳ 0<0`j//t@`D @`/_/b@`D8@``/_`/X@`D @`/_ /D@`Dh@`/_/5@`D @`/_/(@`D, @`/_`/@`DH @`/_hh`[DP@h j/@i/h//g`d/X nDa Gpn/0m/! X nbDGpnh/h//0m@/@`Ds @`0_/HhDAPhg/0/@`D @`0_/HD@@g//0@/@`Dp@`/_@`D @`/_/@`D@`0_0`///@/`/ ٰ / ///ٰ  //| d^  5'} 9`5'| ^  5' t n 4'y PN-F# ( P J# < ( # = ( # ( P G { | ` Q { ( Y # ( P l | ش 8Ҵ @< 8 p `a @+ b `״  ܴ  # ( 6' @6' P6'pN-> ( N-a# ش Ҵ a     U `:' 0*yG !:'a0   @bP `hq N->Z f r      $ 0 8ʵ @ӵ Hߵ P X h p ( xt \ (;'N-\ # sۭ  | 0# w ۭ (  {  "A ϧ @p`Ф@J} K`Z'| pJ Z' t JY'ϣ = p pO-ot O-֤ O- O- P- ϣ P-C O-A 77Lp`*} 'y'| p2y' t 2@y' = p 0P-ot `P-֤ P- PP- P- M P-C P-A  Ҵ   Ȭ yG } % tR c 9t " --f `LD@"O---P0t (P@" --t @"@-t p$LD "O Pk--`-@u 0"?D"С f (-- Q!u p$LD"O -@--B,u p$LD@"O Pk@-- -pu @D "; 0 --(@u 0KD"OϪ -@--(@}}M u @8g @" " o `" "̯ p`" ?"+ pE "2 `?"u u v v  a" @ "!v Ј+v c sD`"8 P`"[u l"4v @RD" R  R0@0 @v p"@-x 0\[/ (-x (*,/ -3} D`]#`-D} 0oDZ#-@mV} @PoDR#`j`-gm} 8pD^#`-} (`D`U# 3P-P-} DS#AP@- 8DQ#Ч-} 8DP# ``-0} 0 D`S#P-0} @DX#``-з~ 8DV#-0 !~ 0D@N# @-`1~ @D L#P@-C~ ( DN#`-W~ (DO#P@`-`k~ D P#@P -P}~ DT#-@~ @0-P~  @M#p -~ ( 9@N#@9  -0; 0  80 Dr## -- 8@K >- PP @--Dp# H``--`8@K a -H (0@@#-\ `@#R-@Op (@`# -PM M ߀ @P,@*D#&0@..@?0(' 80. gfAB`f. h`7`4`#.7_ { V e ~^ >   )} | E| {  Is W`  [ r sr Cr    "/ kc Rx (@i$fP]\.`[.[.E hXkh.n ( I v.v.@rPI} @ u., u.@ C  u.@ C Ҵ u.@ C s M @s   @  I@ rȠ S= Lj 0@q@ pq.]  J @+ gpo@ܛ 6 ..u ֠ 0T`.@.@`rU~ a `.O `D $g .`(vD $2`.tP peD@$gr.dM 0 D0B.b0٣ 8`. .`.@.v @@Y, ( p  8`. .`.@.@@Y, ( p .] 8p*X DY, PD.L@ 8@0/@B1% 020 B17 ~@}.r P!p.i0.0P_&|`.] p(0aWD`& p..@.bPT (. pD&Ԛ `.`> p*0&$`..;  / / D&PpP/rx `@dг / "/F  ~ (. @@&0 "/@"/Q W% G= b 0\@p[@#/C @&/(/D&@d@!zX#/PW@)/(/-D&@d@!zX`'/Eo 0^ ./s 0o-/p* 0? ,/ ,/,/x `&@<`+/*/2 $ ;= 5/MF  $ 4/F Ҫ PD@&0 BZ 6/`6/wYP! 8` D&p0(`7/7/ h 8Й0` wHXЧ(;/:/9/ _?/>/>/@&Q5 P=/;/ p`$@P M  pA/D&h?/0`ӫ  B/ޫ J`B/ PB/ @p@`A/q|# @I/@ WH/ 8$@@F/߫ @`0`H/@H/ԫ @`0G/@V@G/ 8$@@AF/* 8$@@F/< 8$@@eC F/V 8$@@eC F/o 8$@@eC F/ 0П0F/D '`T AD/a` M/@C'@/`K/J/< ( 8 vQ/Q/D']LO/Uz pZ@` R/ T@pMR/ 0@Pg T/y G@ `S/ eT. T/ w. @'ğ H0+JE 0WE pB !  M { P(  aM aM s D"'YPW/0T`2 D '0Y@V/`0&' x pJWH'@pPU/ 0;H p \10 @Y/@X/W/w\/p@/'`@[/Z/0 @. ^/^/B  2'9 #2'̯ _1' 0'9 # 0'̯ _/' `l( @(`i 0`/`/Q hlb/. @(0a/@a/ү K @ A xl 0+. @q (d/d/`c/ ( @0@ >e e/ j @] Reb/( ( `0@ *ie/M ] J?  M 0]OA Y k A u @`- D@@`f/`f/0_F0D3'`/Pj D5'P@/`  8- k@R/`//p@ 0- @R`/@/з 0- @R/`//P' 8- b@R/`/ /Y, 80- HR/`/ /> ,//@@03#} @//a8D6'Pp2@/`//pK @A> 0a@ / / /> `/:'/`/pcv0 3- @='// 0 +( b: HH@>'cw //@/ b _ @B m 0 @>'@w /`/ g - @>'`s~ /2 & 0u, ?' C p:3A :`W'1' 0C `U'v  <T'01 @A DS'A R'^ > >x >4 >f ?< ?T ?L 0?D @? |Q'_A P?`P'. @u8 @BO'0 SN'B KM'\ FK'/1 eA @lA @ K'B pL`I' G'T F'֤ @E' `D'2 Бv8 C'+ ج N Bot ж@B'F  BA'0 R@Im/U !0`///0g0/X'Q0)? v'| y'rA `v't &v'O u' 3A `t' "t'a %`t'1' C %@r'v ' 0 q'_v Pp'01 A o'A 0)m'^ ` O^ 0 m' x P 4 f P < T PL D  0@l'_A k'. Pu8 k'0 0Ri'B 06 h'Q P' g': 8f'\ ``e' `9e'/1 eA lA `d'B 7b' `'T _'֤ @^' P`]'2 (v8 \'+ l N pot ^@['F ` 0Z'L:qi01I R@(/LB 8`/0P/p@/ w'@@R0- +@/ '33stapsdt' 1pythonaudit8@%r13 8@%rbp5stapsdt '(1pythongc__start-4@48(%rsp)0stapsdt? '&1pythongc__done-8@%rax:stapsdtN'*1pythonline8@%r12 8@%rax -4@%ecxEstapsdtS'61pythonfunction__entry8@%rbp 8@%r15 -4@%eaxFstapsdt#W'41pythonfunction__return8@%rbp 8@%r12 -4@%eaxGstapsdt'"1pythonimport__find__load__done8@%rax -4@%esi@stapsdt'$1pythonimport__find__load__start8@%raxlibpython3.8.so.1.0-3.8.20-32.el9.x86_64.debugji87zXZִF!t/䜁]?Eh=ڊ2Nb&0PDU52'y;Xmkb[-]?_hs5{rP侳Wb`%ٻ$IAMoM(i8!Wx0C;&(wPiK,tEfLdQfֵ4GjiW qyUCОl |P>>jv-4ERh -C#2s!을&M҃Հ1CԼL% W |ܟR764mB\蒠cJv)!D4l%C;-^&Cԟ",!Wq[z| 3ĭLY3% 6۪1`ibc᥆&QWBBT(=a wc~R#焞\=+P&aQ);DA6lmdҦtjXH)~%GL\.& <ٜbm9 XVDgN%SD~'˅dug&XAjp4lW/_5rV=MC:}#wz'(  ʿV7"9LRV#tÒ"9ᥧOyvE} (RG?&G\MNz_E_UWp-L_akUvQf \M?tbcēqf]Ľ9*oD\ "AsVzW-4y}@vj( "yF"-{ kF%FB93ӟ/44:VJAX39e|h%@i Si-C;RFsqӖkˡt OZIW"P}KL2fjU%N=u$;䍧ʢ!{"@ jMegwNmqxEYf(O&>m*,@~a&řyg%)WĄn:J/Q#?|xٍACojv 4c;\~[]`h[ft՞IT+Œhv(Qk)COvSQiL>H]DSKfxhܕ}8kMg#'^[Qi=&Vq-V׽-KtkkD,Sv8 ͙@1tCabjkWwV!E8ᬙoR0 < mp + pYǕPۼj'HuO0>܉p7^ S4>ٜOL'_M4%o{ l;ZTvccG=% OY@&){QjQh&*` >ԑW[ROִOKPq3YLU|gaظs{RԐ3m*C7- v&Pϱh}cQe]u;(F'A\M-HN Vcڎ &wlP`2,zYއHŨxji#reg4ѽhtUy='g_Ba{*G'> nA$ɟL*^sqrΆ☛_L)DXyV{.cx?pNG zN}"*Ʉ}QiI)Uy=F=+@4a>~-W˖/ WCMn: Rh]r/ccWF@0KG6(\e7\}ymD7)NwVK4\sG]\e˜jK`3_ *&qᲲjb z vZ=dqw ^aD(g A WB?EC^b$ϳ!Ya[tNsnb# }oJ C$|L gSM7v*(&@ vQ~E5D,(cu1y ~}|a6F5Xvs).'I!G fi21釒/aDplz.b]%'^f=ʟusR{ޠd}2{k&S%YG@X6vPu[xL@/lhhS=k|(Fc] jx-P^w3TU8.*MCIXK#i&D{Kz.oL~rb,"N&%$MKE%)8k*4B|6ΕTGxDv3z.&;0 !)7RPmPԌ"Y?[F@ɰ^S ƹp UqnO56o6R:%S}{cJiAb 37͡zvjmm4BkFT>֘V[gF_v]lt'{:VHo5olt5V)IG7SABM*efM1>eCl\mm Bs̾B c٥y\aM 3kհ%Y^wZ=jhQy?OBv{{w"dv|@mYVtЎv,yYlOvN3ժ]5Yc9;]'LQ䑅_Ѳz^ MBb@Y Z-}yx,!T(гٟ%O0Ϸdu익p2py`--{M9._wз|II:S&xA/R3c{#:LqZNno~*;eIҳ=90@W8v:$꽢%. iOy]G$z- tqx`Fò'5߼#'m`k K?<KOlj3Ҿ1 Ԃ>FP̋0V< vEJfYjPH;s,q6b]Bkf ]'[T&9dDY-f/PS/Re2㯍O8FDYjM$Mrs*9ue%|p$YϿ< kyCї KZN'gd=5|q;Mձr;u>WoH(ѯzAC]KC*3h*tOx(/ʢ%r,t™67R`ނVad&=SwJ &#'Cv +!lX?}Y =9t4%wTM?MWcB;yK9_撇(s_Z@z hdP!)[HB'8؄{#'dsaO@2ϊ:5ܝ$1x*~!@!yBo! &/uSJ1›W<0d*EVR> rB~x_` Jvhۮ~ZMBi S!ֆ#gOW1Bt+!B>P;ss?p.@X8i9у?16mCw6XQ6 ;﫠9>셣Us"W;׵Bǔ w6~?j!=(A$0' -ٕXP7iJ$g%BqۄRELsAO 3*PR(p϶+#,b979};{Z };]2G\O{ -=YAڍm̮Kw2B&Rtްy{$Ey复x4(:ޅ5#M]0'YQ Mw}Q,ʹyN)$$Az U>z&b09?oKD)oE<#xZfwWy9f'#+D&k+>3YkeBX Q3V>4uA$RɡLB1exY]oF8l82mp9xZQ_O%h´Z4{pvE j,:T5VsG33ѧRScȽ,A ħ֧hNE*ύ~Tp=":}] q^As*1r?'1&fRPpws9Y .y*JO rQ9թ<"Zl1E)$HS"}%ߣh_Eygy;}_WXchr@RkyhsIQQ z i+\@ 3<^ 9Pp>)IxmuQI>OJn*3 ^0T  G@ I}:UF_)?j]r9&\; ZeSsԏEUU8.vvRKF^lK> =1dŵ֖֖X(ze)eq5n>K&:MН$Pz)i s!0+ۡn+d *S}ᖂf:=^jq@N87==aDgn!^OFkϺ~u2s(eȭ3p" /AVoZޡLjsY5>qAsc:J QǮwy ]N=v~*E j=vwP7&VjL:`~RGCF ˋ`jԤXP<{VRWWHiEYv Tfh#ԉ^ͻhzNjg.V_ r8ݩ+Ge뿠$}rCyl1GKhv!p?T: Ϋp>=fn2fSq*r<1)Ij9#N&U£wo>Qḻd!|XA*{='3DIh7AJ@ J>G+P]TSGgzH~̢6mڴ ހ4:Ƹ +>Mh WQ>0oWx5Ҫ58UqX4g<$oYsN=zC[P^EJ*M8|PjIfh瓆|ˈ2Nȍ;z Hܳi,5? :XWSvV[+/x[O\;$= agW#+"b+PZRN/kqMl|f)[嵒q;Ul,N5 q=GlY"эӃ'u%N~'Z^]|E])Hꍘ m Xwk#t 8_N' Qf%ƢNye*7CW2GN"3Odkrs!6(ou*Awx_NКh?ӧ)q<ɰz5iA21z<KvɊ^m,4?|3Pzq+Gd06\Q/fo*. ;).pr{4ޣ0q;*sXN!*mc;@ #+C9|EMf-Wi'ƈybQmΊ_`,=4zcȳg+\/f:2Dxa"k#;I"pf ;ԝ5_u|m3z/8M^Cjk-+7VrT[,}w0C|<))؇A6TPXe0¢^gmW3x8ňgبVgT# eDž!=/$j>"3[)|n1AMvܪM?ؙYN ,mv.n S lS'c_,f |G+c 'TR VrY2΄v)>{_H Kza^Fex|ם9FQa\x ػl 颭xD=HJqI[F+S3I.eZݘwXI!EA "z"8Ƞ/LuP1пO ,H5Ww0q:WRW!eN;I/x)xkw!+4t(3e&fUAИ؛`oAD: @u<$h>kǎa59 NT3%ച嶳kj˥dƂ 4(r؀s>KVҽ^%~W6>i)LhܣwLf|MzgzGzbV+A_ڣ#8c$T[RB{  H)zakhGu_O- )x7}G0\..n+f.;O3JQE 1Iף9Z~8Rhk;#8~ܔa5Lfi͟fE)v+;՟v Mfƨ 6v8ø,gi<ȥauԮi5hU&Ʉaӽdž撻WN>2d_N]1JD6'έ0'x2o7+==gظ_LxTX /kU_+yVc譏'5O{[n>,#G"";|h}~m1v^|m|QgO3u] >-kk&CC~ep¿_-S*vzARCͼ}X&w*ПD L^jSz.uWS(y;0?aޡa8[m¶O{+vyXudo0ڨbP#^\uK:u̐P]A?r*DnA QbێA Eޘ "͌{ee uq;Ҵsdh/kb^Jv4-1+>K>>(i$Hh"'~IR1mZ/JǧYp?nxoy2R+Bo$k+X$rͿeKC^-x|GW {o'n~\Non}< *ͫu!d,QQI`2ܭӷO%qE䋺'MmDxњ>u|vӷÜw͕bgpImdD#jy`+E+|]G3 {@Hl)Pm9?Nc|Nv,s> #kj;ikC0OZI8Ry(1MX{HYhD $ w.#PK)5w9*d~ ŚVjJRwi13oyQ{5m0{r DBmَ_NV@.S)#X<8Mêx*L>M%mBi@2 J 彗7^%kښr?NYb{=abI5Ay6ecCЌ`X1ܗ7|m]cOĦ@ }] ~b% TޟARfrDA w +X^=J0n#@ۼCPoZR* [x_}ǟI65aJ~9tq*]꨿s$du$Ѵ5tKэ4%,Yz9hώakFЛ tȖ;d*Q?>?ln*|@AwQ51 m)擺tX {!Ev= L9 2{M0LgTx`5߷J1OXv_Aq!ǀ7$߀%.-7F:<Ȗ3Bx'HvNa9a\7E6~Q@ Ao"I4|Aod ,r?zSGR\. shk@R"l޷WS*K=SedcCn:%$˧^iC(K.E^)z(o6zGjQh3#j9Zp.q-?Xѩjj׃'$3- vZ9-=;kIwdW8]6 mo$6My!aHn/ U߿d}H+tBԋPI' )QY@ ^;^%jIxe1bj`Ҋg`Tu vW2Fhi)F/RǼ*i'ar_oď~Y?a]Yo̪?b \@'NAv$K4Vo,GkT6%E h9Xqr<cf wE2 <#fؽ=?ғ;Jszal;{0*Lev\%v)ctp+c!mANpN{DPUF>9rZ*4((i9Q'ݑ_#bG~=OF*Wa𫠁^Q'M F/75XXqֶR: \zH}|:JuE]IEkNIjwxYG˧Wm{[s@Z _`lDR[|0H " CX6cZ#иEiH.C-K-MTW|~Hz;T$EO{0z6Vb4qD)q4!准gq@<O7d_hBd3C)Tx|}&E3 6ƫ>EnjĆ-rC3j,e"76#P䋤:*gPvd\Md7f(f7 *᪗!ȓ : =k IT#ENn6o aa'3o4zΟP @hfc"{2pYQ= 8BA.ϭ\F&,c-lEFk62 f/ڬvhu}Kmu$Ga:. nnT"}kPLak8Ž{o!! !+Yv}*z|RӞ Öޣ0}0ݧY S&b6g#G*`řzAP^dl0IK4PT=GoPrJbO/^v=޿ Ӣ!pA&2fpĻ yNp 6kBBDܠȡSU*;ZrAeK/0c[|+ܔ4F 's[8A!ࡋwg^W3IG|CdԸ@@yIĐOȘcNU@orB+L_@7h Vsg\'LpV?T+TNu3ũIX=k AM2ҥ$cvݘha5d.W7flh yrbmf2].8O!p"~J-v,3 B2 Β,|ɖʡtR]5\@NR-;nn15l0=\xWW îhЌAB<D,[e>[(R_gM%~{fggǏSeS}y;6 qP.]{i/Ԝ;[k.jB2H7d{ QIQq  ۙ@q"}0o -N.(@j'Z^+IEfڶvO]Y։>;q=$q8,|1& g;MbY > W^k-,X2Jfqu+&[v7Ўj"JmPka@\'6)}+E9Z"y,t@1jf2/Mq:Qd63zU ^xtxaI6tuUf06(]</C:-.P$ќHߎcmWPlD21 |N`[wsQ~%u L5>sU\ieŬ3BocdS \9qY%Bܓr3izߟ?$C !v~yMi3msyIK23 Kg|Zn7So\+}`|;_aLqj\@g3bv24+ Mҵka>_F:]'^G8}Y |LP e/=>q{p//l +Vm~f—`ĩhbD.YN=]xN5`o-H|pvhVBNN #ݞdϺ3{9bSC`v/8.*NSW#g,!hSK6'o&0ݢɔhs]&׸$Np76h|0.bQtCxE)\J0lIY'%xw賉(4J'wf2+ OVW@#*#uڑF#MdT4=&%g'fq.:.GO`%BpTtrc|!cյ6.xan叾qj5E/Oȯ @+of á5[VpMfj,NeTqqBGH4+/j]rmo%6CQgEѽ J#,#gNVXLbq1wq)?Bw_9CBXZ~]6fY|(^,K'wjSE[}N홥H^ᢗL QX0/v NJ-Tj|g4O &0alK9~m%GTMZS>PQ1zԃΔ[l`ϕ){FeAI՝`2}ߵFOHDӔXϖGb0C z0 j7tk&2T4c|cT=H s]%8jڀDiZI5Z#1Dk7̛8;d~IUGQ8q/4u A9O&1/,Չ+kECf't)=:" 8Z &2:arL 'UNGḐF?4 C, jNU("Gw3S&g<!`eyøe7SZICle~ϰfm"qWLtכ_]zP#/ا2/_dI?4VɵAM&Kl"NA޽(~kSj$Mxf*TՒTVK u'⭍ v>TbvD ݌Vx(i& (cDHR'#S @.jbS{;t<{@'!7 9zJd n1́AgFSg% J3"sKvi3;'* ){ZTBfM|D%iGK'LC r?SĔ9;d8R$$U?d&8טe1:^!Y_eEwH2pC:0˔rzliyf2e/]k7-ufשK2I3mƝ>gij,_Q|l͗209D^NCGe9*LSMW|:#aWY!6aY#Ȕ6] QA`ȯxgMƭ!;5dKl+&j':|JѫHe<~T & l1aI  AQ 9}E}K|8kB'D(ZDoA[*c`}U+S򸽙iIU!yQRp}=3 A?gޒ![)Mۅ.a06NuZ 1B&4}yL\ /jٞ 55:w=$y|uV +Z j@T@}[9zm-MWz $G s3kkiteʼ"#ev&R2 E,`me (M> .|irpq݂8XrH#~zRls(Utq1Fm4=E8 :oM7:ށ }ԲJ -Win~iu0E<X94hDۆW/q_+8Rmnێ¶"PCP8ܰW!TM}h܆] V|[/3!XI=x+pA?AsuoUݩ(􁍲,50(Bh2B5M< `>A2{hT #mT_qSӅi<PTb@7232Z 0E9fO9H:U 2x~S$AʐVDHeIї_yU>%5W R@FN%Ib2/@fJ@E ixB[$big~/l5<-O`d)d 'Vd$U wb0]N.i`5 \d92!o g%8aH !_?U z7JeS+ 2= ϚɑRTl?sl $crCo2ؼֲVw>ԜFFϚ!)wx mn*|70% QeLDjfW`y-VA#=xĠd%֘G"Eo<Ѩg EK)-Rq=Jܹ޹ڲ* bp/o}Sh# #S9p1!iBm]eX˽а̉~ gە* 5H_!W۶׈{K\>ᑮfP_QegWZHg(u@](I2~%::؝S|\pc>v|:Y/}q?Gcl.yG{]!W%FM@b"W%"tI)"w E0k @8_ /<~a0kP Ujue(78w;hc/5Aƫ1-ņ9JsJ`zld:7i+vD_tK>ro5E߅ibD!{&ҖE+|6v8F "bQ/6 Ԍ>ʿ@PJT6!Mon7ƛl*R3"_߇#<㎔vlpt_+)נligϦ"@yh:{5mқ&7_nqu]m[eww'L:7 & TX*𵈞mE1C˓L8Pk ]hfr@M|q@C/L`U̒M%lhދ3xؑ5vFJҽf̠>` .ͽYBYCxݙ9uI(7[@~y4+wk4]Kr J'jUv/AQU o 2O$3<}k#]piP@Kh<*y,>#O¤a&1m]>$8v&yC[ se"y2qľr\o3?Zb ъGx:'72׋aik W9 msxsrXCtw*O-(npd^ _t9 tlweq: '@K ]5'1zB5N2瀤?b"`l"WZ@w,/Vg{B/s'm_g*o֛i:KLDeQļxk5z.mk$ X1d*d },H`KhMtϞ,7Wg"IA- VE#Cgď"p މ`ӽ*/"iGr6OZY2QA^2ocg5z<aԫ7,9~WX%6gl 3(Ub[ "[TJ~S^Pw(@jtlfx{ү4I'8mc7Y(IJUM:Uy?z]Lԓ?(,|FaPu95`ԯ̀`UBXUB_I'QaH$FnPCΡ$týƖ('3V2}V {@_ࣝ3i:PL>߷uү"Yqa`'A&q}^ҟGY%N`j;n435 BKѺ7>!N xlL?3B}V&*MJu4% SJ7SA!e _I^OFTMn@skm2EWN-d?>y{|ۺL\KF3Ghl[2o fU2r T gͶƚj< Qs7Kt.#ꩨ_67Մ | 4aޱ$s' g/vhďώEAuގjKM G-B̓MɦxӽGqܾq"Dj\.\&C+(a$}sHvL/}$p!)[36LV]y7O@ )Aay!UMAt&? :*_{_@}{lKUkKCr֔c9d^To ~,[̢v)}ZSIrrU4*:F[3TxPkYf^`{9bbJ`~B];]?G_|AdzȹݲVK8!K`$-wDr_źqG |9=HN쉉P}):B7L# %m*>^+b|'3՜oߖEol-I'$6'9ɏ]ocUL;B:a!??F"V+mNow5Й$e&cӟsd\xaoBO!ڵ؏_2z`FQ!je;fPLx޳y:N P>н'#ɓ6ܰwZ~(okn6QYeW҉rpΑXt֖i(ѫ|ⱣE EZzdhjgɰfHgr,~vYJvQ;էx*͡ G[Xts*?Œ&ȖDp%pnTwR;M,#E|z6x;Rthp#^מ/\d]O({nǫ niA ]dnN]5.ܳ>tlЎv,W#Ft맨J`{)mFNeQ6WW:Nݘy^',LoWƙG[m;xmEpyq{HIG7kO lqd&sIYe yo(B~eb`,SdWC} ꍤ/|*VrI,/8vZ[@,(ܝβĊÎA*L{#X)n) #O~PY l5f9:Rf TG=$BGK.RO/Stn V@y@sjc;KHxK@F}Kgݗ 'GgfH :oDjb]Fk$lBVkEeq:Bnث64Xx{!1.Ʊ)^8)Nxz[Q[&a"N#| †)r8)L@=p¸@!~4;@9U1^R mVd\*Sٙ8)|P+rBy2z$"զmQ:ܨJ\ƻ\QF) kA&f&2L~VtY1f!Dv:'ް!o#m+8U ޱ9 mp hI&dƫ[Nx?Mt4ϸIXapH}n_ć65gdѣJuP ~9mG9%Y&*]Qj,FN)/sm?U7ѻ!ϗx'5fqK%9@ }Ay 7}^\U8Se6v!hZN<#04yC?]37ˇK )[ ^Α56לۭ`N˾Fi|,B&)ʴbRwNʄHĊJ@_|ZO<]'3% ^4= /^\O\Op.(n{Bɖ/sq @uo#4đ95l{@`"yePI3yk#A>吝F1$kdǓ `=2tA'R|sN#"ߜfɮp&U;a L4VPkG-is4V @W'퉷YϜ{ڽՃ7oW PӹxȅL='^N|&YtMݚy3@ c~$ߏ!vi|TJ#PܾVR+PŰ[ӫ Zuewb9h(j5 pg~ nin`ywy=ths>&M=u8HP3”'#ڣ9tqSc)["2kS}tiQ^Wt2.7.T54[L:%Txy$nP ![I#euԩ '[QHд0]Nx{^#& ؊f/((S˫)f`a{3h4>|`'2M[h [aaκKwjY`$#Sû[S#^}j&M&~e.o-=^fwЀwv)M[](JĢ\h/ԑa0(Asԉ޾+P+6L.,ӕSOV }>0~BPĪ S#ǡ>&A)ΡG}:3Lf3)&iL"m(:H#O);z KL y 9ɿ{.cg`QyI{忔n/%X__pT,Д'k WɱF~cg[sG=yj1t)E'B*:"Y,"Y\+ ^ ;>zmV[L b!8(V_'?p-8?pz xJi&fk8*^q\mr q,5GsaWi D#Eҩ!1؊ KC6ݳ<*-틊  + b#JOqMS GJK=R…-o#qTL" f#C@Zܴh?JY+nMo+#EOaߝ|2^VsM{6o)r67G/~4=]:(ӾrFmxN.$h#4Pxl&W8GC&W:#! m>;V\+ϼ=C )WDp 1 N~p;_i@2̧jBus 6Ț\QFި$ 4:>݄C%IX%VǛ,*q>o:e|Gi4|jY!ՒWtPŽ[]&&*3̈X&qzliNVC&&3 $-11fE)؟V"+[yIX_ >_R($* eb}})riwVl3!| O}`רf :q9&ľncN Úu <)–NgޜiLI4GࠞR߅*hay}m6;qOͤE^[1*> t&f.rAV ȑ>sv,K:Zj7Fd =.<3\Ryuo@0n4Ğ6MMuƁ"V YYEοꯕsd~ݥU6cZ>Q`/ >CJ~ޅV4fڭ,ZY"I{}&4Ϸ ksDܒt:~Us}YH '4F"vZ7ktOތ5z9ʚ;A "iB<ŧb_2U/L'Qupe^DM%Պ{cZ.-}D;OT3Geəfv|IHΣj%I̞"?HIrgO y.bit`ZO*(f9EwtZYb]&9âdaҎ{a2@dz/Ug&K?4X[2ryOI \y[mqdRoK2(^BlXEp)PύAƣs4hr~802b>X+^Dc v")SQP_ Wm_lJKc4 rZuzKjv2rM}A[LPV#Oӯ/%@;񝮼]Ηϱz2곐&2sumV=x;$@(zN mef BpHQ l< y0Sc$yWo{N@2x( *7M}w&75xED@+!6z RSngM;IPwfč2FQzGߢ_[bF{! }TcRc2}kh W\HG=3(OGE:4תs2wXr}}#Fz EJSBq |wjÔm pccr5h] hٹqV%'@ 8veϘ6XO";֣6t)%iG:b? Y.H?*k*Y~]*A4>Wbe|Pf DX cWEIz /LחmA์۰5> Z <*Fl8nVLPqsf{S`c73ul-ƌVCK& ФGLX _ZȠwjg3-r,MEFvhd-x@\=_`ko:ևw_0G>Euj,"?7pw?_\="!T [J } 9 ymk<=%BHeQr ` H\N{7wn e1a|qmR輀%ioDw.LXD1(ZŶHZA *,u6?DԷw1Y$U3\"ýR R)YoO_1Lo.Xj2suGb(ֳݸ+ePޑˌ?MjpK=I#Eb~."tt2Ňi>A[W*ltl.b(NPv~;:O)'s %Cu~" Qs0gpv)Uq7Lh?rԭ*TFeBO%?L)NS|)Gd|8bzhHD ܽ!r(7(trz$‡6̡Yss^ c!J@{,!S );hOL:^ @Z{N,=R602o%P;g@iPLhC!NRZHSj_ Úygab>I,^TSai\ 'eZV|ڸ(A̬jL f"b>Sx+AT`" |GeVT *2(c Nd) 4=r#} fs֣]mQ%`ۗ}ezdya{22kwt!0+4.o{!0+M7Bv/pJ/K"tx;*ʘYJ0Xwr3t1ZGG)/G䝶ccEOP_L >}"sj9U`r"Z=4 0ˁtJ•Q9j뀃5\"掙xv2NO"( i8s׬#>: B}Nk;^½)fH C.#F9W'N-% QI]l!UDK|9@z[~@Dun.<->S6X l\q ؁gg~1F<X͐nAo'Jn'RRԀ/QoE~|"]#y0Q=֛q 㝬/xb :f+.} <6Z4 g? 9&\B]D=sf|d(C$hut^E>t %ҡ+ǚf(5\dSxa[g>pFĎ,wj7^xgÁ(֗n@.udẁ Enzq/3v\;l.A`G#0]\L{zdSk aF)ߨìrVw逥>.n 1һ:O5 >\ &s߄b[Lrpt[U7Z5Nô}3Wn.#aFJNA/=NIz6+\l7\|(AqۢIcd s jKBX%rw1|) DEecLjq"S PÓC[}$G_FC X+inGuֽQkuosmpkT]zvͽAC:H+[]ZÎL%Wf$"9L"ÒG G4]taj_1î%I b,ܬ VYQ̼QXrI޽mq`]+]wݥ32FNIyJɵMقyaga>v3k@!nԛ `px.]lIJ4?CxhK !wnLǖT >2c9{1Qs^۠ia.QØUk ?' !Nt}a|/0Ït$@pTB8a,s_Q]M{r%Hݪ @PK.8!؄ą5r0/d>7˫X CVBEA-_V tcZoA. ZMBP)Ёv~%ح)=Qmߌ,ZKnFգto䂌g7DxeE_=LcL@}w&j̇ cp{Lj^we@ǡo )pO۔/rܡ(sU}I+cQYd^ cv3|l_?EhP5 3Y šk |Bg1?qV OL];?$Uɮi}IDZhƳ5˿[ UE !`@ o\Hy uG'. co=!/acz:;À!o#7@8DxAJ TB^a6 hb+uUgaL#. .XT18ОǽTsO8$Xh2pZ3'cXEmfM>9d2j $L_?|0Կ锸dhrƆssSIoP݁DN"q䅎?(~[p2G Tٞ)DcT| #"pXcs >a4k&-:ŧG UmS2@ŊG)0%$XGOO 8T+5;=G(QJ2Yxʯ~1E}]x4b5GA2=S^?1@6V>ݥԎ.xZ岙+3DN3`=B%{:Ʃin]IXĮqb: >4{зh<,gromӶ4 !|cn͒Џ+9RRC`&yUu2畵20&9D^8ЦT^Ė|ڝLgX5j:֙gd㊿ֆAgx`rǁ[$1G#lZUH`vO?05~i3 {Cg_&ŐWIYsX=~(ԉ;_gBf !8pf^#/ ܍ \G!J@i6NcƈUfCUp.; %.21R&hw^.Fj[UjQOЧ ^+r"#ӸGeUlflTٿ3b ݶDGb-B|Lm}*n|_@?,4헗o`>!o̥_COٷDjԹpK۫6-OfԄL%~HX"QfD"Jڞ=,5ylDz2o:ǻ)F\ӝ'! h"Oz=F#!{[&ߦ_M,q*b1BŰz0/ ҿBtΤONGWY"xm`%T)V{ IOVH+9X b(^6W%Xw¬eheiVz4_a OHgē|iꄂu'B^]}I:νAg'uz7GԜM}ar-l5 St'P hZ +bЙ`JAdiC{]z F:o.}we,W7 ܴuMa49td3p#WT&Bx{f?ޭgEءؐ RvK]% |z\ ՙ|"DDs#I#|Lpq[ ҂7巾!$ yv-;2g 801`\[WJix TcYw\w$ :C<#z:te Nj-|;q-G"XZ}7%ۆ`oi~&4H&Dϝ!a3$;lVɄVq x]QǂE*YBr5tDΆ-KMNB|&Rp/(WPD"CJ;d$Kwou缙cFF1"D!x7IiKz74i;Hgdzs( LcZ9e36b^?|oB iLen|_zRA٪ZBfo'<[2j ܏1 B() F]YK~%, MJ8d]y9MCUE+`~9w/Z#U Btyawkt -r?Ye /{v=I-Uw}# Z{|BQ?.3xJWgsȬw)5>c&-w|!7 j#]c_p,'"JgT"[5=Ji\[VxẠSr4b$j8VDc'bpa^?^r>ou|>o;t,K+R kt4lI쾚9QˡwnLr L%Re,3J$|mm3.p:d}#g%[MV jMS^ÿh/(jx#a(1ZO2J1LF[S."RTۀ%}CpTP^$a- ))'mDBJdݴ?V-  y`:.̷{~=>̀rl7UA5__៉.Zm|YuPLq c0=ZWQ2۫?y~f]q1B;x74$vs*jx}0ըk8APj QAF?&1p HK椟k7ey/WyW0P}^V'Tv2J͖?\O2۬>q:].}ht,Y$N g wy(Hwp=D Rm7+;"8AZ):ՇVQ?9'!}wi#dS&}A/۰|CoVH \C(oM;Fԕ}!h+ aƔbJu-,Rtm 7ix^-*AFd`a39u2gy7XO&E~z?v}'̂]X,|q#U:7R·_=y75F  wR㞲:Avr=k%sEA,ߑ06,VM,*z$ \M)M'~p{m5su.aPO0ͰK;6, hLVٺк:y, h4ͦj_~叏z#RStj`IAMQ"{f\0K4ϱ@CLTԦ)?XbvM"̤'DZqJȧ4EuB_~x\3lr,&O.K31^8Br? Nos4cojP TwBv.Lܟgfc0{!ͳ? B$@>[f&Xgî*&gZhÊx)89炘+gkǞOGG]q⨯Y-jp|o@Lbqt#ua";^ѷI?PvTO@)RkOcDžY\^UbH =؟NŘhP.\B`qŴ;~ y'G>ZF5dMg "%摶Mtj=> {H!r73R |Mna:?n"@uZ젖"cd&Ž~ebaf>Gddf߈l=#ͼwKT?t!Rq)+GOB*W@tjkx!bQ?l9gy[PHm= t_@zN|&.aƒS֋oLKUJt_aA RwqV1*7ӟ% ^{e?joDy[A~FP7bʛg­X5Rj 'MEb2g˚x]ֿaYE, 5߳Dҍ6hɔFO%\INDr9X #>}qZ]ůHL% oh8(tx#B27|7PLgu:- A 2^B6|1F =$3,jESn1NOn=l<<)/C  w;9`{9n C/B \Q^7t~mtz372+ML-bR0Z8eͮGqn8B&zէv6WlxOdBt}?.5!'37gz{W%ȕVV&qۛN{,c+#]# @zYn1^,-@ _B% J3_:/VR tE]{Nk.jmoxIw_z{ײ; E/3̣90=MG޶j5Lxn=;V,PpGj Ol"5'$ڠK }87[hlrôk l5VJYȮ\7U" JH`D.{,?4

Q複t]݀qqAo)LI,}rRe' F&z9X&O) um,m;+H5>(:;E&0 T 0T;d KWlW3wy;|1]G}o]NP.wMk2bh1,{t&s#z-\ڒx~nMWLN>I&B wW.A?#"/88rB./^1ޚ6H7e*59Vg" 9i}(ਨѪ^f8uy)F}+vpRH3>#$%|fBaGt#Jar]ỷa6!g'/m3auJ !n2טh'>``^IKVGPZA ˝ZḲݩd ZȻG {Cܹ'Bstq3'[ȗ} Vm-+L 0utfKlk'Zp@z [JJ?8cf9et^>JZ&e퓚\=9_cqc^ws<:5tt ~l8"3gNԜSoiiVl;['5Eg Q5{X:JǸ͢:!"E{– ]Vĸ6y S7RU= qȆ7.ܡ˼RlFO^~fr/9~fE;D"qtEst pT 9Ďl,;y+PHGͩ/VyLJqӔHEq]̻43IioGTt9Co:@K N!I AX@CDH2C)>qs) 'yb%1 S}R%oZ2ecqNMQ&U<S5&x գ']ԌH(a3|V‹2-'cӁQo0f8Oxi~OOȓHR$=^ޒ ,[n8ڇC4&`x*߆5%ݢk$3ɻM٧3J}6 xZ1$dbNZUh1YE Ɲ!x $>DRܗr<1ۿbRql#/Pmn< V%S@8C0gGS>y+kM\>Jiƍsí.f_}N|v?WEvz=kޣiCv] ObSp>Q*9 5LAz<"|~O@yE mgS4"zoYB.պ53&$%LRy.,K41O\yg+=eO3}<${$d%©^˸pz|cRe(2D)*B5~ơXQDtX[9:Y%?ʇܲD m+ySDO_m@ưߠ2z?kEJEl"̳o+)̙-.şQ[Uߊ0i%,#-wZ[iUZP`>_ x?^j7uR!uEfje?1GŨx\=\C$1L#·Lo`{r :~7޲ 歴,bO?%ȳq3f1S]Y8U1+k4Ϧ'$mB㍪cA>0YdDuc ^kQXb>oAÅТ_ Ws#ҸK4$Y8cY΀8LXq_BBp+jԗ(3;G~w +HIk|94u}ƹbtGű쯉qA{YNREbGsvsUtnˁ# ٶ:*V0+sIv/2)L2ənRi)wqUߍv(d~'`2RP*D(!%^QGA):N3ַ[;D-!,z"gUedNٰ= Ű(q6O(H~dP,Zϑ*l'# qv5㑆ғrmȩ<S'{-߅?N)Ċ?G!3))M2. ׍wlx4ρZ4d8deS2DŽSۿ0jI_3-}-VYsg+eA~ezSmz))Ϭ_=Vd*+3.s,cyx_i25Qܿ]x1^fKVG4`]Mk4cR@'( f De֓wa#N?Qi8XTs3*g!bc Q @TC,f\{n*IQZ\ʞn CM-׻K> ~:=%hw~ 6U"g#v57ڦ[6csmR p Ռ[/!иH}zʘ&tFd2rq.2 |ۭ8Yad-=o4~qNzy1odGb=ٴ\aI:JaN䟈@P{ nJ u9J0 ~@*s=Zܫb7Dj(uoOQ)?qЃXDqiWkh Y!f;VqID*OLC˫RG^j|nEm̽OOvąa'MJ9:ɳJZ>R!*@v| -RVV7E{i7xNҫ M:m'_/R`f'U}S"6M.xQ"q\px0 AQKKN{܆vgBSSfG/Zr=F6oD*Mb0ȝ m(\)J]Z@Ar )"rW2/IB5z;!! ;ڢ_]utk !i.aog0~<8Pi[_l;% m&؋Et %OՄEޒ"]:PΜ0N-G\ Ez} Z]Ex.mFo6޷@ji2e=.$CG ]qg;+ -g؆CeH;_sŵ\%KK𡳐(k@).Ynj k:%r@?V)tE<}xIn?,雴`' |e}G4\%;_pֵ2"?<6Mli'hկTUZ߮jwaY0{ֺ +L6"Q'&ZVnFwH|5tfLKZ7؝-JY"KQ U g&C !jQ*Ti|?ؾY=7L!thp7|^"M~ yê D 3Ak ?'{dkb7qHOJֲm5%L*{ȹ <;'Sd"y^.OH⹏P347xcD -K ǻV$-XI 1=0h t$ӷp穮U_iиTWK|&e dG7Q%ceÖO+VyDI%?J~ɗd&*b&Wfr!JVkr?-Jz}"Uƭm)X$~U.5NPmed`ږ!8^@榩7)n^XoCO_/Ƙ~(|s}X=7" {oعvo+<,2@%bhY_hvEd{g7˕\(C~غtg{REn}|M /ᰒjL\zǙp׷ҼgʞP/i4uE;(8ㅅ TDlTcL" $ JE^P!fiBK<I邵6 7*9T ǝA|qgk_oEΨn2rO닡 c0<^k1!~!¤8F$nrå3_U(j^BU⹾Dxz\u#S㬄R-[]U'U eo<,W~ sC6icd| FA~WPx"q$"9zeGs9BUK/S͋(&)WBk aSfZOi{ p_ "u|GZoSMw1t:*)\UwR \ALaUyK±ö uI:Ydg(4%f ђG+g'{REٱ*]W-9v<*G_m&YN6:ߨd:tHg+ ,D<mi_ 7 / se;<\>xD6 ]T 2O8AS`4;ءQO/ojh㈵&Մxn rs;6޷fo><6hVR?hVm/>$=?kbՄq}%EExJ(ڎ䛎 cU}>*NDztpE"~Х$f$cˉw%7][ ܻݎCP"IhﴋN<1$a: 7t8, ^PAezʈ<$}"҂֣Z~3&;y*흴֬ӝwXi'CyuNF詬n:CC6:z}1q](:a;QuQe4zZa4d`=ϗGw 6o8:ʒl$(_;G);4Y6E OlkyX ް!Srv68 9;L(fW;lF \ Nv$ESj¶ADJXk&\G%s XG$i.+QY2I9"(IJB G0\J|ZѪGdy&ē9E\%kEחno|79 8í^WI?W/kח!$4|A; ݘ p5m`eK-I]<$L]'t}ꀐkQ~6ܚјSި[/Y}1oG vA$xC]X }~{}_tkj= =f1jeDk*5UP%)3XD|"Dnњ5 ǂOnp. K7!KB1qZ}b>n2-R TOzm 8\VsFlI,TtMJBcsarBX&BXo@bit诧@OۧKg hʉ*{E5Ѻ{_=Y黉i7Z A5GN΃ƽ~(#n>Y:c\خ'>9̒d \3L1Ԅ`$[[~QO/oz0š/du@Evڢ@ͤS;jS4ٓtޟFf|zmΣ4|H/Kdw1B%v1i`u6W95-^`/MEp:=M^s[Hl-jHÃ#ԔU'6Ww&ԫgh`P҉0ș gR+@Sk@lq~a$Ht#SvqhŻV1NØxJ',ȫGj-!YgH 9&lPLPOq=EWv.Ʀ)xɃ39Rd kTG儳W s.Hnǐt⢝QB+9u)h9&R*|<@P֕?AЫ)d5xCU ƘyZpyi:o2Y);x;˩iF!z>L ?_1l{lĺLZ$ۄ9_^A&)yAe-0%&pV\dS燷}rF3K࿮>~uovȪWo:${ZӶ F|0&dc ,a4ސJ2YFsa1jI0 4Kr Ѥ}ZUeJsIϾ'<azÇQ (PR f;-v¨q Ķ c_:9lkaƞRE*eB-PBkeUbv KwnDm7P73A:yV4ݻ3*ոt<w4t'%*dѳcwyh[*ZtȜ3񨠪Luqd_DVqثZv±C*bz4!{%(Jb =} ׯ<2@SנN3B;]FoMN`,|0ʇHr1d Al=&O½p%k#:ͨ Uz/jAd2ajWzY}l3#춳3<;LFQKyH#ɑ[g| &y,? u2dSth" +Dw6[ /.G-UvɢkYGe;HYu>oZ62W)h櫑s^0.)`n3U3$:ptnK8STNF B ^)’YջgK`'Ύ6llnfaE 3N Knl!'KaaTpUQT۷tk~ 1tQ]^0pӫ§ðQ#0BÕ|tê*x5U GةauAT`Z$LU>wgCv<}50|Iq lv%Yx|&i:32KQEWCةF8L8% :j=GF6.;qH`W!t--[ Ň-ecoeI)s8U,c)%#ϴlvӸY S/OP֧2f9lŞ{l-uU'_hhAż3z)p?Key@R"r$u%V-}=. P>/yĜBJ%^kRYAA t0::1{@2Gh3׮}Su?K5Qd?NtQJuJF%^7kiLn}6p P F[h=3_[~2HL&%h 3;!2SP8ڲʆ=b!`_M`xIm[f8x?-ֽ6E1wGTgSVqrtw'-48]h죥us/$?Gv^) ){6.lLnF Z GbQf gIXWե(Q I|)QR޳e5DjhU1kێW 6?1|qM)ҫ}eVdG,Z4 e2yE½gu5Q@#gB*_dgCS*oFs)CؠXYB`A.El RP`|~iE.]\i"Α {>A;4G䨥NHq=+zK0p\nQ )f!hb2wK{` OsY A /s4Z+B>6.kC%hW0&kt37"Ӄݸ~FZ4iӉdo+JfP.ݣ8ͨ[lY'#׀!r2ʊ >yЩ22ӬY(B 2*_5o~L+;]`͚(AHMBGKqc\-0OOWiZfped ;r-8[)h 0J꯸'CI[8v/Sc^"KQ \庂 <y`6,c~*c+3O _d l>+|>ӌ#Y. Iyl cfh~׻R:y<p#}]v bʑox|Ė=rFqU Qneaw7w*a5680TgC?L})E)ɣŽOu9y EŗC7#'KǬ}:C*$ތPk;/+?XR9ew!`o.ܯa^ZޟOB9R ];ߞOmi1+%!H S]_v"!8,)BPtÔJ| og'Z۹BrFk~d)tP"+%CYEYG}4Xi`Rr!|~t87I eU0Ŝlr%؏9a""'q)q($xh&Ώٷ;.i)A`eSlF+f;Fg\X+dv-2`R'cۇL=?JLl<$i[tHҧInuR㢌𼎂 `=D7rS J>$/T"rݔHu] a?y@qZx KvgCXx`*jv8PX2b˾Ӭ-!RE'YC(Cr& "&k}CFBL5h}C$6e->/ʾ@H: H[A>+.u.u9z|Ł^4O090 bZ6Ԓ U\4TzaQm)kSNbH#%T @"؀_rHw0,ƌk0gDMȗv/K G+-`8 jv(4jlY& -a[åxS%[ OU΅^E'9NY]icNG_x& 28) iܟz+h@AmaϺS|EhUfy<㻇(ԙo.+Ƙ|yڦ<s9 $Dׄl%/X. Id,Xt廉Ru{sz\qIc Ղ.3mhBi|?: x?D0 l&Z!L% Y$2(b=)ob@ "B.C3v zSrڑDT1"(p+!WL\D41$ w'|X` #hkpi0c$Wo*ۯ3H@Y5q EZrMu\CMIMA:o-+]KxKxbAO󕔿wtEfd->t$q@PK<B~Ŀg\w^@ٞ*s8uI J1$aY.㼆̞N=`=Wl+2) qaӡTHƒFUBQٚb0\R{BcOQ u6>sED:Ԟ`7$.cb6+S!h˶%qZ)%'EƅwajU`q)-&C: M9Iw1"*I>x6u#LM'(,o :;ʎH;ڟ_:#P2kh,rjg-f~Ni7`]+^ՙfT*]|(&T 0'lQ笝bjO[@(LY5%wٚBS2 `w4e*쐺 Q pFLih"5Z.&^XM /vzQ< 'Wp3'ut^mf}[Qf2w8)y(G"!哙r$ 찰!T?C.K$n4E4v$Z pAG#!SzĎU{/?$5%aJgWY,k/m[QcNUL]/lhϓjYk$G?-B{eT{V~efs3v^sN kPo3ևW{]*=Rc_XGS\ St 4ug6a޷Γެ |$O@J6<) 4wt½@vB'Z8qA]Șa6@ @:2H*\Y;i(3SXA84?zf=Di30%X":ȷenȆ)?~sG V'g)JZ-ADDfCfABs0gPk}>Wǿ+5t^!K, =KoBҴ|5:/AIeG<}^1anX!Lve?@C3Eo[2y j |L:cw2AN][,%\~,η՛}q py !|+!vjr±0e:HiUU{vo'I_dY5 ^p2?N#4^TBKY7(%) ?!ύ`Eed^dbv{) Ghrnh4S2ٜ Rv@:0~J!Hrh>-%h6$WUDO1S.C)u9%j%ݵߞAiXl>py~Y5PPCOg@!' \8OY,`_ɳzJ!4>>vq z߮oxMzKiZ7!<;]?[܇eAZ%㌮.߮ƌ{< fǍ."h"E.X2e|t"s&iA_ڞz g9S.8&9/ͰzYx?8V/&(TWMX+ʌ{`]V]t{`.a;CAo5!ɔ/ջ  d+*/G-jeɠsf{سp7UszO2tm>]uו ؓ7EՌ!t/w:G zxcDÄ](+Z V,}v)h<wp$spA'XUUxT#k%; uw p.g1vYZSNC4L)v6hNla$Y0bn0G$9lA-- f;lxrBpW`5iRGD פPuuD@7X#+ap‰>`IVnV)w"c\L+:._IlbuFtݗ3ï|2ZZ5=|QT 4|6O6Kr24!TaF+mA;'4ׅ\/[g\lc y㞽0x)X'?3 ] #͏j}d[!UUV[LN3eБ%Z6r2# L [uט6/vveښ07]-@J^@ "R7yw'*41SOI? hr@Iű{,߃=_q-{51Bi@%`pa 0C gvdz2WUqDbŇO:Mq%2=L=q^,&1 ̪5$N]-/2~4piȟ~C&C%omK@YU汶P ɿ|D?hB`dÜ HN\cW}#\HkpLEeuxjLtAv~`6cd }r!p<^BLO /߫fA jye 9! Pn'DV۹ `;Ǿnk:55GiHCyF RT|<˝6;'˹ ӜBReF(YH2qHHlplq#21}yO%2zn.ˏd怓r6TUkTq"*IH | ]rQ³~oh 2\ H03TA ,`2p oPBxnI%p.):ӰPI_e[P=8dV,>q { FVcoa)v "}bg^{ujv)֢K"_LI?9]yT_=h%TXmKThЦ+^V܋AŒrp6^Ҷ]8!WqҶڪ<$:RWbA<Z&Ep5/deDJ" B %n`6M rGn||})(i49X,zo2` w#.vجvO_ԳTְw͈j;v٘pQKwoza^eGq _nדP<4g)OQؘ]sġ=rY|Qez$uIaq+{32l)6qg5-d(>{#ܮ>m[^cJr~0Z&5#)im%pOWgKlR%D-  NYFB y-=417,q E ʥgȏpUlI|:$obC@hO }imXR;l2iԿsPfҳrv:<8峰S>WrIp1E^ NJŬٲx=bHDʊ„toj2kz?,ώ6g"PYՀl0/.om?iR1#ԐI_'T7'yQ@z2b=K^-Z4nzϙRp-Ҕf&%Vs\="Qǽ7m?aAe9~YL5.i mq ФB垃< }CvJ4H61 zw<>.( ) Qu95:5q'c8U!Տ#Cyfb<=:Ҽdйa8a LSgerv1Rt$lMƂ;߶b86δKAR_jMS*1dBAm3Ihxå%>|+YP텾BxZrUZl/_iY"8jw5#!b#&~v900Sۿ#ZKhg1H?ء{7`@W"|I ǫ!t[By#`6oY?]1K?ʩ3e" zcVMV4wGv`f6~{Sx|Ȯ MDz΍K/U~xCFEai}~P/2!oz^UlSZ:ym Y#GiF㏿kg+ΩK,2`b ;R,:͞}-\J! cY٩ j'/m۵a݁l)G?kA2'ծ`Y4޺N}+T,H ,&\WQ?wJ;nCwU\C{=W E9 P%B!5ssq !z1s% KH1pTBsS,LC׵U;F4恵1]HUG/ww=NOkp^N!n? :8,"[F1X-X?0alƴ58\k">/<3Њפ30ty3!5vюfRYFeixm#NېHݬ8a:^O poٯ֗{7Y,#L?5Vm\~NjH*6ywwx8Y{Zh?eYvh fE,+߾MZ"Ne͎{YY .)*pw~YhTRIٝ ЏGѤ6̒ +epFa(CEAҤ%ǚY aYnBlfnStZvpZC薳 ^kPd'Vư~1G>ߐf;aDZ:4#uD@ሇ"+2`E-ys"й&EϷ 6\'qsVm׊/EgAj٨!j_uBV5>vayA11E>OQLviA6K%>zNMSZϤdkS͂7,8Q I_0!Q˽ȵSpE|?wEc';D{IU`]*1☔<+qdDc &EOFnWMIި#0Oa+\/V]uny( a? a8"[<[V4_(>öjy/}3PNj6h9v TaW^˕h y2QVs]..]#OXH k| Yh*,<( !ڐ7 $aoyx9NDSl)t1Ҭϗ+t̟th8_0t?k׽U:3#vcӹ`|Ӧ WS耜#轮׾TMG!}ϸM{a\fRX{rq/O'茙}G[mñκ9KHAd&+}&BgWsyχXFmth]J]_kP²$t (-JLN>G'J*n?uF_#=HHgj!=gQ鿫hB4[LVwU]~2!Ȇ8?,Ɋ]j ()i:YG4ӧäkE `pI^XD'(6lc4N=yl)eE_zllF9xΦ mi)XrDnGJ"n#FC괩1`$-".OrHfSz~@+~Yylp\䢣Z І+5FZOdWT[bGZak kbNn@dlwN.R)Ŭ(z߈S#m\١lkuL-`XnϲF8a-f$b8!9o4&SK!mî*C Xeɋ!EvȧM""E=jwN%ߤ@w61X1j:0'Y4jqmk,AB\QmE7$ܒ;`fP]Eͣl 7`4\rY;!74z"'o14JѱJ.1Kå0'MrpiCU} ޣO ?LRs}Wx +'}hGb?4Din? a筿LbzCYxjMya3oFMϺ)5/uu+W=bd@ p'n+cu+ \U N>mdCUPAbnݵLJ-KQla.1/B_Çf}iht(TjEޫ1c]E6Fq[$4H߷{nO=E#_%[u_ JtўׅWdMUn>CU2.7adU*SK~TX!No-uJVsB(!j{?ԁhb 4#;_bp!=0B ?&YP'y_W,C\yۈԸIb.WIvKǣQDx<('i :(\&m~c^MyfC˗w6-eO̳V$G8|&-c{)r`ÔlQtE/3@-pňA^z*Cn1Z~-Ƙy߁7k=?t+l%+Hh[CCPU |DF'c/0}7ʗL`vԟ7Kb>GnPϊ1IS.fM]r3=}vz qն@Ϟn:u13֗+pt)9޹Lo0O^ܬ['RE}oN,\ۻ>HϾ\-lAH@?}g>r#wTRxo_vh~5!._ &zVt&HH?^t8x3{Z gIy*0t;9LJSJD%(TT1U깖.7;srl૬wY3jD"^|u0,ge > (̇w`DJY(8r,A'@6^C 3{/Xَ]mG_>;Q8Q+cʭŲ;-  ܭ+% oAo'e=^Ĺ?-57Oz?6Ł-~Z .@V3L5XiJyg fCkK QCCazk0YBl]l1sIuéVfҬZ=mrk\&9PY'9 X Mx *T# ~A#iq^9(i&'(o>b. #O< ;@" Z;z:/ʋuyT\Tz~ "3FN|cH8B+uhl16mF׊˱DikJ|" [|L- !5zE&"A4^*/FO;W1A˽N@C?€q%1Зw-G=T!ڃyeAPPs3߫dʹZн!O˴uԙ]dKOhHZu\8Tш_Outԟ7)(S)^%@nޅTX޺*Å onr耺$w`ӊL=/ !h(,T=q?"ϚH 9!Of0U:b&1 WSPJS{_K,4 |̪po fH|PacHZ`ae,PaAx1/ TR]ܽxdY`ulb¯5$푍u78^x, RL>oYt7'^^Zqh0s8dE,Ĕ/C;:+lʦU]C]奄I?`u+[exA"44SA|kt`I6{`f~d2NXNZB𜥸*ƾv^3T@0un* c\㼕.WW֖pg-C=Pzn4HNj$5y^)r#O,sI'}Աґ&kCsu+>O#q; ycU/Mt@d(Om G:K'jqŷ<-qÜB4B?\;>Wa'fjqs8H>!kޣ]2HqvW=&dN*m 9@ˑd+Qt+4]ؖ@ >;YO;%ynta/%έ+z}_z,(nNNP7g|jv9H @Y&:lAmQy~իD65fngPFDpfjdxFA*=/ W09lu;*s1nmFsW mVH5ގ] &a1R{/ɴYIݔXkAafHm޵x{OinpJ8ɑMHl~_bu讆FsR}{ SvtEn!凑-sufw/`høp]hNtZF4PXB@^\R@44͑9wMqV(#,fmkG@fG>J:ЅoD|o(}8/M0e Iݧ;ᚡlUa?`$we. F鐼,FNbxD~N|u=*q;a8(/5} i8~NVx_S#'B+%qtUE";ť@}*Uђo42DBl3uVB!F]5^]o&q+8c!JYH!yGu$%IS?c|jy'́ζ4_D H2&^97<5Q*{v-t1];v2ǣ:Ckh|Ln;f a NKPQ8`)G&9$d]tH?V1dዜEB!Kۨo_:P:γb{/퇁J5>p6u_85t+pλ:.r֞mmE׮X R8x֣y+KC$>z1×$.VgĸJA?|A&F#Z}6Ƅ^Q(x V>b;:("'ȦfvuaUɭ S/t-wgm垔qwa~ؐmoF0 љW?LL_ u0>f?.A?jh[MJ[(iؒ0(U50ɯs>w[e<,qq`(֝B-Q %}HY$NBb⡚p ,GA#-ѳx? vb8r$<}!k^$EOJjs4λ[!}UZn\ [8PW!C 6MHmxz#ҬߡC?L񢘏h.u~>j66Dr1O隼=煮 ,`zq7Zj)A+b NZB~8BMxJ7c)o}N.`n^*xU*/Ց(m`&c*cƩy;*c1"T~iCՕPLB ֡2pJ|cyRcZADMv> f*T* ,Ͷ9Mm3+]`!uId8^T r?qmk洩g@$C+xvnY G[k]RLyi@ u!PlX՜T4Co_4NմQFp3 \@^N& 8ncE4>g}? j9YǷ,v,HIBK[U/H(E2L#%Smy"\}\XndClV[EԘRYkȊ]V+ Mz$)?+xz=]Kc? [f.pr秱gYZ.shstrtab.note.gnu.build-id.gnu.hash.dynsym.dynstr.gnu.version.gnu.version_r.rela.dyn.rela.plt.init.text.fini.rodata.stapsdt.base.eh_frame_hdr.eh_frame.init_array.fini_array.data.rel.ro.dynamic.got.data.probes.bss.note.stapsdt.gnu_debuglink.gnu_debugdata 88$o``7( ::0Ϊ8o~~Eo`Tpp^Bhhh@@c @ @`nРРUt(C(C zPPC ''''((P-P-X-X-`-`-@ S-S-U-U-9-- t  1 1@181 8114 1H D2